Symbol:
Pax6
Name:
paired box 6
RGD ID:
3258
Description:
Enables DNA-binding transcription factor activity, RNA polymerase II-specific; RNA polymerase II cis-regulatory region sequence-specific DNA binding activity; and minor groove of adenine-thymine-rich DNA binding activity. Involved in several processes, including endocrine pancreas development; nervous system development; and positive regulation of macromolecule biosynthetic process. Located in chromatin. Used to study autistic disorder. Biomarker of Smith-Lemli-Opitz syndrome and transient cerebral ischemia. Human ortholog(s) of this gene implicated in bilateral optic nerve hypoplasia; eye disease (multiple); glucose intolerance; and paranoid schizophrenia. Orthologous to human PAX6 (paired box 6); PARTICIPATES IN maturity-onset diabetes of the young pathway; INTERACTS WITH (S)-nicotine; 1,2-dimethylhydrazine; 3H-1,2-dithiole-3-thione.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
oculorhombin; paired box gene 6; Paired box homeotic gene 6; paired box protein Pax-6
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PAX6 (paired box 6) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Pax6 (paired box 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Pax6 (paired box 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PAX6 (paired box 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PAX6 (paired box 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Pax6 (paired box 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PAX6 (paired box 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PAX6 (paired box 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Pax6 (paired box 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
PCDH1 (protocadherin 1) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Pax6 (paired box 6)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
PAX6 (paired box 6)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
pax6a (paired box 6a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Danio rerio (zebrafish):
pax6b (paired box 6b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
toy
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
vab-3
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
pax6
Alliance
DIOPT (Ensembl Compara|OMA|PANTHER|PhylomeDB)
Allele / Splice:
Pax6Sey
Pax6Sey2
Genetic Models:
SD-Pax6Sey2 /Mce
SD-Pax6Sey /Mce
Is Marker For:
Strains:
SD-Pax6Sey /Mce
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 112,590,034 - 112,611,771 (+) NCBI GRCr8 mRatBN7.2 3 92,128,772 - 92,157,022 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 92,135,637 - 92,157,014 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 95,631,693 - 95,652,650 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 104,230,622 - 104,251,579 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 102,058,594 - 102,079,600 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 95,700,241 - 95,728,682 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 95,707,386 - 95,728,624 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 102,320,059 - 102,348,223 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 91,127,605 - 91,149,178 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 91,023,827 - 91,045,776 (+) NCBI Celera 3 91,190,477 - 91,211,449 (+) NCBI Celera RH 3.4 Map 3 722.9 RGD Cytogenetic Map 3 q33 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Pax6 Rat (-)-cotinine multiple interactions ISO PAX6 (Homo sapiens) 6480464 [diethyl phosphate co-treated with Cotinine co-treated with bis(2 more ... CTD PMID:37914285 Pax6 Rat (S)-colchicine multiple interactions ISO PAX6 (Homo sapiens) 6480464 Colchicine promotes the reaction [[4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with LDN 193189] results in increased expression of PAX6 mRNA] CTD PMID:32949729 Pax6 Rat (S)-nicotine decreases expression EXP 6480464 Nicotine results in decreased expression of PAX6 mRNA CTD PMID:28555334 Pax6 Rat 1,2-dimethylhydrazine multiple interactions EXP 6480464 [APC protein affects the susceptibility to 1 and 2-Dimethylhydrazine] which results in decreased expression of PAX6 mRNA CTD PMID:27840820 Pax6 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO PAX6 (Homo sapiens) 6480464 2 more ... CTD PMID:31173147 Pax6 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO PAX6 (Homo sapiens) 6480464 2 more ... CTD PMID:31326446 Pax6 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Pax6 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of PAX6 mRNA CTD PMID:24058054 and PMID:37172768 Pax6 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Pax6 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of PAX6 mRNA CTD PMID:19465110 Pax6 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Pax6 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of PAX6 mRNA CTD PMID:20188158 Pax6 Rat 3H-1,2-dithiole-3-thione increases expression EXP 6480464 1 and 2-dithiol-3-thione results in increased expression of PAX6 mRNA CTD PMID:19162173 Pax6 Rat 4,4'-diaminodiphenylmethane increases expression ISO Pax6 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of PAX6 mRNA CTD PMID:18648102 Pax6 Rat 4,4'-sulfonyldiphenol decreases expression ISO Pax6 (Mus musculus) 6480464 bisphenol S results in decreased expression of PAX6 mRNA CTD PMID:30951980 Pax6 Rat 4,4'-sulfonyldiphenol affects methylation ISO Pax6 (Mus musculus) 6480464 bisphenol S affects the methylation of PAX6 gene CTD PMID:31683443 Pax6 Rat 4,4'-sulfonyldiphenol decreases methylation ISO PAX6 (Homo sapiens) 6480464 bisphenol S results in decreased methylation of PAX6 gene CTD PMID:31601247 Pax6 Rat 4,4'-sulfonyldiphenol increases methylation ISO Pax6 (Mus musculus) 6480464 bisphenol S results in increased methylation of PAX6 promoter CTD PMID:33297965 Pax6 Rat 4-hydroxyphenyl retinamide decreases expression ISO PAX6 (Homo sapiens) 6480464 Fenretinide results in decreased expression of PAX6 protein CTD PMID:17110918 Pax6 Rat 5-aza-2'-deoxycytidine increases expression ISO PAX6 (Homo sapiens) 6480464 Decitabine results in increased expression of PAX6 mRNA CTD PMID:16367923 Pax6 Rat 5-fluorouracil increases expression ISO Pax6 (Mus musculus) 6480464 Fluorouracil results in increased expression of PAX6 protein CTD PMID:21296659 Pax6 Rat 5-fluorouracil decreases expression ISO PAX6 (Homo sapiens) 6480464 Fluorouracil results in decreased expression of PAX6 mRNA CTD PMID:30518710 Pax6 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of PAX6 mRNA CTD PMID:24780913 Pax6 Rat 9-cis-retinoic acid decreases expression ISO PAX6 (Homo sapiens) 6480464 Alitretinoin results in decreased expression of PAX6 mRNA and Alitretinoin results in decreased expression of PAX6 protein CTD PMID:36805303 Pax6 Rat abacavir increases expression ISO PAX6 (Homo sapiens) 6480464 abacavir results in increased expression of PAX6 mRNA CTD PMID:31711903 Pax6 Rat acetaldehyde decreases expression ISO Pax6 (Mus musculus) 6480464 Acetaldehyde results in decreased expression of PAX6 mRNA CTD PMID:22634333 Pax6 Rat acetic acid affects expression ISO Pax6 (Mus musculus) 6480464 Acetic Acid affects the expression of PAX6 protein CTD PMID:21296659 Pax6 Rat aflatoxin B1 decreases methylation ISO PAX6 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of PAX6 gene CTD PMID:27153756 Pax6 Rat Aflatoxin B2 alpha increases methylation ISO PAX6 (Homo sapiens) 6480464 aflatoxin B2 results in increased methylation of PAX6 intron CTD PMID:30157460 Pax6 Rat aldehydo-D-glucose decreases expression EXP 6480464 Glucose results in decreased expression of PAX6 mRNA CTD PMID:21818840 Pax6 Rat aldehydo-D-glucose multiple interactions ISO Pax6 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Glyphosate] results in decreased expression of PAX6 mRNA CTD PMID:37567420 Pax6 Rat aldicarb multiple interactions ISO PAX6 (Homo sapiens) 6480464 Aldicarb inhibits the reaction [[4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with LDN 193189] results in increased expression of PAX6 mRNA] CTD PMID:32949729 Pax6 Rat all-trans-retinoic acid increases expression ISO Pax6 (Mus musculus) 6480464 Tretinoin results in increased expression of PAX6 mRNA and Tretinoin results in increased expression of PAX6 protein CTD PMID:15996115 more ... Pax6 Rat all-trans-retinoic acid multiple interactions ISO Pax6 (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of PAX6 mRNA CTD PMID:36189433 Pax6 Rat all-trans-retinoic acid multiple interactions ISO PAX6 (Homo sapiens) 6480464 [4-(5-benzo(1 more ... CTD PMID:31711903 and PMID:38070836 Pax6 Rat all-trans-retinoic acid increases expression ISO PAX6 (Homo sapiens) 6480464 Tretinoin results in increased expression of PAX6 mRNA CTD PMID:31711903 Pax6 Rat all-trans-retinoic acid affects expression ISO PAX6 (Homo sapiens) 6480464 Tretinoin affects the expression of PAX6 mRNA CTD PMID:31600526 Pax6 Rat all-trans-retinoic acid decreases expression ISO PAX6 (Homo sapiens) 6480464 Tretinoin results in decreased expression of PAX6 mRNA and Tretinoin results in decreased expression of PAX6 protein CTD PMID:21934132 more ... Pax6 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PAX6 mRNA CTD PMID:16483693 Pax6 Rat Anatoxin a multiple interactions ISO PAX6 (Homo sapiens) 6480464 anatoxin a promotes the reaction [Tretinoin results in decreased expression of PAX6 mRNA] CTD PMID:38070836 Pax6 Rat Aroclor 1254 decreases expression ISO PAX6 (Homo sapiens) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of PAX6 mRNA CTD PMID:16934159 Pax6 Rat arsane decreases expression ISO Pax6 (Mus musculus) 6480464 Arsenic results in decreased expression of PAX6 mRNA CTD PMID:24019935 Pax6 Rat arsenic atom decreases expression ISO Pax6 (Mus musculus) 6480464 Arsenic results in decreased expression of PAX6 mRNA CTD PMID:24019935 Pax6 Rat arsenite(3-) increases methylation ISO PAX6 (Homo sapiens) 6480464 arsenite results in increased methylation of PAX6 promoter CTD PMID:23974009 Pax6 Rat arsenite(3-) multiple interactions ISO PAX6 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to PAX6 mRNA] CTD PMID:32406909 Pax6 Rat atrazine decreases expression ISO PAX6 (Homo sapiens) 6480464 Atrazine results in decreased expression of PAX6 mRNA CTD PMID:34146662 Pax6 Rat atrazine multiple interactions ISO PAX6 (Homo sapiens) 6480464 [Herbicides results in increased abundance of Atrazine] which affects the methylation of PAX6 gene CTD PMID:34516295 Pax6 Rat Azoxymethane multiple interactions ISO Pax6 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of PAX6 mRNA CTD PMID:29950665 Pax6 Rat benzene decreases expression ISO Pax6 (Mus musculus) 6480464 Benzene results in decreased expression of PAX6 mRNA CTD PMID:15120971 and PMID:15122651 Pax6 Rat benzo[a]pyrene increases expression ISO PAX6 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of PAX6 mRNA CTD PMID:20106945 more ... Pax6 Rat benzo[a]pyrene decreases expression ISO PAX6 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of PAX6 mRNA and Benzo(a)pyrene results in decreased expression of PAX6 protein CTD PMID:30659931 Pax6 Rat benzo[a]pyrene affects methylation ISO PAX6 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of PAX6 5' UTR and Benzo(a)pyrene affects the methylation of PAX6 promoter CTD PMID:27901495 Pax6 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO PAX6 (Homo sapiens) 6480464 Diethylhexyl Phthalate inhibits the reaction [[4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with LDN 193189] results in increased expression of PAX6 mRNA] CTD PMID:32949729 Pax6 Rat bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 Zinc inhibits the reaction [Diethylhexyl Phthalate results in decreased expression of PAX6 protein] CTD PMID:35841924 Pax6 Rat bis(2-ethylhexyl) phthalate decreases expression EXP 6480464 Diethylhexyl Phthalate results in decreased expression of PAX6 protein CTD PMID:25280772 and PMID:35841924 Pax6 Rat bisphenol A decreases expression ISO PAX6 (Homo sapiens) 6480464 bisphenol A results in decreased expression of PAX6 mRNA CTD PMID:25051057 and PMID:28597690 Pax6 Rat bisphenol A increases methylation ISO PAX6 (Homo sapiens) 6480464 bisphenol A results in increased methylation of PAX6 gene CTD PMID:31601247 Pax6 Rat bisphenol A decreases expression ISO Pax6 (Mus musculus) 6480464 bisphenol A results in decreased expression of PAX6 mRNA CTD PMID:30951980 Pax6 Rat bisphenol A multiple interactions ISO PAX6 (Homo sapiens) 6480464 [bisphenol A co-treated with decabromobiphenyl ether] results in decreased expression of PAX6 mRNA more ... CTD PMID:28597690 and PMID:31400064 Pax6 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PAX6 mRNA CTD PMID:30816183 and PMID:32528016 Pax6 Rat bisphenol A affects methylation ISO Pax6 (Mus musculus) 6480464 bisphenol A affects the methylation of PAX6 promoter CTD PMID:27334623 Pax6 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of PAX6 mRNA CTD PMID:25181051 Pax6 Rat bisphenol A multiple interactions EXP 6480464 Curcumin inhibits the reaction [bisphenol A results in decreased expression of PAX6 mRNA] CTD PMID:25963729 Pax6 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PAX6 mRNA CTD PMID:25963729 and PMID:34947998 Pax6 Rat bisphenol F decreases expression ISO Pax6 (Mus musculus) 6480464 bisphenol F results in decreased expression of PAX6 mRNA CTD PMID:30951980 Pax6 Rat bromochloroacetic acid increases expression ISO Pax6 (Mus musculus) 6480464 bromochloroacetic acid results in increased expression of PAX6 protein CTD PMID:21296659 Pax6 Rat bucladesine multiple interactions ISO PAX6 (Homo sapiens) 6480464 bisphenol A affects the reaction [Bucladesine affects the expression of PAX6 mRNA] more ... CTD PMID:31400064 Pax6 Rat bucladesine affects expression ISO PAX6 (Homo sapiens) 6480464 Bucladesine affects the expression of PAX6 mRNA and Bucladesine affects the expression of PAX6 protein CTD PMID:31400064 Pax6 Rat butanal increases expression ISO PAX6 (Homo sapiens) 6480464 butyraldehyde results in increased expression of PAX6 mRNA CTD PMID:26079696 Pax6 Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of PAX6 mRNA CTD PMID:19167457 Pax6 Rat cadmium atom multiple interactions ISO PAX6 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PAX6 protein CTD PMID:34373904 Pax6 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of PAX6 mRNA and Cadmium Chloride results in increased expression of PAX6 protein CTD PMID:30506660 Pax6 Rat cadmium dichloride multiple interactions ISO PAX6 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PAX6 protein CTD PMID:34373904 Pax6 Rat calcium atom affects expression EXP 6480464 Calcium affects the expression of PAX6 mRNA CTD PMID:15913539 Pax6 Rat calcium(0) affects expression EXP 6480464 Calcium affects the expression of PAX6 mRNA CTD PMID:15913539 Pax6 Rat carbamazepine decreases expression ISO Pax6 (Mus musculus) 6480464 Carbamazepine results in decreased expression of PAX6 mRNA CTD PMID:22634333 Pax6 Rat carbaryl multiple interactions ISO PAX6 (Homo sapiens) 6480464 Carbaryl inhibits the reaction [[4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with LDN 193189] results in increased expression of PAX6 mRNA] CTD PMID:32949729 Pax6 Rat carbofuran decreases expression EXP 6480464 Carbofuran results in decreased expression of PAX6 mRNA CTD PMID:28982980 Pax6 Rat CHIR 99021 multiple interactions ISO PAX6 (Homo sapiens) 6480464 [4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with Tretinoin] promotes the reaction [Chir 99021 results in increased expression of PAX6 mRNA] CTD PMID:31711903 Pax6 Rat CHIR 99021 increases expression ISO PAX6 (Homo sapiens) 6480464 Chir 99021 results in increased expression of PAX6 mRNA CTD PMID:31711903 Pax6 Rat CHIR-98014 decreases expression ISO PAX6 (Homo sapiens) 6480464 Chir 98014 results in decreased expression of PAX6 mRNA CTD PMID:22723015 Pax6 Rat chlorpyrifos decreases expression ISO PAX6 (Homo sapiens) 6480464 Chlorpyrifos results in decreased expression of PAX6 mRNA CTD PMID:28112198 Pax6 Rat chlorpyrifos multiple interactions ISO PAX6 (Homo sapiens) 6480464 U 0126 inhibits the reaction [Chlorpyrifos results in increased expression of PAX6 mRNA] CTD PMID:28112198 Pax6 Rat choline multiple interactions ISO Pax6 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of PAX6 gene CTD PMID:20938992 Pax6 Rat crocidolite asbestos increases expression ISO Pax6 (Mus musculus) 6480464 Asbestos and Crocidolite results in increased expression of PAX6 mRNA CTD PMID:29279043 Pax6 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of PAX6 mRNA CTD PMID:26577399 Pax6 Rat curcumin multiple interactions EXP 6480464 Curcumin inhibits the reaction [bisphenol A results in decreased expression of PAX6 mRNA] CTD PMID:25963729 Pax6 Rat curcumin increases expression EXP 6480464 Curcumin results in increased expression of PAX6 mRNA CTD PMID:25963729 Pax6 Rat cyclosporin A increases expression ISO PAX6 (Homo sapiens) 6480464 Cyclosporine results in increased expression of PAX6 mRNA CTD PMID:20106945 and PMID:25562108 Pax6 Rat cyproconazole increases expression ISO Pax6 (Mus musculus) 6480464 cyproconazole results in increased expression of PAX6 mRNA CTD PMID:22045034 Pax6 Rat cytarabine increases expression ISO PAX6 (Homo sapiens) 6480464 Cytarabine results in increased expression of PAX6 mRNA CTD PMID:21198554 Pax6 Rat cytarabine decreases expression ISO PAX6 (Homo sapiens) 6480464 Cytarabine results in decreased expression of PAX6 protein CTD PMID:21198554 Pax6 Rat D-glucose decreases expression EXP 6480464 Glucose results in decreased expression of PAX6 mRNA CTD PMID:21818840 Pax6 Rat D-glucose multiple interactions ISO Pax6 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Glyphosate] results in decreased expression of PAX6 mRNA CTD PMID:37567420 Pax6 Rat dabigatran increases expression ISO PAX6 (Homo sapiens) 6480464 Dabigatran results in increased expression of PAX6 mRNA CTD PMID:31711903 Pax6 Rat DDT multiple interactions ISO PAX6 (Homo sapiens) 6480464 DDT inhibits the reaction [[4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with LDN 193189] results in increased expression of PAX6 mRNA] CTD PMID:32949729 Pax6 Rat decabromodiphenyl ether increases expression EXP 6480464 decabromobiphenyl ether results in increased expression of PAX6 mRNA CTD PMID:23640034 Pax6 Rat decabromodiphenyl ether decreases expression ISO PAX6 (Homo sapiens) 6480464 decabromobiphenyl ether results in decreased expression of PAX6 mRNA CTD PMID:28597690 Pax6 Rat decabromodiphenyl ether multiple interactions ISO PAX6 (Homo sapiens) 6480464 [bisphenol A co-treated with decabromobiphenyl ether] results in decreased expression of PAX6 mRNA CTD PMID:28597690 Pax6 Rat decabromodiphenyl ether increases expression ISO PAX6 (Homo sapiens) 6480464 decabromobiphenyl ether results in increased expression of PAX6 mRNA CTD PMID:31326446 Pax6 Rat dexamethasone increases expression ISO PAX6 (Homo sapiens) 6480464 Dexamethasone results in increased expression of PAX6 mRNA CTD PMID:34742744 Pax6 Rat dexamethasone decreases expression ISO PAX6 (Homo sapiens) 6480464 Dexamethasone results in decreased expression of PAX6 protein CTD PMID:34742744 Pax6 Rat dextran sulfate multiple interactions ISO Pax6 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of PAX6 mRNA CTD PMID:29950665 Pax6 Rat diazinon decreases methylation ISO PAX6 (Homo sapiens) 6480464 Diazinon results in decreased methylation of PAX6 gene CTD PMID:22964155 Pax6 Rat diclofenac increases expression ISO Pax6 (Mus musculus) 6480464 Diclofenac results in increased expression of PAX6 mRNA CTD PMID:26934552 Pax6 Rat dieldrin multiple interactions ISO PAX6 (Homo sapiens) 6480464 Dieldrin inhibits the reaction [[4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with LDN 193189] results in increased expression of PAX6 mRNA] CTD PMID:32949729 Pax6 Rat diethyl hydrogen phosphate multiple interactions ISO PAX6 (Homo sapiens) 6480464 [diethyl phosphate co-treated with Cotinine co-treated with bis(2 more ... CTD PMID:37914285 Pax6 Rat dimethylarsinic acid multiple interactions ISO Pax6 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of PAX6 mRNA CTD PMID:34876320 Pax6 Rat dioxygen decreases expression ISO PAX6 (Homo sapiens) 6480464 Oxygen deficiency results in decreased expression of PAX6 mRNA CTD PMID:24236059 Pax6 Rat dorsomorphin multiple interactions ISO PAX6 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Pax6 Rat doxorubicin increases expression ISO PAX6 (Homo sapiens) 6480464 Doxorubicin results in increased expression of PAX6 mRNA CTD PMID:16404146 Pax6 Rat elemental selenium multiple interactions ISO PAX6 (Homo sapiens) 6480464 [diethyl phosphate co-treated with Cotinine co-treated with bis(2 more ... CTD PMID:37914285 Pax6 Rat entinostat decreases expression ISO PAX6 (Homo sapiens) 6480464 entinostat results in decreased expression of PAX6 mRNA CTD PMID:26272509 Pax6 Rat entinostat multiple interactions ISO PAX6 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PAX6 mRNA CTD PMID:27188386 Pax6 Rat ethanol increases expression ISO Pax6 (Mus musculus) 6480464 Ethanol results in increased expression of PAX6 mRNA CTD PMID:30319688 Pax6 Rat ethanol affects expression ISO Pax6 (Mus musculus) 6480464 Ethanol affects the expression of PAX6 mRNA CTD PMID:30319688 Pax6 Rat ethosuximide increases expression EXP 6480464 Ethosuximide results in increased expression of PAX6 mRNA CTD PMID:26420483 Pax6 Rat ethosuximide multiple interactions EXP 6480464 Ethosuximide inhibits the reaction [APP protein modified form results in decreased expression of PAX6 mRNA] CTD PMID:26420483 Pax6 Rat flusilazole increases expression ISO Pax6 (Mus musculus) 6480464 flusilazole results in increased expression of PAX6 mRNA CTD PMID:22634333 Pax6 Rat folic acid multiple interactions ISO Pax6 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of PAX6 gene CTD PMID:20938992 Pax6 Rat folic acid decreases expression ISO PAX6 (Homo sapiens) 6480464 Folic Acid results in decreased expression of PAX6 protein CTD PMID:34742744 Pax6 Rat folic acid increases expression ISO Pax6 (Mus musculus) 6480464 Folic Acid results in increased expression of PAX6 mRNA CTD PMID:25006883 Pax6 Rat fructose multiple interactions ISO Pax6 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Glyphosate] results in decreased expression of PAX6 mRNA CTD PMID:37567420 Pax6 Rat gamma-hexachlorocyclohexane multiple interactions ISO PAX6 (Homo sapiens) 6480464 Hexachlorocyclohexane inhibits the reaction [[4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with LDN 193189] results in increased expression of PAX6 mRNA] CTD PMID:32949729 Pax6 Rat glucose decreases expression EXP 6480464 Glucose results in decreased expression of PAX6 mRNA CTD PMID:21818840 Pax6 Rat glucose multiple interactions ISO Pax6 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Glyphosate] results in decreased expression of PAX6 mRNA CTD PMID:37567420 Pax6 Rat glyphosate multiple interactions ISO Pax6 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Glyphosate] results in decreased expression of PAX6 mRNA CTD PMID:37567420 Pax6 Rat glyphosate affects expression ISO PAX6 (Homo sapiens) 6480464 Glyphosate affects the expression of PAX6 mRNA CTD PMID:35485992 Pax6 Rat heptachlor multiple interactions ISO PAX6 (Homo sapiens) 6480464 Heptachlor inhibits the reaction [[4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with LDN 193189] results in increased expression of PAX6 mRNA] CTD PMID:32949729 Pax6 Rat herbicide multiple interactions ISO PAX6 (Homo sapiens) 6480464 [Herbicides results in increased abundance of Atrazine] which affects the methylation of PAX6 gene CTD PMID:34516295 Pax6 Rat hexachlorophene multiple interactions ISO PAX6 (Homo sapiens) 6480464 Hexachlorophene inhibits the reaction [[4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with LDN 193189] results in increased expression of PAX6 mRNA] CTD PMID:32949729 Pax6 Rat hexachlorophene decreases expression ISO Pax6 (Mus musculus) 6480464 Hexachlorophene results in decreased expression of PAX6 mRNA and Hexachlorophene results in decreased expression of PAX6 protein CTD PMID:25943520 Pax6 Rat isotretinoin increases expression ISO PAX6 (Homo sapiens) 6480464 Isotretinoin results in increased expression of PAX6 mRNA CTD PMID:31711903 Pax6 Rat L-methionine multiple interactions ISO Pax6 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of PAX6 gene CTD PMID:20938992 Pax6 Rat lead diacetate increases expression ISO Pax6 (Mus musculus) 6480464 lead acetate results in increased expression of PAX6 mRNA CTD PMID:22609695 Pax6 Rat lead(0) decreases expression ISO PAX6 (Homo sapiens) 6480464 Lead results in decreased expression of PAX6 mRNA and Lead results in decreased expression of PAX6 protein CTD PMID:24519525 more ... Pax6 Rat lipopolysaccharide multiple interactions ISO PAX6 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Pax6 Rat lipopolysaccharide increases expression ISO PAX6 (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of PAX6 mRNA CTD PMID:35811015 Pax6 Rat lumiracoxib multiple interactions ISO Pax6 (Mus musculus) 6480464 lumiracoxib affects the reaction [Crotoxin results in increased expression of PAX6 protein] CTD PMID:36702313 Pax6 Rat maneb multiple interactions ISO Pax6 (Mus musculus) 6480464 [LRRK2 protein mutant form co-treated with Maneb co-treated with Paraquat] results in decreased expression of PAX6 mRNA CTD PMID:23017109 Pax6 Rat mercury atom multiple interactions ISO PAX6 (Homo sapiens) 6480464 [diethyl phosphate co-treated with Cotinine co-treated with bis(2 more ... CTD PMID:37914285 Pax6 Rat mercury dibromide decreases expression ISO PAX6 (Homo sapiens) 6480464 mercuric bromide results in decreased expression of PAX6 mRNA CTD PMID:26272509 Pax6 Rat mercury dibromide multiple interactions ISO PAX6 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PAX6 mRNA CTD PMID:27188386 Pax6 Rat mercury(0) multiple interactions ISO PAX6 (Homo sapiens) 6480464 [diethyl phosphate co-treated with Cotinine co-treated with bis(2 more ... CTD PMID:37914285 Pax6 Rat methylarsonic acid multiple interactions ISO Pax6 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of PAX6 mRNA CTD PMID:34876320 Pax6 Rat methylmercury chloride affects expression ISO Pax6 (Mus musculus) 6480464 methylmercuric chloride affects the expression of PAX6 mRNA CTD PMID:22555245 Pax6 Rat methylmercury chloride increases expression ISO PAX6 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of PAX6 mRNA CTD PMID:23179753 Pax6 Rat methylmercury chloride decreases expression ISO PAX6 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of PAX6 mRNA CTD PMID:22555245 and PMID:28001369 Pax6 Rat mono(2-ethylhexyl) phthalate increases expression ISO PAX6 (Homo sapiens) 6480464 mono-(2-ethylhexyl)phthalate results in increased expression of PAX6 mRNA CTD PMID:31711903 Pax6 Rat mono(2-ethylhexyl) phthalate multiple interactions ISO Pax6 (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of PAX6 mRNA CTD PMID:36189433 Pax6 Rat Morroniside increases expression EXP 6480464 morroniside results in increased expression of PAX6 protein CTD PMID:24876057 Pax6 Rat N-ethyl-N-nitrosourea increases mutagenesis ISO Pax6 (Mus musculus) 6480464 Ethylnitrosourea results in increased mutagenesis of PAX6 exon more ... CTD PMID:16303964 and PMID:16724327 Pax6 Rat nicotine decreases expression EXP 6480464 Nicotine results in decreased expression of PAX6 mRNA CTD PMID:28555334 Pax6 Rat nilotinib increases expression ISO PAX6 (Homo sapiens) 6480464 nilotinib results in increased expression of PAX6 mRNA CTD PMID:31711903 Pax6 Rat p-chloromercuribenzoic acid decreases expression ISO PAX6 (Homo sapiens) 6480464 p-Chloromercuribenzoic Acid results in decreased expression of PAX6 mRNA CTD PMID:26272509 Pax6 Rat panobinostat decreases expression ISO PAX6 (Homo sapiens) 6480464 panobinostat results in decreased expression of PAX6 mRNA CTD PMID:26272509 Pax6 Rat panobinostat multiple interactions ISO PAX6 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PAX6 mRNA CTD PMID:27188386 Pax6 Rat paraquat multiple interactions ISO Pax6 (Mus musculus) 6480464 [LRRK2 protein mutant form co-treated with Maneb co-treated with Paraquat] results in decreased expression of PAX6 mRNA CTD PMID:23017109 Pax6 Rat paraquat multiple interactions ISO PAX6 (Homo sapiens) 6480464 Paraquat affects the reaction [Bucladesine affects the expression of PAX6 mRNA] and Paraquat affects the reaction [Bucladesine affects the expression of PAX6 protein] CTD PMID:31400064 Pax6 Rat paraquat decreases expression ISO PAX6 (Homo sapiens) 6480464 Paraquat results in decreased expression of PAX6 mRNA and Paraquat results in decreased expression of PAX6 protein CTD PMID:30698896 Pax6 Rat perfluorooctanoic acid increases activity ISO PAX6 (Homo sapiens) 6480464 perfluorooctanoic acid results in increased activity of PAX6 protein CTD PMID:27589886 Pax6 Rat phenylmercury acetate decreases expression ISO PAX6 (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of PAX6 mRNA CTD PMID:26272509 Pax6 Rat phenylmercury acetate multiple interactions ISO PAX6 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PAX6 mRNA CTD PMID:27188386 Pax6 Rat phenytoin increases expression ISO PAX6 (Homo sapiens) 6480464 Phenytoin results in increased expression of PAX6 mRNA CTD PMID:31711903 Pax6 Rat potassium chromate increases expression ISO PAX6 (Homo sapiens) 6480464 potassium chromate(VI) results in increased expression of PAX6 mRNA CTD PMID:22714537 Pax6 Rat propanal increases expression ISO PAX6 (Homo sapiens) 6480464 propionaldehyde results in increased expression of PAX6 mRNA CTD PMID:26079696 Pax6 Rat propiconazole decreases expression ISO Pax6 (Mus musculus) 6480464 propiconazole results in decreased expression of PAX6 mRNA CTD PMID:21278054 Pax6 Rat rotenone multiple interactions ISO PAX6 (Homo sapiens) 6480464 Rotenone inhibits the reaction [[4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with LDN 193189] results in increased expression of PAX6 mRNA] CTD PMID:32949729 Pax6 Rat rotenone decreases expression ISO Pax6 (Mus musculus) 6480464 Rotenone results in decreased expression of PAX6 protein CTD PMID:35919817 Pax6 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO PAX6 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Pax6 Rat SB 431542 multiple interactions ISO PAX6 (Homo sapiens) 6480464 [4-(5-benzo(1 more ... CTD PMID:27188386 more ... Pax6 Rat selenium atom multiple interactions ISO PAX6 (Homo sapiens) 6480464 [diethyl phosphate co-treated with Cotinine co-treated with bis(2 more ... CTD PMID:37914285 Pax6 Rat silicon dioxide decreases expression ISO Pax6 (Mus musculus) 6480464 Silicon Dioxide results in decreased expression of PAX6 mRNA CTD PMID:19073995 and PMID:29203145 Pax6 Rat silver atom decreases expression ISO Pax6 (Mus musculus) 6480464 Silver results in decreased expression of PAX6 mRNA CTD PMID:27131904 Pax6 Rat silver(0) decreases expression ISO Pax6 (Mus musculus) 6480464 Silver results in decreased expression of PAX6 mRNA CTD PMID:27131904 Pax6 Rat sodium arsenate multiple interactions ISO Pax6 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of PAX6 mRNA CTD PMID:34876320 Pax6 Rat sodium arsenite decreases expression ISO PAX6 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of PAX6 mRNA CTD PMID:22714537 Pax6 Rat sodium arsenite multiple interactions ISO Pax6 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of PAX6 mRNA CTD PMID:34876320 Pax6 Rat sodium arsenite increases expression ISO Pax6 (Mus musculus) 6480464 sodium arsenite results in increased expression of PAX6 mRNA CTD PMID:37682722 Pax6 Rat sodium arsenite increases expression ISO PAX6 (Homo sapiens) 6480464 sodium arsenite results in increased expression of PAX6 mRNA CTD PMID:28595984 Pax6 Rat T-2 toxin increases expression ISO Pax6 (Mus musculus) 6480464 T-2 Toxin results in increased expression of PAX6 mRNA CTD PMID:26314264 Pax6 Rat tert-butyl hydroperoxide decreases expression ISO PAX6 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of PAX6 mRNA CTD PMID:15336504 Pax6 Rat Tetrachlorobisphenol A increases expression ISO PAX6 (Homo sapiens) 6480464 tetrachlorodian results in increased expression of PAX6 mRNA CTD PMID:31326446 Pax6 Rat thalidomide increases expression ISO PAX6 (Homo sapiens) 6480464 Thalidomide results in increased expression of PAX6 mRNA CTD PMID:31711903 Pax6 Rat thapsigargin decreases expression EXP 6480464 Thapsigargin results in decreased expression of PAX6 protein CTD PMID:35544339 Pax6 Rat titanium dioxide multiple interactions ISO Pax6 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of PAX6 mRNA CTD PMID:29950665 Pax6 Rat titanium dioxide decreases methylation ISO Pax6 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of PAX6 gene and titanium dioxide results in decreased methylation of PAX6 promoter alternative form CTD PMID:35295148 Pax6 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of PAX6 mRNA CTD PMID:33387578 Pax6 Rat trichostatin A decreases expression ISO PAX6 (Homo sapiens) 6480464 trichostatin A results in decreased expression of PAX6 mRNA CTD PMID:22723015 more ... Pax6 Rat trichostatin A multiple interactions ISO PAX6 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PAX6 mRNA CTD PMID:27188386 Pax6 Rat trovafloxacin decreases expression ISO Pax6 (Mus musculus) 6480464 trovafloxacin results in decreased expression of PAX6 mRNA CTD PMID:35537566 Pax6 Rat urethane increases expression ISO PAX6 (Homo sapiens) 6480464 Urethane results in increased expression of PAX6 mRNA CTD PMID:28818685 Pax6 Rat valproic acid affects expression ISO Pax6 (Mus musculus) 6480464 Valproic Acid affects the expression of PAX6 mRNA CTD PMID:17292431 and PMID:22045034 Pax6 Rat valproic acid multiple interactions ISO PAX6 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PAX6 mRNA CTD PMID:27188386 Pax6 Rat valproic acid decreases expression ISO PAX6 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of PAX6 mRNA CTD PMID:22723015 more ... Pax6 Rat valproic acid increases expression ISO PAX6 (Homo sapiens) 6480464 Valproic Acid results in increased expression of PAX6 mRNA CTD PMID:24849673 more ... Pax6 Rat vismodegib increases expression ISO Pax6 (Mus musculus) 6480464 HhAntag691 results in increased expression of PAX6 mRNA CTD PMID:27585885 Pax6 Rat zinc atom decreases expression ISO PAX6 (Homo sapiens) 6480464 Zinc deficiency results in decreased expression of PAX6 mRNA CTD PMID:18356318 Pax6 Rat zinc atom multiple interactions EXP 6480464 Zinc inhibits the reaction [Diethylhexyl Phthalate results in decreased expression of PAX6 protein] CTD PMID:35841924 Pax6 Rat zinc(0) decreases expression ISO PAX6 (Homo sapiens) 6480464 Zinc deficiency results in decreased expression of PAX6 mRNA CTD PMID:18356318 Pax6 Rat zinc(0) multiple interactions EXP 6480464 Zinc inhibits the reaction [Diethylhexyl Phthalate results in decreased expression of PAX6 protein] CTD PMID:35841924
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
Pax6 Rat chromatin binding enables ISO Pax6 (Mus musculus) 1624291 PMID:19146846 more ... RGD PMID:19146846 more ... Pax6 Rat chromatin binding enables IEA UniProtKB:P63015 and ensembl:ENSMUSP00000106716 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Pax6 Rat chromatin DNA binding enables IEA UniProtKB:P63015 and ensembl:ENSMUSP00000106716 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Pax6 Rat chromatin DNA binding enables ISO Pax6 (Mus musculus) 1624291 PMID:30186101 RGD PMID:30186101 Pax6 Rat co-SMAD binding enables ISO Pax6 (Mus musculus) 1624291 PMID:17251190 RGD PMID:17251190 Pax6 Rat co-SMAD binding enables IEA UniProtKB:P63015 and ensembl:ENSMUSP00000106716 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Pax6 Rat DNA binding enables IEA ARBA:ARBA00029224 1600115 GO_REF:0000117 UniProt GO_REF:0000117 Pax6 Rat DNA binding enables IEA InterPro:IPR001356 more ... 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Pax6 Rat DNA binding enables ISO Pax6 (Mus musculus) 1624291 PMID:12756174 RGD PMID:12756174 Pax6 Rat DNA binding enables IEA UniProtKB:P63015 and ensembl:ENSMUSP00000106716 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Pax6 Rat DNA binding enables IEA InterPro:IPR001356 more ... 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Pax6 Rat DNA binding enables IEA UniRule:UR000401037 1600115 GO_REF:0000104 UniProt GO_REF:0000104 Pax6 Rat DNA binding enables IEA UniProtKB-KW:KW-0238 and UniProtKB-KW:KW-0371 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Pax6 Rat DNA-binding transcription activator activity, RNA polymerase II-specific enables IEA UniProtKB:P26367 and ensembl:ENSP000004920241600115 GO_REF:0000107 Ensembl GO_REF:0000107 Pax6 Rat DNA-binding transcription activator activity, RNA polymerase II-specific enables IEA UniProtKB:P63015 and ensembl:ENSMUSP00000106716 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Pax6 Rat DNA-binding transcription activator activity, RNA polymerase II-specific enables ISO Pax6 (Mus musculus) 1624291 PMID:12756174 and PMID:22031545 RGD PMID:12756174 and PMID:22031545 Pax6 Rat DNA-binding transcription activator activity, RNA polymerase II-specific enables ISO PAX6 (Homo sapiens) 1624291 PMID:24802670 RGD PMID:24802670 Pax6 Rat DNA-binding transcription factor activity TAS 729590 RGD Pax6 Rat DNA-binding transcription factor activity enables IEA UniProtKB:P63015 and ensembl:ENSMUSP00000106716 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Pax6 Rat DNA-binding transcription factor activity enables ISO Pax6 (Mus musculus) 1624291 PMID:18287938 RGD PMID:18287938 Pax6 Rat DNA-binding transcription factor activity, RNA polymerase II-specific enables IDA 8552352 PMID:20592023 BHF-UCL Pax6 Rat DNA-binding transcription factor activity, RNA polymerase II-specific enables IEA UniProtKB:P63015 and ensembl:ENSMUSP00000106716 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Pax6 Rat DNA-binding transcription factor activity, RNA polymerase II-specific enables IBA FB:FBgn0003145 more ... 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Pax6 Rat DNA-binding transcription factor activity, RNA polymerase II-specific enables ISO Pax6 (Mus musculus) 1624291 PMID:16407227 and PMID:20592023 RGD PMID:16407227 and PMID:20592023 Pax6 Rat DNA-binding transcription factor activity, RNA polymerase II-specific enables IEA UniProtKB:P26367 and ensembl:ENSP000004920241600115 GO_REF:0000107 Ensembl GO_REF:0000107 Pax6 Rat DNA-binding transcription factor activity, RNA polymerase II-specific enables IEA InterPro:IPR017970 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Pax6 Rat DNA-binding transcription factor activity, RNA polymerase II-specific enables ISO PAX6 (Homo sapiens) 1624291 PMID:20592023 RGD PMID:20592023 Pax6 Rat DNA-binding transcription repressor activity, RNA polymerase II-specific enables ISO Pax6 (Mus musculus) 1624291 PMID:23622063 RGD PMID:23622063 Pax6 Rat DNA-binding transcription repressor activity, RNA polymerase II-specific enables IEA UniProtKB:P63015 and ensembl:ENSMUSP00000106716 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Pax6 Rat double-stranded DNA binding IDA 632189 RGD Pax6 Rat histone acetyltransferase binding enables ISO Pax6 (Mus musculus) 1624291 PMID:16407227 RGD PMID:16407227 Pax6 Rat histone acetyltransferase binding enables IEA UniProtKB:P63015 and ensembl:ENSMUSP00000106716 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Pax6 Rat HMG box domain binding enables ISO Pax6 (Mus musculus) 1624291 UniProtKB:O55170 and PMID:16582099 RGD PMID:16582099 Pax6 Rat HMG box domain binding enables IEA UniProtKB:P63015 and ensembl:ENSMUSP00000106716 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Pax6 Rat minor groove of adenine-thymine-rich DNA binding IDA 632189 RGD Pax6 Rat protein binding enables ISO PAX6 (Homo sapiens) and UniProtKB:P26367-1 1624291 UniProtKB:P63166 and PMID:21084637 RGD PMID:21084637 Pax6 Rat protein binding enables ISO Pax6 (Mus musculus) 1624291 PR:P48432 more ... RGD PMID:16098226 more ... Pax6 Rat protein binding enables ISO PAX6 (Homo sapiens) 1624291 UniProtKB:A0A384ME25 more ... RGD PMID:16098226 and PMID:32296183 Pax6 Rat protein kinase binding enables IEA UniProtKB:P63015 and ensembl:ENSMUSP00000106716 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Pax6 Rat protein kinase binding enables ISO Pax6 (Mus musculus) 1624291 UniProtKB:Q9QZR5 and PMID:16407227 RGD PMID:16407227 Pax6 Rat R-SMAD binding enables ISO Pax6 (Mus musculus) 1624291 PMID:17251190 RGD PMID:17251190 Pax6 Rat R-SMAD binding enables IEA UniProtKB:P63015 and ensembl:ENSMUSP00000106716 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Pax6 Rat R-SMAD binding enables ISO PAX6 (Homo sapiens) 1624291 UniProtKB:P84022 and PMID:17251190 RGD PMID:17251190 Pax6 Rat R-SMAD binding enables IEA UniProtKB:P26367 and ensembl:ENSP000004920241600115 GO_REF:0000107 Ensembl GO_REF:0000107 Pax6 Rat RNA binding enables ISO Pax6 (Mus musculus) 1624291 PMID:24488179 RGD PMID:24488179 Pax6 Rat RNA binding enables IEA UniProtKB:P63015 and ensembl:ENSMUSP00000106716 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Pax6 Rat RNA polymerase II cis-regulatory region sequence-specific DNA binding enables ISO Pax6 (Mus musculus) 1624291 PMID:12756174 and PMID:20592023 RGD PMID:12756174 and PMID:20592023 Pax6 Rat RNA polymerase II cis-regulatory region sequence-specific DNA binding enables IEA UniProtKB:P63015 and ensembl:ENSMUSP00000106716 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Pax6 Rat RNA polymerase II cis-regulatory region sequence-specific DNA binding enables IEA UniProtKB:P26367 and ensembl:ENSP000004920241600115 GO_REF:0000107 Ensembl GO_REF:0000107 Pax6 Rat RNA polymerase II cis-regulatory region sequence-specific DNA binding enables IBA FB:FBgn0005558 more ... 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Pax6 Rat RNA polymerase II cis-regulatory region sequence-specific DNA binding enables IDA 8552352 PMID:20592023 BHF-UCL Pax6 Rat RNA polymerase II cis-regulatory region sequence-specific DNA binding enables ISO PAX6 (Homo sapiens) 1624291 PMID:20592023 and PMID:24802670 RGD PMID:20592023 and PMID:24802670 Pax6 Rat RNA polymerase II core promoter sequence-specific DNA binding enables ISO Pax6 (Mus musculus) 1624291 PMID:16407227 RGD PMID:16407227 Pax6 Rat RNA polymerase II core promoter sequence-specific DNA binding enables IEA UniProtKB:P63015 and ensembl:ENSMUSP00000106716 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Pax6 Rat sequence-specific DNA binding IDA 632189 RGD Pax6 Rat sequence-specific DNA binding enables IEA UniProtKB:P63015 and ensembl:ENSMUSP00000106716 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Pax6 Rat sequence-specific DNA binding enables ISO Pax6 (Mus musculus) 1624291 PMID:23622063 RGD PMID:23622063 Pax6 Rat sequence-specific double-stranded DNA binding enables ISO PAX6 (Homo sapiens) 1624291 PMID:28473536 RGD PMID:28473536 Pax6 Rat sequence-specific double-stranded DNA binding enables IEA UniProtKB:P26367 and ensembl:ENSP000004920241600115 GO_REF:0000107 Ensembl GO_REF:0000107 Pax6 Rat transcription cis-regulatory region binding enables ISS UniProtKB:P63015 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Pax6 Rat transcription cis-regulatory region binding enables ISO Pax6 (Mus musculus) 1624291 PMID:19521500 and PMID:23990468 RGD PMID:19521500 and PMID:23990468 Pax6 Rat transcription cis-regulatory region binding enables IEA UniProtKB:P63015 and ensembl:ENSMUSP00000106716 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Pax6 Rat transcription coregulator binding enables ISO Pax6 (Mus musculus) 1624291 UniProtKB:Q9QZR5 and PMID:16407227 RGD PMID:16407227 Pax6 Rat transcription coregulator binding enables IEA UniProtKB:P63015 and ensembl:ENSMUSP00000106716 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Pax6 Rat ubiquitin protein ligase binding enables ISO Pax6 (Mus musculus) 1624291 UniProtKB:Q99PQ2 and PMID:18628401 RGD PMID:18628401 Pax6 Rat ubiquitin protein ligase binding enables IEA UniProtKB:P63015 and ensembl:ENSMUSP00000106716 1600115 GO_REF:0000107 Ensembl GO_REF:0000107
Imported Annotations - KEGG (archival)
(-)-cotinine (ISO) (S)-colchicine (ISO) (S)-nicotine (EXP) 1,2-dimethylhydrazine (EXP) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3H-1,2-dithiole-3-thione (EXP) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) 9-cis-retinoic acid (ISO) abacavir (ISO) acetaldehyde (ISO) acetic acid (ISO) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) aldehydo-D-glucose (EXP,ISO) aldicarb (ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP) Anatoxin a (ISO) Aroclor 1254 (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) atrazine (ISO) Azoxymethane (ISO) benzene (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) bromochloroacetic acid (ISO) bucladesine (ISO) butanal (ISO) C60 fullerene (EXP) cadmium atom (ISO) cadmium dichloride (EXP,ISO) calcium atom (EXP) calcium(0) (EXP) carbamazepine (ISO) carbaryl (ISO) carbofuran (EXP) CHIR 99021 (ISO) CHIR-98014 (ISO) chlorpyrifos (ISO) choline (ISO) crocidolite asbestos (ISO) Cuprizon (EXP) curcumin (EXP) cyclosporin A (ISO) cyproconazole (ISO) cytarabine (ISO) D-glucose (EXP,ISO) dabigatran (ISO) DDT (ISO) decabromodiphenyl ether (EXP,ISO) dexamethasone (ISO) dextran sulfate (ISO) diazinon (ISO) diclofenac (ISO) dieldrin (ISO) diethyl hydrogen phosphate (ISO) dimethylarsinic acid (ISO) dioxygen (ISO) dorsomorphin (ISO) doxorubicin (ISO) elemental selenium (ISO) entinostat (ISO) ethanol (ISO) ethosuximide (EXP) flusilazole (ISO) folic acid (ISO) fructose (ISO) gamma-hexachlorocyclohexane (ISO) glucose (EXP,ISO) glyphosate (ISO) heptachlor (ISO) herbicide (ISO) hexachlorophene (ISO) isotretinoin (ISO) L-methionine (ISO) lead diacetate (ISO) lead(0) (ISO) lipopolysaccharide (ISO) lumiracoxib (ISO) maneb (ISO) mercury atom (ISO) mercury dibromide (ISO) mercury(0) (ISO) methylarsonic acid (ISO) methylmercury chloride (ISO) mono(2-ethylhexyl) phthalate (ISO) Morroniside (EXP) N-ethyl-N-nitrosourea (ISO) nicotine (EXP) nilotinib (ISO) p-chloromercuribenzoic acid (ISO) panobinostat (ISO) paraquat (ISO) perfluorooctanoic acid (ISO) phenylmercury acetate (ISO) phenytoin (ISO) potassium chromate (ISO) propanal (ISO) propiconazole (ISO) rotenone (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) selenium atom (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenate (ISO) sodium arsenite (ISO) T-2 toxin (ISO) tert-butyl hydroperoxide (ISO) Tetrachlorobisphenol A (ISO) thalidomide (ISO) thapsigargin (EXP) titanium dioxide (ISO) trichloroethene (EXP) trichostatin A (ISO) trovafloxacin (ISO) urethane (ISO) valproic acid (ISO) vismodegib (ISO) zinc atom (EXP,ISO) zinc(0) (EXP,ISO)
Biological Process
animal organ development (IEA) anterior/posterior pattern specification (IEA,ISO) astrocyte differentiation (IEA,IMP,ISO) axon guidance (IEA,ISO) axonogenesis (IEA,ISO) blood vessel development (IEA,ISO) brain development (IBA,IEA,ISO) camera-type eye development (IEA,ISO) cell differentiation (IEA,ISO) cell fate commitment (IEA,ISO) cell fate determination (IEA,ISO) cell population proliferation (IEA,ISO) cellular response to fibroblast growth factor stimulus (IEP) cellular response to glucose stimulus (IEP) cellular response to insulin stimulus (IEP) cellular response to leukemia inhibitory factor (IEA,ISO) cellular response to prostaglandin E stimulus (IEP) cellular response to xenobiotic stimulus (IEP) cerebellum development (IEP) cerebral cortex development (IEA,ISO) cerebral cortex regionalization (IEA,ISO) chromatin remodeling (IEA,ISO) commitment of neuronal cell to specific neuron type in forebrain (IEA,ISO) cornea development in camera-type eye (IEA,ISO) dorsal/ventral axis specification (IEA,ISO) dorsal/ventral pattern formation (IEA,ISO) embryonic camera-type eye morphogenesis (IEA,ISO) epithelial cell development (IMP) epithelial cell differentiation (IEA,ISO) establishment of mitotic spindle orientation (IEA,ISO) eye photoreceptor cell development (IEA,ISO) forebrain development (IBA,IEA,ISO) forebrain dorsal/ventral pattern formation (IEA,ISO) forebrain-midbrain boundary formation (IEA,ISO) gene expression (IEA,ISO) glucose homeostasis (IEA,ISO) habenula development (IEA,ISO) hindbrain development (IDA,IMP) insulin metabolic process (IMP) interkinetic nuclear migration (IMP) iris morphogenesis (IEA,ISO) keratinocyte differentiation (IEA,ISO) lacrimal gland development (IEA,ISO) learned vocalization behavior or vocal learning (IMP) lens development in camera-type eye (IEA,ISO) negative regulation of epithelial cell proliferation (IEA,ISO) negative regulation of neural precursor cell proliferation (IEA,ISO) negative regulation of neuroblast proliferation (IEA,ISO) negative regulation of neuron differentiation (IEA,ISO) negative regulation of protein phosphorylation (ISO) negative regulation of transcription by RNA polymerase II (IEA,ISO,ISS) nervous system development (IEA,ISO) neural crest cell migration (IMP) neural precursor cell proliferation (IEA,IMP,ISO) neuroblast proliferation (IEA,ISO) neuron differentiation (IEA,ISO) neuron migration (IEA,IMP,ISO) olfactory bulb development (IMP) olfactory bulb mitral cell layer development (IMP) oligodendrocyte cell fate specification (IEA,ISO) pallium development (IEA,ISO) pancreatic A cell development (IEA,IMP,ISO) pancreatic A cell differentiation (IMP) pituitary gland development (IEA,ISO) positive regulation of cell fate specification (IMP) positive regulation of DNA-templated transcription (IEA,ISO,ISS) positive regulation of epithelial cell differentiation (IEA,ISO) positive regulation of gene expression (IEA,IMP,ISO) positive regulation of glutamatergic neuron differentiation (IMP) positive regulation of miRNA transcription (IEA,ISO) positive regulation of neuroblast proliferation (IEA,ISO) positive regulation of neuron migration (IGI) positive regulation of response to biotic stimulus (IMP) positive regulation of transcription by RNA polymerase II (IEA,IMP,ISO) protein localization to organelle (IEA,ISO) protein phosphorylation (ISO) regionalization (IEA,ISO) regulation of asymmetric cell division (IEA,ISO) regulation of cell migration (IEA,ISO) regulation of DNA-templated transcription (IEA) regulation of gene expression (IEA,ISO) regulation of neurogenesis (IEA,IMP,ISO) regulation of neuron differentiation (IDA,IEA,ISO) regulation of neuron projection development (IGI) regulation of timing of cell differentiation (IEA,ISO) regulation of transcription by RNA polymerase II (IBA,IEA,ISO) response to ethanol (IEP) response to wounding (IEA,ISO) retina development in camera-type eye (IBA,IEA,IEP,ISO) rhombomere morphogenesis (IMP) salivary gland morphogenesis (IEA,ISO) sensory neuron migration (IMP) sensory organ development (IBA) signal transduction involved in regulation of gene expression (IEA,ISO) smoothened signaling pathway (IEA,ISO) somatic motor neuron fate commitment (ISO) spinal cord development (IEP) spinal cord motor neuron cell fate specification (ISO) telencephalon regionalization (IEA,ISO) transcription by RNA polymerase II (IEA,ISO) type B pancreatic cell differentiation (IBA,IEA,IMP,ISO) ventral spinal cord development (IEA,ISO) ventral spinal cord interneuron specification (ISO) visual perception (IEA,ISO)
Molecular Function
chromatin binding (IEA,ISO) chromatin DNA binding (IEA,ISO) co-SMAD binding (IEA,ISO) DNA binding (IEA,ISO) DNA-binding transcription activator activity, RNA polymerase II-specific (IEA,ISO) DNA-binding transcription factor activity (IEA,ISO,TAS) DNA-binding transcription factor activity, RNA polymerase II-specific (IBA,IDA,IEA,ISO) DNA-binding transcription repressor activity, RNA polymerase II-specific (IEA,ISO) double-stranded DNA binding (IDA) histone acetyltransferase binding (IEA,ISO) HMG box domain binding (IEA,ISO) minor groove of adenine-thymine-rich DNA binding (IDA) protein binding (ISO) protein kinase binding (IEA,ISO) R-SMAD binding (IEA,ISO) RNA binding (IEA,ISO) RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA,IDA,IEA,ISO) RNA polymerase II core promoter sequence-specific DNA binding (IEA,ISO) sequence-specific DNA binding (IDA,IEA,ISO) sequence-specific double-stranded DNA binding (IEA,ISO) transcription cis-regulatory region binding (IEA,ISO,ISS) transcription coregulator binding (IEA,ISO) ubiquitin protein ligase binding (IEA,ISO)
1.
PAX6 aniridia and interhemispheric brain anomalies.
Abouzeid H, etal., Mol Vis. 2009 Oct 17;15:2074-83.
2.
R-cadherin is a Pax6-regulated, growth-promoting cue for pioneer axons.
Andrews GL and Mastick GS, J Neurosci 2003 Oct 29;23(30):9873-80.
3.
Role of Fabp7, a downstream gene of Pax6, in the maintenance of neuroepithelial cells during early embryonic development of the rat cortex.
Arai Y, etal., J Neurosci. 2005 Oct 19;25(42):9752-61.
4.
The incidence of PAX6 mutation in patients with simple aniridia: an evaluation of mutation detection in 12 cases.
Axton R, etal., J Med Genet. 1997 Apr;34(4):279-86.
5.
Missense mutation in the alternative splice region of the PAX6 gene in eye anomalies.
Azuma N, etal., Am J Hum Genet. 1999 Sep;65(3):656-63.
6.
Mutations of the PAX6 gene detected in patients with a variety of optic-nerve malformations.
Azuma N, etal., Am J Hum Genet. 2003 Jun;72(6):1565-70. Epub 2003 Apr 29.
7.
Glucose modulates Pax6 expression through the JNK/p38 MAP kinase pathway in pancreatic beta-cells.
Balakrishnan S, etal., Life Sci. 2014 Jul 25;109(1):1-7. doi: 10.1016/j.lfs.2014.06.009. Epub 2014 Jun 20.
8.
A novel PAX6 mutation in a large Chinese family with aniridia and congenital cataract.
Cai F, etal., Mol Vis. 2010 Jun 22;16:1141-5.
9.
A novel mutation of PAX6 identified in a Chinese twin family with congenital aniridia complicated with nystagmus.
Cao X, etal., Genet Mol Res. 2014 Oct 27;13(4):8679-85. doi: 10.4238/2014.October.27.8.
10.
A novel PAX6 deletion in a Chinese family with congenital aniridia.
Chen JH, etal., Mol Vis. 2012;18:989-95. Epub 2012 Apr 21.
11.
Mutation analysis of paired box 6 gene in inherited aniridia in northern China.
Chen P, etal., Mol Vis. 2013 May 30;19:1169-77. Print 2013.
12.
Overexpression of PAX6(5a) in lens fiber cells results in cataract and upregulation of (alpha)5(beta)1 integrin expression.
Duncan MK, etal., J Cell Sci. 2000 Sep;113 ( Pt 18):3173-85.
13.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
14.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
15.
Absence of ventral cell populations in the developing brain in a rat model of the Smith-Lemli-Opitz syndrome.
Gofflot F, etal., Am J Med Genet. 1999 Nov 26;87(3):207-16.
16.
Pax6 is a key component of regulated glucagon secretion.
Gosmain Y, etal., Endocrinology. 2012 Sep;153(9):4204-15. doi: 10.1210/en.2012-1425. Epub 2012 Jul 9.
17.
Pax6 controls the expression of critical genes involved in pancreatic {alpha} cell differentiation and function.
Gosmain Y, etal., J Biol Chem. 2010 Oct 22;285(43):33381-93. doi: 10.1074/jbc.M110.147215. Epub 2010 Jun 30.
18.
Pax6 is crucial for beta-cell function, insulin biosynthesis, and glucose-induced insulin secretion.
Gosmain Y, etal., Mol Endocrinol. 2012 Apr;26(4):696-709. doi: 10.1210/me.2011-1256. Epub 2012 Mar 8.
19.
Three novel Pax6 alleles in the mouse leading to the same small-eye phenotype caused by different consequences at target promoters.
Graw J, etal., Invest Ophthalmol Vis Sci. 2005 Dec;46(12):4671-83.
20.
Extracellular matrix modulates insulin production during differentiation of AR42J cells: functional role of Pax6 transcription factor.
Hamamoto K, etal., J Cell Biochem. 2011 Jan;112(1):318-29. doi: 10.1002/jcb.22930.
21.
Adult pancreatic islets require differential pax6 gene dosage.
Hamasaki A, etal., Biochem Biophys Res Commun. 2007 Feb 2;353(1):40-6. Epub 2006 Dec 4.
22.
Association of PAX6 polymorphisms with high myopia in Han Chinese nuclear families.
Han W, etal., Invest Ophthalmol Vis Sci. 2009 Jan;50(1):47-56. doi: 10.1167/iovs.07-0813.
23.
The Expression of Neuroepithelial Cell Fate Determinants in Rat Spinal Cord Development.
Henley BM and McDermott KW, J Mol Neurosci. 2010 Mar 2.
24.
Subpial neuronal migration in the medulla oblongata of Pax-6-deficient rats.
Horie M, etal., Eur J Neurosci 2003 Jan;17(1):49-57.
25.
Trophic factors and neuronal interactions regulate the cell cycle and Pax6 expression in Muller stem cells.
Insua MF, etal., J Neurosci Res. 2008 May 15;86(7):1459-71. doi: 10.1002/jnr.21606.
26.
PAX6 haplotypes are associated with high myopia in Han chinese.
Jiang B, etal., PLoS One. 2011 May 12;6(5):e19587. doi: 10.1371/journal.pone.0019587.
27.
A recurrent PAX6 mutation is associated with aniridia and congenital progressive cataract in a Chinese family.
Jin C, etal., Mol Vis. 2012;18:465-70. Epub 2012 Feb 16.
28.
Mutation analysis of PAX6 in inherited and sporadic aniridia from northeastern China.
Kang Y, etal., Mol Vis. 2012;18:1750-4. Epub 2012 Jun 27.
29.
Prenatal exposure of ethanol induces increased glutamatergic neuronal differentiation of neural progenitor cells.
Kim KC, etal., J Biomed Sci. 2010 Nov 12;17:85. doi: 10.1186/1423-0127-17-85.
30.
Pax6-dependent cortical glutamatergic neuronal differentiation regulates autism-like behavior in prenatally valproic acid-exposed rat offspring.
Kim KC, etal., Mol Neurobiol. 2014 Feb;49(1):512-28. doi: 10.1007/s12035-013-8535-2. Epub 2013 Sep 13.
31.
Study of Pax6 mutant rat revealed the association between upper incisor formation and midface formation.
Kriangkrai R, etal., Dev Dyn. 2006 Aug;235(8):2134-43.
32.
High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.
Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
33.
PAX6 is expressed in pancreatic adenocarcinoma and is downregulated during induction of terminal differentiation.
Lang D, etal., Mol Carcinog. 2008 Feb;47(2):148-56.
34.
PAX6 analysis of one family and one sporadic patient from southern China with classic aniridia.
Lin Y, etal., Mol Vis. 2011;17:3116-20. Epub 2011 Nov 26.
35.
Aberrant lens fiber differentiation in anterior subcapsular cataract formation: a process dependent on reduced levels of Pax6.
Lovicu FJ, etal., Invest Ophthalmol Vis Sci. 2004 Jun;45(6):1946-53.
36.
Pax6 is required for production and maintenance of progenitor cells in postnatal hippocampal neurogenesis.
Maekawa M, etal., Genes Cells. 2005 Oct;10(10):1001-14.
37.
Overexpression of Pax6 results in microphthalmia, retinal dysplasia and defective retinal ganglion cell axon guidance.
Manuel M, etal., BMC Dev Biol. 2008 May 28;8:59. doi: 10.1186/1471-213X-8-59.
38.
A mutation in the Pax-6 gene in rat small eye is associated with impaired migration of midbrain crest cells.
Matsuo T, etal., Nat Genet. 1993 Apr;3(4):299-304.
39.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
40.
Mutation of the PAX6 gene in patients with autosomal dominant keratitis.
Mirzayans F, etal., Am J Hum Genet. 1995 Sep;57(3):539-48.
41.
Association of paired box 6 with high myopia in Japanese.
Miyake M, etal., Mol Vis. 2012;18:2726-35. Epub 2012 Nov 17.
42.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
43.
Misrouting of mitral cell progenitors in the Pax6/small eye rat telencephalon.
Nomura T and Osumi N, Development. 2004 Feb;131(4):787-96. Epub 2004 Jan 21.
44.
Pax6-dependent boundary defines alignment of migrating olfactory cortex neurons via the repulsive activity of ephrin A5.
Nomura T, etal., Development. 2006 Apr;133(7):1335-45. Epub 2006 Mar 1.
45.
Downstream genes of Pax6 revealed by comprehensive transcriptome profiling in the developing rat hindbrain.
Numayama-Tsuruta K, etal., BMC Dev Biol. 2010 Jan 18;10:6. doi: 10.1186/1471-213X-10-6.
46.
Pax6 guides a relay of pioneer longitudinal axons in the embryonic mouse forebrain.
Nural HF and Mastick GS, J Comp Neurol 2004 Nov 22;479(4):399-409.
47.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
48.
Pax-6 is involved in the specification of hindbrain motor neuron subtype.
Osumi N, etal., Development 1997 Aug;124(15):2961-72.
49.
Cranial anomaly of homozygous rSey rat is associated with a defect in the migration pathway of midbrain crest cells.
Osumi-Yamashita N, etal., Dev Growth Differ. 1997 Feb;39(1):53-67.
50.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
51.
Developmental and cellular factors underlying corneal epithelial dysgenesis in the Pax6+/- mouse model of aniridia.
Ramaesh T, etal., Exp Eye Res. 2005 Aug;81(2):224-35.
52.
Histopathological characterisation of effects of the mouse Pax6(Leca4) missense mutation on eye development.
Ramaesh T, etal., Exp Eye Res. 2009 Aug;89(2):263-73. doi: 10.1016/j.exer.2009.03.016. Epub 2009 Apr 2.
53.
Developmental and daily expression of the Pax4 and Pax6 homeobox genes in the rat retina: localization of Pax4 in photoreceptor cells.
Rath MF, etal., J Neurochem. 2009 Jan;108(1):285-94. Epub 2008 Nov 19.
54.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
55.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
56.
Regulation of c-maf gene expression by Pax6 in cultured cells.
Sakai M, etal., Nucleic Acids Res. 2001 Mar 1;29(5):1228-37.
57.
Reduced proliferation and excess astrogenesis of Pax6 heterozygous neural stem/progenitor cells.
Sakayori N, etal., Neurosci Res. 2012 Oct;74(2):116-21. doi: 10.1016/j.neures.2012.08.004. Epub 2012 Aug 27.
58.
Novel target sequences for Pax-6 in the brain-specific activating regions of the rat aldolase C gene.
Skala-Rubinson H, etal., J Biol Chem 2002 Dec 6;277(49):47190-6.
59.
Transcription factor Pax6 is expressed by astroglia after transient brain ischemia in the rat model.
Steliga A, etal., Folia Neuropathol. 2013;51(3):203-13.
60.
Functional PAX-6 gene-linked polymorphic region: potential association with paranoid schizophrenia.
Stober G, etal., Biol Psychiatry 1999 Jun 15;45(12):1585-91.
61.
Pax6 regulates specification of ventral neurone subtypes in the hindbrain by establishing progenitor domains.
Takahashi M and Osumi N, Development 2002 Mar;129(6):1327-38.
62.
Pax6 regulates boundary-cell specification in the rat hindbrain.
Takahashi M and Osumi N, Mech Dev. 2011 May-Jun;128(5-6):289-302. doi: 10.1016/j.mod.2011.04.001. Epub 2011 Apr 9.
63.
Pax6 transcription factor is required for the interkinetic nuclear movement of neuroepithelial cells.
Tamai H, etal., Genes Cells. 2007 Sep;12(9):983-96.
64.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
65.
Evaluation of Pax6 mutant rat as a model for autism.
Umeda T, etal., PLoS One. 2010 Dec 21;5(12):e15500. doi: 10.1371/journal.pone.0015500.
66.
Variable phenotype related to a novel PAX 6 mutation (IVS4+5G>C) in a family presenting congenital nystagmus and foveal hypoplasia.
Vincent MC, etal., Am J Ophthalmol. 2004 Dec;138(6):1016-21.
67.
Prostaglandin E(2) enhances proliferation, dedifferentiation and stem-like properties of rat retinal Muller glial cells in vitro.
Wang L, etal., Ophthalmic Res. 2013;49(2):100-7. doi: 10.1159/000345256. Epub 2012 Dec 18.
68.
A splice site mutation in the PAX6 gene which induces exon skipping causes autosomal dominant inherited aniridia.
Weisschuh N, etal., Mol Vis. 2012;18:751-7. Epub 2012 Mar 29.
69.
Paired box 6 (PAX6) regulates glucose metabolism via proinsulin processing mediated by prohormone convertase 1/3 (PC1/3).
Wen JH, etal., Diabetologia. 2009 Mar;52(3):504-13. Epub 2008 Nov 26.
70.
Altered gene expression in rat cranial neural crest cells exposed to a teratogenic glucose concentration in vitro: paradoxical downregulation of antioxidative defense genes.
Wentzel P and Eriksson UJ, Birth Defects Res B Dev Reprod Toxicol. 2011 Oct;92(5):487-97. doi: 10.1002/bdrb.20321. Epub 2011 Aug 4.
71.
Dopamine receptor activation promotes adult neurogenesis in an acute Parkinson model.
Winner B, etal., Exp Neurol. 2009 Oct;219(2):543-52. doi: 10.1016/j.expneurol.2009.07.013. Epub 2009 Jul 18.
72.
Muller glia cells activation in rat retina after optic nerve injury: spatiotemporal correlation with transcription initiation factor IIb.
Xu Y, etal., J Mol Neurosci. 2013 Sep;51(1):37-46. doi: 10.1007/s12031-012-9941-z. Epub 2013 Jan 9.
73.
Pax6 regulates granule cell polarization during parallel fiber formation in the developing cerebellum.
Yamasaki T, etal., Development. 2001 Aug;128(16):3133-44.
74.
Corneal epithelial-like transdifferentiation of hair follicle stem cells is mediated by pax6 and beta-catenin/Lef-1.
Yang K, etal., Cell Biol Int. 2009 Aug;33(8):861-6. doi: 10.1016/j.cellbi.2009.04.009. Epub 2009 Apr 23.
Pax6 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 112,590,034 - 112,611,771 (+) NCBI GRCr8 mRatBN7.2 3 92,128,772 - 92,157,022 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 92,135,637 - 92,157,014 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 95,631,693 - 95,652,650 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 104,230,622 - 104,251,579 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 102,058,594 - 102,079,600 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 95,700,241 - 95,728,682 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 95,707,386 - 95,728,624 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 102,320,059 - 102,348,223 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 91,127,605 - 91,149,178 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 91,023,827 - 91,045,776 (+) NCBI Celera 3 91,190,477 - 91,211,449 (+) NCBI Celera RH 3.4 Map 3 722.9 RGD Cytogenetic Map 3 q33 NCBI
PAX6 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 31,789,026 - 31,817,961 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 31,784,779 - 31,817,961 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 31,810,574 - 31,839,509 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 31,767,034 - 31,789,455 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 11 31,768,057 - 31,789,341 NCBI Celera 11 31,953,799 - 31,986,960 (-) NCBI Celera Cytogenetic Map 11 p13 NCBI HuRef 11 31,501,758 - 31,535,259 (-) NCBI HuRef CHM1_1 11 31,805,847 - 31,839,030 (-) NCBI CHM1_1 T2T-CHM13v2.0 11 31,924,847 - 31,953,767 (-) NCBI T2T-CHM13v2.0
Pax6 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 105,499,241 - 105,528,755 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 105,499,245 - 105,527,709 (+) Ensembl GRCm39 Ensembl GRCm38 2 105,668,896 - 105,698,410 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 105,668,900 - 105,697,364 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 105,516,602 - 105,537,226 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 105,477,284 - 105,497,908 (+) NCBI MGSCv36 mm8 Celera 2 106,897,827 - 106,918,452 (+) NCBI Celera Cytogenetic Map 2 E3 NCBI cM Map 2 55.31 NCBI
Pax6 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955476 10,058,961 - 10,074,162 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955476 10,058,979 - 10,074,668 (-) NCBI ChiLan1.0 ChiLan1.0
PAX6 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 33,999,843 - 34,029,009 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 34,004,314 - 34,033,443 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 31,753,190 - 31,782,225 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 31,641,813 - 31,671,071 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 31,641,813 - 31,664,474 (-) Ensembl panpan1.1 panPan2
PAX6 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Dog10K_Boxer_Tasha 18 35,260,520 - 35,281,796 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 18 36,247,894 - 36,277,423 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 18 36,247,935 - 36,276,689 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 18 35,828,719 - 35,849,973 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 18 35,410,013 - 35,431,263 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 18 36,045,041 - 36,066,313 (+) NCBI UU_Cfam_GSD_1.0
Pax6 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 32,827,732 - 32,856,209 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936533 5,957,971 - 5,982,075 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936533 5,952,529 - 5,980,889 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PAX6 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 28,978,287 - 29,001,200 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 28,971,565 - 29,001,149 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 31,478,545 - 31,510,656 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PAX6 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 1 33,386,165 - 33,414,605 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 1 33,392,970 - 33,414,587 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 130,542,963 - 130,572,341 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Pax6
.
Predicted Target Of
Count of predictions: 162 Count of miRNA genes: 63 Interacting mature miRNAs: 78 Transcripts: ENSRNOT00000005882, ENSRNOT00000006302 Prediction methods: Miranda, Targetscan Result types: miRGate_prediction
2301414 Kidm37 Kidney mass QTL 37 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 3 70653097 121056321 Rat 1582238 Bw68 Body weight QTL 68 3.2 0.0064 body mass (VT:0001259) body weight (CMO:0000012) 3 53184593 115665732 Rat 1582239 Epfw1 Epididymal fat weight QTL 1 4.5 0.0006 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 3 53184593 115665732 Rat 70216 Cm14 Cardiac mass QTL 14 2.1 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 31172320 163586636 Rat 2292591 Esta4 Estrogen-induced thymic atrophy QTL 4 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 3 47233211 147415807 Rat 1358362 Srcrt2 Stress Responsive Cort QTL 2 2.78 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 3 38192233 133483320 Rat 737818 Hcar12 Hepatocarcinoma resistance QTL 12 2.6 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 3 29463235 118376539 Rat 1582218 Bw74 Body weight QTL 74 3.9 0.0021 body mass (VT:0001259) body weight (CMO:0000012) 3 53184593 115665732 Rat 1582221 Kidm30 Kidney mass QTL 30 3.5 0.0008 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 3 64655305 115665732 Rat 1581568 Rf53 Renal function QTL 53 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 3 56395968 161299569 Rat 1582210 Bw71 Body weight QTL 71 3.3 0.0012 body mass (VT:0001259) body weight (CMO:0000012) 3 64655305 115665732 Rat 7387306 Bw124 Body weight QTL 124 3.2 0.0003 body mass (VT:0001259) body weight (CMO:0000012) 3 84091273 129091273 Rat 1300111 Rf12 Renal function QTL 12 3.78 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 3 61017749 121056321 Rat 724523 Tsu1 Thymus enlargement suppressive QTL 1 3.84 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 3 50437504 115638231 Rat 1600376 Arunc5 Aerobic running capacity QTL 5 0.21 exercise endurance trait (VT:0002332) maximum distance run on treadmill (CMO:0001406) 3 73376539 118376539 Rat 8694437 Bw167 Body weight QTL 167 22.46 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 3 91797474 136797474 Rat 2302273 Gluco35 Glucose level QTL 35 5.3 0.001 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 80800231 114297550 Rat 8662816 Vetf4 Vascular elastic tissue fragility QTL 4 4 renal artery integrity trait (VT:0010642) number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563) 3 59242096 157323038 Rat 1559282 Emca5 Estrogen-induced mammary cancer QTL 5 3.9 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 3 43827364 169034231 Rat 1581503 Cm58 Cardiac mass QTL 58 2.7 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 43827364 121056321 Rat 2292613 Ept16 Estrogen-induced pituitary tumorigenesis QTL 16 8.3 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 3 47233430 110362260 Rat 631649 Bp123 Blood pressure QTL 123 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 89772419 134772419 Rat 61419 Cia11 Collagen induced arthritis QTL 11 5.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 3 30356773 98535386 Rat 12879848 Bw181 Body weght QTL 181 0.015 body mass (VT:0001259) body weight (CMO:0000012) 3 70348525 121056321 Rat 2301971 Cm71 Cardiac mass QTL 71 4.63 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 3 41874578 155617519 Rat 1358885 Bp251 Blood pressure QTL 251 3.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 1354597 Kidm13 Kidney mass QTL 13 2.9 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 3 41874578 104104347 Rat 2301970 Bw81 Body weight QTL 81 5.19 body mass (VT:0001259) body weight (CMO:0000012) 3 41874578 155617519 Rat 1581546 Pur13 Proteinuria QTL 13 2.93 0.0335 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 3 78196190 146592722 Rat 1354604 Bw36 Body weight QTL 36 2.9 body mass (VT:0001259) body weight (CMO:0000012) 3 33703347 104104347 Rat 631665 Bw8 Body weight QTL 8 5.5 body mass (VT:0001259) body weight (CMO:0000012) 3 50437042 119183768 Rat 1358888 Bp264 Blood pressure QTL 264 4.43 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 1358186 Ept2 Estrogen-induced pituitary tumorigenesis QTL 2 8.3 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 3 47233430 110362260 Rat
RH94662
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 92,156,482 - 92,156,661 (+) MAPPER mRatBN7.2 Rnor_6.0 3 95,728,022 - 95,728,200 NCBI Rnor6.0 Rnor_5.0 3 102,347,862 - 102,348,040 UniSTS Rnor5.0 RGSC_v3.4 3 91,148,817 - 91,148,995 UniSTS RGSC3.4 Celera 3 91,211,088 - 91,211,266 UniSTS RH 3.4 Map 3 722.9 UniSTS Cytogenetic Map 3 q32 UniSTS
RH94663
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 3 112,590,501 - 112,590,611 (+) Marker Load Pipeline mRatBN7.2 3 92,135,747 - 92,135,857 (+) MAPPER mRatBN7.2 Rnor_6.0 3 95,707,292 - 95,707,401 NCBI Rnor6.0 Rnor_5.0 3 102,327,132 - 102,327,241 UniSTS Rnor5.0 RGSC_v3.4 3 91,127,511 - 91,127,620 UniSTS RGSC3.4 Celera 3 91,190,383 - 91,190,492 UniSTS Cytogenetic Map 3 q32 UniSTS
GDB:197570
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 3 112,609,999 - 112,610,845 (+) Marker Load Pipeline mRatBN7.2 3 92,155,250 - 92,156,096 (+) MAPPER mRatBN7.2 Rnor_6.0 3 95,726,790 - 95,727,635 NCBI Rnor6.0 Rnor_5.0 3 102,346,630 - 102,347,475 UniSTS Rnor5.0 RGSC_v3.4 3 91,147,585 - 91,148,430 UniSTS RGSC3.4 Celera 3 91,209,856 - 91,210,701 UniSTS Cytogenetic Map 3 q32 UniSTS
GDB:344354
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 92,143,651 - 92,143,782 (+) MAPPER mRatBN7.2 Rnor_6.0 3 95,715,194 - 95,715,324 NCBI Rnor6.0 Rnor_5.0 3 102,335,034 - 102,335,164 UniSTS Rnor5.0 RGSC_v3.4 3 91,135,415 - 91,135,545 UniSTS RGSC3.4 Celera 3 91,198,289 - 91,198,419 UniSTS Cytogenetic Map 3 q32 UniSTS
PMC186446P1
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 3 112,607,288 - 112,607,469 (+) Marker Load Pipeline mRatBN7.2 3 92,152,539 - 92,152,720 (+) MAPPER mRatBN7.2 Rnor_6.0 3 95,724,079 - 95,724,259 NCBI Rnor6.0 Rnor_5.0 3 102,343,919 - 102,344,099 UniSTS Rnor5.0 RGSC_v3.4 3 91,144,340 - 91,144,520 UniSTS RGSC3.4 Celera 3 91,207,145 - 91,207,325 UniSTS Cytogenetic Map 3 q32 UniSTS
Pax6
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 92,143,668 - 92,143,780 (+) MAPPER mRatBN7.2 Rnor_6.0 3 95,715,211 - 95,715,322 NCBI Rnor6.0 Rnor_5.0 3 102,335,051 - 102,335,162 UniSTS Rnor5.0 RGSC_v3.4 3 91,135,432 - 91,135,543 UniSTS RGSC3.4 Celera 3 91,198,306 - 91,198,417 UniSTS Cytogenetic Map 3 q32 UniSTS
D12Bir2
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 92,143,663 - 92,144,747 (+) MAPPER mRatBN7.2 Rnor_6.0 3 95,715,206 - 95,716,289 NCBI Rnor6.0 Rnor_5.0 3 102,335,046 - 102,336,129 UniSTS Rnor5.0 RGSC_v3.4 3 91,135,427 - 91,136,510 UniSTS RGSC3.4 Celera 3 91,198,301 - 91,199,384 UniSTS Cytogenetic Map 3 q32 UniSTS
This gene Pax6 is modified in the following models/strains:
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
3
22
99
41
38
27
13
27
2
98
40
93
19
54
11
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000005882 ⟹ ENSRNOP00000005882
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 92,135,637 - 92,157,014 (+) Ensembl Rnor_6.0 Ensembl 3 95,707,386 - 95,728,382 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000006302 ⟹ ENSRNOP00000006302
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 92,143,229 - 92,157,014 (+) Ensembl Rnor_6.0 Ensembl 3 95,711,555 - 95,728,624 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000089525 ⟹ ENSRNOP00000071013
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 92,135,637 - 92,157,014 (+) Ensembl Rnor_6.0 Ensembl 3 95,715,193 - 95,727,664 (+) Ensembl
RefSeq Acc Id:
NM_013001 ⟹ NP_037133
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 112,590,596 - 112,611,593 (+) NCBI mRatBN7.2 3 92,135,842 - 92,156,844 (+) NCBI Rnor_6.0 3 95,707,386 - 95,728,383 (+) NCBI Rnor_5.0 3 102,320,059 - 102,348,223 (+) NCBI RGSC_v3.4 3 91,127,605 - 91,149,178 (+) RGD Celera 3 91,190,477 - 91,211,449 (+) RGD
Sequence:
GCGACGAAAGAGAGGATGCCTCTTAAAGGCAGAAGACTTTAACTAGGGGCGGGCGAGCAGATGTGTGAGATCTTCTATTCAAAGAGTGGACATATAGCCCAGTTTTCAGAGCCACGTATTCGAGCCCC
hide sequence
RefSeq Acc Id:
XM_006234633 ⟹ XP_006234695
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 112,590,034 - 112,611,771 (+) NCBI mRatBN7.2 3 92,135,285 - 92,157,022 (+) NCBI Rnor_6.0 3 95,706,982 - 95,728,682 (+) NCBI Rnor_5.0 3 102,320,059 - 102,348,223 (+) NCBI
Sequence:
GATGATGACAGAGGTCAGGCTTCGCTAATGGGCCAGTGAGGAGCGGTGGAGGCGAGGCCGGGCG
hide sequence
RefSeq Acc Id:
XM_039104376 ⟹ XP_038960304
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 112,590,647 - 112,611,771 (+) NCBI mRatBN7.2 3 92,135,888 - 92,157,022 (+) NCBI
RefSeq Acc Id:
XM_063283158 ⟹ XP_063139228
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 112,590,045 - 112,611,771 (+) NCBI
RefSeq Acc Id:
NP_037133 ⟸ NM_013001
- UniProtKB:
Q6QHS5 (UniProtKB/Swiss-Prot), A1A5N7 (UniProtKB/Swiss-Prot), Q701Q8 (UniProtKB/Swiss-Prot), P63016 (UniProtKB/Swiss-Prot), E1AZB1 (UniProtKB/TrEMBL)
- Sequence:
MQNSHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYETGSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLR
hide sequence
RefSeq Acc Id:
XP_006234695 ⟸ XM_006234633
- Peptide Label:
isoform X1
- UniProtKB:
E1AZB1 (UniProtKB/TrEMBL)
- Sequence:
MQNSHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQTHADAKVQVLDSENVSN
hide sequence
Ensembl Acc Id:
ENSRNOP00000006302 ⟸ ENSRNOT00000006302
Ensembl Acc Id:
ENSRNOP00000071013 ⟸ ENSRNOT00000089525
Ensembl Acc Id:
ENSRNOP00000005882 ⟸ ENSRNOT00000005882
RefSeq Acc Id:
XP_038960304 ⟸ XM_039104376
- Peptide Label:
isoform X1
- UniProtKB:
E1AZB1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063139228 ⟸ XM_063283158
- Peptide Label:
isoform X2
- UniProtKB:
Q701Q8 (UniProtKB/Swiss-Prot), Q6QHS5 (UniProtKB/Swiss-Prot), P63016 (UniProtKB/Swiss-Prot), A1A5N7 (UniProtKB/Swiss-Prot), E1AZB1 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-06-10
Pax6
Paired box homeotic gene 6
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_disease
mutations in human homolog are associated with several eye disorders, including aniridia and Peter's anomoly
731242
gene_expression
protein expressed in hindbrain and forebrain
731242
gene_mutations_overexpression
point mutation in rat (rSey) exhibits abnormal development of hindbrain motor neurons
731242
gene_process
controls ventral neurons specification by establishing the correct progenitor domains
729590
gene_process
may regulate Isl2 and Wnt7b expression
731242
gene_process
involved with the specification of hindbrain motor neuron subtype
731242
gene_process
regulates specific neural pathways during forebrain development
731242
gene_process
plays role in axon guidance of specific motor neurons in the hindbrain
731242
gene_process
role in axon guidance crucial for development of the thalamocortical neuronal pathway
731243
