Symbol:
S100a4
Name:
S100 calcium-binding protein A4
RGD ID:
3245
Description:
Enables actin binding activity; calcium ion binding activity; and calcium-dependent protein binding activity. Predicted to be involved in positive regulation of canonical NF-kappaB signal transduction. Predicted to be located in cytosol and nucleoplasm. Predicted to be active in extracellular space; nucleus; and perinuclear region of cytoplasm. Orthologous to human S100A4 (S100 calcium binding protein A4); PARTICIPATES IN calcium/calcium-mediated signaling pathway; INTERACTS WITH 1,3,5-trinitro-1,3,5-triazinane; 17alpha-ethynylestradiol; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
18A2; 42A; calvasculin; CAPL; metastasin; MTS1; nerve growth factor-induced protein 42A; P9K; P9ka; PEL98; placental calcium-binding protein; protein 9 Ka homologous to calcium-binding protein; protein S100-A4; RNP9KA
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
S100A4 (S100 calcium binding protein A4) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
S100a4 (S100 calcium binding protein A4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
S100a4 (S100 calcium binding protein A4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
S100A4 (S100 calcium binding protein A4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
S100A4 (S100 calcium binding protein A4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
S100a4 (S100 calcium binding protein A4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
S100A4 (S100 calcium binding protein A4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
S100A4 (S100 calcium binding protein A4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
S100a4 (S100 calcium binding protein A4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
S100Z (S100 calcium binding protein Z) HGNC
OrthoDB
Homo sapiens (human):
S100A2 (S100 calcium binding protein A2) HGNC
OrthoDB
Homo sapiens (human):
NIBAN3 (niban apoptosis regulator 3) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
S100A4 (S100 calcium binding protein A4)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
S100a4 (S100 calcium binding protein A4)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
s100t (S100 calcium binding protein T)
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Danio rerio (zebrafish):
s100s (S100 calcium binding protein S)
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Danio rerio (zebrafish):
icn (ictacalcin)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Danio rerio (zebrafish):
icn2 (ictacalcin 2)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 178,388,529 - 178,390,838 (+) NCBI GRCr8 mRatBN7.2 2 176,090,951 - 176,093,258 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 176,091,804 - 176,093,254 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 183,231,137 - 183,233,459 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 181,253,405 - 181,255,727 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 175,853,265 - 175,855,593 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 189,997,278 - 189,999,587 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 189,997,129 - 189,999,604 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 209,431,373 - 209,433,680 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 182,885,070 - 182,887,380 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 182,835,175 - 182,837,486 (+) NCBI Celera 2 170,025,678 - 170,027,982 (+) NCBI Celera RH 3.4 Map 2 1164.6 RGD Cytogenetic Map 2 q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
S100a4 Rat (-)-demecolcine increases expression ISO S100A4 (Homo sapiens) 6480464 Demecolcine results in increased expression of S100A4 mRNA CTD PMID:23649840 S100a4 Rat 1,2-dichloroethane increases expression ISO S100a4 (Mus musculus) 6480464 ethylene dichloride results in increased expression of S100A4 mRNA CTD PMID:28960355 S100a4 Rat 1,3,5-trinitro-1,3,5-triazinane increases expression EXP 6480464 cyclonite results in increased expression of S100A4 mRNA CTD PMID:25559034 S100a4 Rat 1,4-dithiothreitol multiple interactions ISO S100A4 (Homo sapiens) 6480464 Dithiothreitol inhibits the reaction [Copper promotes the reaction [S100A4 protein binds to S100A4 protein]] CTD PMID:21924240 S100a4 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of S100A4 mRNA CTD PMID:12655037 S100a4 Rat 17beta-estradiol multiple interactions ISO S100A4 (Homo sapiens) 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in increased expression of S100A4 mRNA CTD PMID:19619570 S100a4 Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of S100A4 mRNA and [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of S100A4 mRNA CTD PMID:26496021 and PMID:32741896 S100a4 Rat 17beta-estradiol increases expression ISO S100a4 (Mus musculus) 6480464 Estradiol results in increased expression of S100A4 mRNA CTD PMID:19484750 S100a4 Rat 17beta-estradiol decreases expression ISO S100A4 (Homo sapiens) 6480464 Estradiol results in decreased expression of S100A4 mRNA CTD PMID:23019147 and PMID:31614463 S100a4 Rat 17beta-estradiol increases expression ISO S100A4 (Homo sapiens) 6480464 Estradiol results in increased expression of S100A4 mRNA CTD PMID:19619570 S100a4 Rat 17beta-estradiol 3-benzoate multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of S100A4 mRNA CTD PMID:32741896 S100a4 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO S100A4 (Homo sapiens) 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in increased expression of S100A4 mRNA and Cycloheximide inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of S100A4 mRNA] CTD PMID:11007951 and PMID:19619570 S100a4 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of S100A4 mRNA CTD PMID:33387578 S100a4 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of S100A4 mRNA CTD PMID:34747641 S100a4 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO S100a4 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of S100A4 mRNA CTD PMID:17337447 and PMID:24154488 S100a4 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO S100a4 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of S100A4 mRNA CTD PMID:15034205 more ... S100a4 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of S100A4 mRNA CTD PMID:22808131 S100a4 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO S100A4 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of S100A4 mRNA CTD PMID:11007951 and PMID:19619570 S100a4 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO S100a4 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with 4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone] results in decreased expression of S100A4 mRNA and Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to S100A4 promoter] CTD PMID:19654925 and PMID:21167638 S100a4 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO S100a4 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 S100a4 Rat 2-nitrotoluene increases expression ISO S100a4 (Mus musculus) 6480464 2-nitrotoluene results in increased expression of S100A4 mRNA CTD PMID:15612046 S100a4 Rat 4,4'-diaminodiphenylmethane increases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of S100A4 mRNA CTD PMID:30723492 S100a4 Rat 4,4'-sulfonyldiphenol decreases expression ISO S100A4 (Homo sapiens) 6480464 bisphenol S results in decreased expression of S100A4 mRNA CTD PMID:25912373 and PMID:38568856 S100a4 Rat 4,4'-sulfonyldiphenol increases expression ISO S100A4 (Homo sapiens) 6480464 bisphenol S results in increased expression of S100A4 protein CTD PMID:34186270 S100a4 Rat 4,4'-sulfonyldiphenol increases expression ISO S100a4 (Mus musculus) 6480464 bisphenol S results in increased expression of S100A4 mRNA CTD PMID:39298647 S100a4 Rat 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one decreases expression ISO S100a4 (Mus musculus) 6480464 4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone results in decreased expression of S100A4 mRNA CTD PMID:21167638 S100a4 Rat 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one multiple interactions ISO S100a4 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with 4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone] results in decreased expression of S100A4 mRNA CTD PMID:21167638 S100a4 Rat 4-hydroxyphenyl retinamide decreases expression ISO S100a4 (Mus musculus) 6480464 Fenretinide results in decreased expression of S100A4 mRNA CTD PMID:28973697 S100a4 Rat 5-aza-2'-deoxycytidine affects methylation ISO S100A4 (Homo sapiens) 6480464 Decitabine affects the methylation of S100A4 gene CTD PMID:17579622 S100a4 Rat 5-aza-2'-deoxycytidine affects expression ISO S100A4 (Homo sapiens) 6480464 Decitabine affects the expression of S100A4 mRNA CTD PMID:23300844 S100a4 Rat 5-aza-2'-deoxycytidine increases expression ISO S100A4 (Homo sapiens) 6480464 Decitabine results in increased expression of S100A4 mRNA CTD PMID:19194470 S100a4 Rat 5-fluorouracil affects response to substance ISO S100A4 (Homo sapiens) 6480464 S100A4 protein affects the susceptibility to Fluorouracil CTD PMID:15352031 S100a4 Rat 5-fluorouracil decreases expression ISO S100A4 (Homo sapiens) 6480464 Fluorouracil results in decreased expression of S100A4 protein CTD PMID:15352031 S100a4 Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of S100A4 mRNA CTD PMID:24780913 S100a4 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of S100A4 mRNA CTD PMID:30047161 S100a4 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of S100A4 mRNA CTD PMID:25825206 S100a4 Rat acetylsalicylic acid increases expression ISO S100A4 (Homo sapiens) 6480464 Aspirin results in increased expression of S100A4 mRNA CTD PMID:14976132 S100a4 Rat acetylsalicylic acid decreases expression ISO S100A4 (Homo sapiens) 6480464 Aspirin results in decreased expression of S100A4 mRNA CTD PMID:20457246 S100a4 Rat acrolein increases expression ISO S100a4 (Mus musculus) 6480464 Acrolein results in increased expression of S100A4 mRNA CTD PMID:18515264 S100a4 Rat actinomycin D multiple interactions ISO S100A4 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of S100A4 protein CTD PMID:38460933 S100a4 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of S100A4 mRNA CTD PMID:25378103 S100a4 Rat all-trans-retinoic acid decreases expression ISO S100A4 (Homo sapiens) 6480464 Tretinoin results in decreased expression of S100A4 mRNA and Tretinoin results in decreased expression of S100A4 protein CTD PMID:21934132 and PMID:30093655 S100a4 Rat all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of S100A4 mRNA CTD PMID:24977338 S100a4 Rat all-trans-retinoic acid increases expression ISO S100A4 (Homo sapiens) 6480464 Tretinoin results in increased expression of S100A4 mRNA CTD PMID:15498508 and PMID:33167477 S100a4 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of S100A4 mRNA CTD PMID:30047161 S100a4 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of S100A4 mRNA CTD PMID:16483693 S100a4 Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of S100A4 mRNA CTD PMID:30779732 S100a4 Rat andrographolide multiple interactions EXP 6480464 andrographolide inhibits the reaction [Bleomycin results in increased expression of S100A4 protein] CTD PMID:31706003 S100a4 Rat anthra[1,9-cd]pyrazol-6(2H)-one multiple interactions ISO S100A4 (Homo sapiens) 6480464 pyrazolanthrone inhibits the reaction [S100A4 protein results in increased expression of MMP13 protein] CTD PMID:16948116 S100a4 Rat antimycin A increases expression ISO S100A4 (Homo sapiens) 6480464 Antimycin A results in increased expression of S100A4 mRNA CTD PMID:33512557 S100a4 Rat apocynin multiple interactions ISO S100a4 (Mus musculus) 6480464 acetovanillone inhibits the reaction [Homocysteine results in increased expression of S100A4 protein] CTD PMID:21647593 S100a4 Rat aristolochic acid A increases expression ISO S100A4 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of S100A4 mRNA CTD PMID:33212167 S100a4 Rat arsenous acid decreases expression ISO S100A4 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of S100A4 protein CTD PMID:30093655 S100a4 Rat ATP multiple interactions ISO S100a4 (Mus musculus) 6480464 Adenosine Triphosphate results in increased expression of and results in increased secretion of S100A4 protein and Niclosamide inhibits the reaction [Adenosine Triphosphate results in increased expression of S100A4 protein] CTD PMID:29733962 S100a4 Rat ATP increases expression ISO S100A4 (Homo sapiens) 6480464 Adenosine Triphosphate results in increased expression of S100A4 mRNA CTD PMID:29733962 S100a4 Rat ATP multiple interactions ISO S100A4 (Homo sapiens) 6480464 Adenosine Triphosphate results in increased expression of and results in increased secretion of S100A4 protein and Niclosamide inhibits the reaction [Adenosine Triphosphate results in increased expression of S100A4 protein] CTD PMID:29733962 S100a4 Rat ATP increases expression ISO S100a4 (Mus musculus) 6480464 Adenosine Triphosphate results in increased expression of S100A4 mRNA CTD PMID:29733962 S100a4 Rat atrazine decreases expression ISO S100A4 (Homo sapiens) 6480464 Atrazine results in decreased expression of S100A4 mRNA CTD PMID:24211529 S100a4 Rat atrazine increases expression ISO S100A4 (Homo sapiens) 6480464 Atrazine results in increased expression of S100A4 mRNA CTD PMID:22378314 S100a4 Rat atrazine multiple interactions ISO S100A4 (Homo sapiens) 6480464 Atrazine inhibits the reaction [Tetradecanoylphorbol Acetate results in increased expression of S100A4 mRNA] CTD PMID:24211529 S100a4 Rat azoxystrobin increases expression ISO S100A4 (Homo sapiens) 6480464 azoxystrobin results in increased expression of S100A4 mRNA CTD PMID:33512557 S100a4 Rat benzo[a]pyrene increases expression ISO S100a4 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of S100A4 mRNA CTD PMID:22228805 S100a4 Rat benzo[a]pyrene increases expression ISO S100A4 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of S100A4 mRNA CTD PMID:32234424 S100a4 Rat benzo[a]pyrene affects methylation ISO S100A4 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of S100A4 promoter CTD PMID:27901495 S100a4 Rat benzo[a]pyrene increases methylation ISO S100A4 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of S100A4 5' UTR CTD PMID:27901495 S100a4 Rat benzo[a]pyrene decreases expression ISO S100a4 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of S100A4 mRNA CTD PMID:15034205 and PMID:21569818 S100a4 Rat benzo[a]pyrene multiple interactions ISO S100a4 (Mus musculus) 6480464 AHR protein promotes the reaction [Benzo(a)pyrene results in decreased expression of S100A4 mRNA] CTD PMID:15034205 S100a4 Rat benzo[a]pyrene diol epoxide I increases expression ISO S100A4 (Homo sapiens) 6480464 7 more ... CTD PMID:20382639 S100a4 Rat benzo[b]fluoranthene increases expression ISO S100a4 (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of S100A4 mRNA CTD PMID:26377693 S100a4 Rat beta-lapachone increases expression ISO S100A4 (Homo sapiens) 6480464 beta-lapachone results in increased expression of S100A4 mRNA CTD PMID:38218311 S100a4 Rat beta-naphthoflavone increases expression ISO S100A4 (Homo sapiens) 6480464 beta-Naphthoflavone results in increased expression of S100A4 mRNA CTD PMID:32151702 S100a4 Rat bilirubin IXalpha decreases expression ISO S100A4 (Homo sapiens) 6480464 Bilirubin results in decreased expression of S100A4 mRNA CTD PMID:20196124 S100a4 Rat bis(2-chloroethyl) sulfide increases expression ISO S100A4 (Homo sapiens) 6480464 Mustard Gas results in increased expression of S100A4 mRNA CTD PMID:25102026 S100a4 Rat bis(2-ethylhexyl) phthalate increases expression ISO S100a4 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of S100A4 mRNA CTD PMID:28085963 S100a4 Rat bis(2-ethylhexyl) phthalate decreases expression ISO S100A4 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in decreased expression of S100A4 protein CTD PMID:31163220 S100a4 Rat bisphenol A increases expression ISO S100a4 (Mus musculus) 6480464 bisphenol A results in increased expression of S100A4 mRNA and bisphenol A results in increased expression of S100A4 protein CTD PMID:15215581 more ... S100a4 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of S100A4 mRNA CTD PMID:30816183 and PMID:32528016 S100a4 Rat bisphenol A affects expression ISO S100A4 (Homo sapiens) 6480464 bisphenol A affects the expression of S100A4 mRNA CTD PMID:30903817 S100a4 Rat bisphenol A decreases expression ISO S100A4 (Homo sapiens) 6480464 bisphenol A results in decreased expression of S100A4 mRNA CTD PMID:25912373 and PMID:38568856 S100a4 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of S100A4 mRNA CTD PMID:25181051 S100a4 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of S100A4 mRNA CTD PMID:26496021 S100a4 Rat bisphenol AF decreases expression ISO S100A4 (Homo sapiens) 6480464 bisphenol AF results in decreased expression of S100A4 mRNA CTD PMID:25912373 S100a4 Rat bisphenol AF increases expression ISO S100A4 (Homo sapiens) 6480464 bisphenol AF results in increased expression of S100A4 protein CTD PMID:34186270 S100a4 Rat bisphenol F increases expression ISO S100A4 (Homo sapiens) 6480464 bisphenol F results in increased expression of S100A4 protein CTD PMID:34186270 S100a4 Rat bleomycin A2 increases expression EXP 6480464 Bleomycin results in increased expression of S100A4 protein CTD PMID:25933445 and PMID:31706003 S100a4 Rat bleomycin A2 multiple interactions EXP 6480464 andrographolide inhibits the reaction [Bleomycin results in increased expression of S100A4 protein] CTD PMID:31706003 S100a4 Rat calcitriol decreases expression ISO S100A4 (Homo sapiens) 6480464 Calcitriol results in decreased expression of S100A4 mRNA CTD PMID:26485663 S100a4 Rat capsaicin increases expression ISO S100A4 (Homo sapiens) 6480464 Capsaicin results in increased expression of S100A4 mRNA CTD PMID:21310942 S100a4 Rat carbon nanotube affects expression ISO S100a4 (Mus musculus) 6480464 Nanotubes and Carbon affects the expression of S100A4 mRNA CTD PMID:23845593 and PMID:25554681 S100a4 Rat carbon nanotube increases expression ISO S100a4 (Mus musculus) 6480464 Nanotubes and Carbon analog results in increased expression of S100A4 mRNA CTD PMID:25554681 S100a4 Rat carbon nanotube decreases expression ISO S100a4 (Mus musculus) 6480464 Nanotubes and Carbon analog results in decreased expression of S100A4 mRNA CTD PMID:25620056 S100a4 Rat celastrol increases expression ISO S100A4 (Homo sapiens) 6480464 celastrol results in increased expression of S100A4 mRNA CTD PMID:39181414 S100a4 Rat chloroprene decreases expression ISO S100a4 (Mus musculus) 6480464 Chloroprene results in decreased expression of S100A4 mRNA CTD PMID:23125180 S100a4 Rat choline multiple interactions ISO S100a4 (Mus musculus) 6480464 [Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of S100A4 mRNA and [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of S100A4 mRNA CTD PMID:20938992 and PMID:23439872 S100a4 Rat cisplatin increases expression ISO S100A4 (Homo sapiens) 6480464 Cisplatin results in increased expression of S100A4 mRNA CTD PMID:27594783 S100a4 Rat cisplatin affects expression ISO S100A4 (Homo sapiens) 6480464 Cisplatin affects the expression of S100A4 mRNA CTD PMID:23300844 S100a4 Rat cisplatin affects expression ISO S100a4 (Mus musculus) 6480464 Cisplatin affects the expression of S100A4 mRNA CTD PMID:21151649 S100a4 Rat cobalt dichloride decreases expression ISO S100A4 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of S100A4 mRNA CTD PMID:17553155 and PMID:19376846 S100a4 Rat copper atom affects binding ISO S100A4 (Homo sapiens) 6480464 Copper binds to S100A4 protein CTD PMID:21924240 S100a4 Rat copper atom decreases expression EXP 6480464 Copper results in decreased expression of S100A4 mRNA CTD PMID:30556269 S100a4 Rat copper atom multiple interactions ISO S100A4 (Homo sapiens) 6480464 Ascorbic Acid inhibits the reaction [Copper promotes the reaction [S100A4 protein binds to S100A4 protein]] more ... CTD PMID:21924240 S100a4 Rat copper(0) affects binding ISO S100A4 (Homo sapiens) 6480464 Copper binds to S100A4 protein CTD PMID:21924240 S100a4 Rat copper(0) decreases expression EXP 6480464 Copper results in decreased expression of S100A4 mRNA CTD PMID:30556269 S100a4 Rat copper(0) multiple interactions ISO S100A4 (Homo sapiens) 6480464 Ascorbic Acid inhibits the reaction [Copper promotes the reaction [S100A4 protein binds to S100A4 protein]] more ... CTD PMID:21924240 S100a4 Rat copper(II) chloride decreases expression ISO S100A4 (Homo sapiens) 6480464 cupric chloride results in decreased expression of S100A4 mRNA CTD PMID:38568856 S100a4 Rat copper(II) sulfate increases expression ISO S100A4 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of S100A4 mRNA CTD PMID:19549813 S100a4 Rat cycloheximide multiple interactions ISO S100A4 (Homo sapiens) 6480464 Cycloheximide inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of S100A4 mRNA] CTD PMID:11007951 S100a4 Rat cyclosporin A increases expression EXP 6480464 Cyclosporine results in increased expression of S100A4 mRNA CTD PMID:21865292 S100a4 Rat cyclosporin A decreases expression ISO S100A4 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of S100A4 mRNA CTD PMID:25562108 and PMID:27989131 S100a4 Rat cyclosporin A increases expression ISO S100a4 (Mus musculus) 6480464 Cyclosporine results in increased expression of S100A4 mRNA CTD PMID:21354196 S100a4 Rat cytarabine decreases expression ISO S100A4 (Homo sapiens) 6480464 Cytarabine results in decreased expression of S100A4 mRNA CTD PMID:21198554 S100a4 Rat D-penicillamine increases expression EXP 6480464 Penicillamine results in increased expression of S100A4 mRNA CTD PMID:19575532 S100a4 Rat DDE decreases expression ISO S100A4 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of S100A4 mRNA CTD PMID:38568856 S100a4 Rat deoxynivalenol decreases expression ISO S100A4 (Homo sapiens) 6480464 deoxynivalenol results in decreased expression of S100A4 mRNA CTD PMID:31863870 S100a4 Rat dexamethasone increases expression ISO S100A4 (Homo sapiens) 6480464 Dexamethasone results in increased expression of S100A4 mRNA CTD PMID:25047013 S100a4 Rat dextran sulfate increases expression ISO S100a4 (Mus musculus) 6480464 Dextran Sulfate results in increased expression of S100A4 protein CTD PMID:32272095 S100a4 Rat dextran sulfate decreases expression ISO S100a4 (Mus musculus) 6480464 Dextran Sulfate results in decreased expression of S100A4 protein CTD PMID:35362542 S100a4 Rat dextran sulfate multiple interactions ISO S100a4 (Mus musculus) 6480464 Erianin inhibits the reaction [Dextran Sulfate results in increased expression of S100A4 protein] and evodiamine inhibits the reaction [Dextran Sulfate results in decreased expression of S100A4 protein] CTD PMID:32272095 and PMID:35362542 S100a4 Rat diarsenic trioxide decreases expression ISO S100A4 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of S100A4 protein CTD PMID:30093655 S100a4 Rat Diosbulbin B increases expression ISO S100a4 (Mus musculus) 6480464 diosbulbin B results in increased expression of S100A4 mRNA and diosbulbin B results in increased expression of S100A4 protein CTD PMID:30401638 S100a4 Rat dioxygen multiple interactions ISO S100a4 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of S100A4 mRNA CTD PMID:30529165 S100a4 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of S100A4 mRNA CTD PMID:21551480 S100a4 Rat diuron decreases expression ISO S100A4 (Homo sapiens) 6480464 Diuron results in decreased expression of S100A4 mRNA CTD PMID:35967413 S100a4 Rat dopamine increases expression EXP 6480464 Dopamine results in increased expression of S100A4 mRNA CTD PMID:21983523 S100a4 Rat dorsomorphin multiple interactions ISO S100A4 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 S100a4 Rat doxorubicin increases expression ISO S100A4 (Homo sapiens) 6480464 Doxorubicin results in increased expression of S100A4 mRNA CTD PMID:29803840 S100a4 Rat endosulfan increases expression ISO S100A4 (Homo sapiens) 6480464 Endosulfan results in increased expression of S100A4 mRNA CTD PMID:22677888 S100a4 Rat entinostat increases expression ISO S100A4 (Homo sapiens) 6480464 entinostat results in increased expression of S100A4 mRNA CTD PMID:26272509 and PMID:27188386 S100a4 Rat entinostat multiple interactions ISO S100A4 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of S100A4 mRNA CTD PMID:27188386 S100a4 Rat epoxiconazole increases expression ISO S100a4 (Mus musculus) 6480464 epoxiconazole results in increased expression of S100A4 mRNA CTD PMID:35436446 S100a4 Rat ethanol increases expression ISO S100A4 (Homo sapiens) 6480464 Ethanol results in increased expression of S100A4 mRNA CTD PMID:15963989 S100a4 Rat ethylenediaminetetraacetic acid multiple interactions ISO S100A4 (Homo sapiens) 6480464 Edetic Acid inhibits the reaction [Copper promotes the reaction [S100A4 protein binds to S100A4 protein]] CTD PMID:21924240 S100a4 Rat ethylparaben increases expression ISO S100A4 (Homo sapiens) 6480464 ethyl-p-hydroxybenzoate results in increased expression of S100A4 mRNA CTD PMID:37690743 S100a4 Rat Evodiamine multiple interactions ISO S100a4 (Mus musculus) 6480464 evodiamine inhibits the reaction [Dextran Sulfate results in decreased expression of S100A4 protein] CTD PMID:35362542 S100a4 Rat fenoldopam increases expression EXP 6480464 Fenoldopam results in increased expression of S100A4 mRNA CTD PMID:21983523 S100a4 Rat fenpyroximate increases expression ISO S100A4 (Homo sapiens) 6480464 fenpyroximate results in increased expression of S100A4 mRNA CTD PMID:33512557 S100a4 Rat fluoranthene multiple interactions ISO S100a4 (Mus musculus) 6480464 [1-methylanthracene co-treated with fluoranthene] results in decreased expression of S100A4 mRNA CTD PMID:28329830 S100a4 Rat folic acid affects expression ISO S100A4 (Homo sapiens) 6480464 Folic Acid affects the expression of S100A4 mRNA CTD PMID:16361273 S100a4 Rat folic acid increases expression ISO S100a4 (Mus musculus) 6480464 Folic Acid deficiency results in increased expression of S100A4 protein CTD PMID:21647593 S100a4 Rat folic acid multiple interactions ISO S100a4 (Mus musculus) 6480464 [Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of S100A4 mRNA more ... CTD PMID:20938992 more ... S100a4 Rat fonofos decreases methylation ISO S100A4 (Homo sapiens) 6480464 Fonofos results in decreased methylation of S100A4 promoter CTD PMID:22847954 S100a4 Rat formaldehyde increases expression ISO S100A4 (Homo sapiens) 6480464 Formaldehyde results in increased expression of S100A4 mRNA CTD PMID:23649840 S100a4 Rat furan increases expression EXP 6480464 furan results in increased expression of S100A4 mRNA CTD PMID:27387713 S100a4 Rat geldanamycin decreases expression ISO S100A4 (Homo sapiens) 6480464 geldanamycin results in decreased expression of S100A4 mRNA CTD PMID:26705709 S100a4 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of S100A4 mRNA CTD PMID:22061828 S100a4 Rat glycidol decreases expression EXP 6480464 glycidol results in decreased expression of S100A4 mRNA CTD PMID:24915197 S100a4 Rat glycidyl methacrylate decreases expression ISO S100A4 (Homo sapiens) 6480464 glycidyl methacrylate results in decreased expression of S100A4 protein CTD PMID:36641056 S100a4 Rat graphene oxide increases expression ISO S100a4 (Mus musculus) 6480464 graphene oxide results in increased expression of S100A4 mRNA CTD PMID:33227293 S100a4 Rat homocysteine multiple interactions ISO S100a4 (Mus musculus) 6480464 [Folic Acid deficiency results in increased abundance of Homocysteine] which results in increased expression of S100A4 mRNA more ... CTD PMID:21647593 S100a4 Rat homocysteine increases expression ISO S100a4 (Mus musculus) 6480464 Homocysteine results in increased expression of S100A4 mRNA and Homocysteine results in increased expression of S100A4 protein CTD PMID:21647593 S100a4 Rat hydrogen peroxide affects expression ISO S100A4 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of S100A4 mRNA CTD PMID:21179406 S100a4 Rat indole-3-methanol affects expression EXP 6480464 indole-3-carbinol affects the expression of S100A4 mRNA CTD PMID:21396975 S100a4 Rat iohexol increases expression ISO S100A4 (Homo sapiens) 6480464 Iohexol results in increased expression of S100A4 mRNA CTD PMID:29705293 S100a4 Rat iopamidol increases expression ISO S100A4 (Homo sapiens) 6480464 Iopamidol results in increased expression of S100A4 mRNA CTD PMID:29705293 S100a4 Rat isoprenaline increases expression EXP 6480464 Isoproterenol results in increased expression of S100A4 protein CTD PMID:10886724 S100a4 Rat isotretinoin increases expression ISO S100A4 (Homo sapiens) 6480464 Isotretinoin results in increased expression of S100A4 mRNA CTD PMID:20436886 S100a4 Rat ivermectin decreases expression ISO S100A4 (Homo sapiens) 6480464 Ivermectin results in decreased expression of S100A4 protein CTD PMID:32959892 S100a4 Rat ketamine increases expression EXP 6480464 Ketamine results in increased expression of S100A4 mRNA CTD PMID:20080153 S100a4 Rat ketamine increases expression ISO S100A4 (Homo sapiens) 6480464 Ketamine results in increased expression of S100A4 mRNA CTD PMID:28331066 S100a4 Rat L-1,4-dithiothreitol multiple interactions ISO S100A4 (Homo sapiens) 6480464 Dithiothreitol inhibits the reaction [Copper promotes the reaction [S100A4 protein binds to S100A4 protein]] CTD PMID:21924240 S100a4 Rat L-ascorbic acid multiple interactions ISO S100A4 (Homo sapiens) 6480464 Ascorbic Acid inhibits the reaction [Copper promotes the reaction [S100A4 protein binds to S100A4 protein]] CTD PMID:21924240 S100a4 Rat L-methionine multiple interactions ISO S100a4 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of S100A4 mRNA CTD PMID:20938992 S100a4 Rat lead diacetate decreases expression ISO S100A4 (Homo sapiens) 6480464 lead acetate results in decreased expression of S100A4 mRNA CTD PMID:38568856 S100a4 Rat lipopolysaccharide decreases expression ISO S100a4 (Mus musculus) 6480464 Lipopolysaccharides results in decreased expression of S100A4 mRNA CTD PMID:21461237 S100a4 Rat lithium atom decreases expression EXP 6480464 Lithium results in decreased expression of S100A4 protein CTD PMID:18296634 S100a4 Rat lithium hydride decreases expression EXP 6480464 Lithium results in decreased expression of S100A4 protein CTD PMID:18296634 S100a4 Rat losartan multiple interactions ISO S100A4 (Homo sapiens) 6480464 [Losartan co-treated with ICG 001] inhibits the reaction [AGT protein results in increased expression of S100A4 protein] and Losartan inhibits the reaction [AGT protein results in increased expression of S100A4 protein] CTD PMID:28578904 S100a4 Rat Malonoben multiple interactions ISO S100A4 (Homo sapiens) 6480464 tyrphostin A9 inhibits the reaction [S100A4 protein results in increased expression of MMP13 protein] more ... CTD PMID:16948116 S100a4 Rat mercury atom decreases expression ISO S100a4 (Mus musculus) 6480464 Mercury analog results in decreased expression of S100A4 mRNA CTD PMID:25056781 S100a4 Rat mercury(0) decreases expression ISO S100a4 (Mus musculus) 6480464 Mercury analog results in decreased expression of S100A4 mRNA CTD PMID:25056781 S100a4 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of S100A4 mRNA CTD PMID:30047161 S100a4 Rat methotrexate decreases response to substance ISO S100A4 (Homo sapiens) 6480464 S100A4 protein results in decreased susceptibility to Methotrexate CTD PMID:20515499 S100a4 Rat methyl carbamate increases expression ISO S100a4 (Mus musculus) 6480464 methyl carbamate results in increased expression of S100A4 mRNA CTD PMID:15612046 S100a4 Rat methyl methanesulfonate decreases expression ISO S100A4 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of S100A4 mRNA CTD PMID:23649840 S100a4 Rat methylmercury chloride decreases expression ISO S100A4 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of S100A4 mRNA CTD PMID:23179753 and PMID:28001369 S100a4 Rat methylparaben decreases expression ISO S100A4 (Homo sapiens) 6480464 methylparaben results in decreased expression of S100A4 mRNA CTD PMID:38568856 S100a4 Rat methylseleninic acid increases expression ISO S100A4 (Homo sapiens) 6480464 methylselenic acid results in increased expression of S100A4 mRNA CTD PMID:18548127 S100a4 Rat Miglitol decreases expression EXP 6480464 miglitol results in decreased expression of S100A4 CTD PMID:20667563 S100a4 Rat Miglitol decreases expression ISO S100A4 (Homo sapiens) 6480464 miglitol results in decreased expression of S100A4 mRNA CTD PMID:20667563 S100a4 Rat milrinone increases expression EXP 6480464 Milrinone results in increased expression of S100A4 mRNA CTD PMID:22936366 S100a4 Rat mitomycin C affects response to substance ISO S100A4 (Homo sapiens) 6480464 S100A4 protein affects the susceptibility to Mitomycin CTD PMID:16217747 S100a4 Rat N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine increases expression ISO S100A4 (Homo sapiens) 6480464 N more ... CTD PMID:19013360 S100a4 Rat N-acetyl-L-cysteine multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [Dietary Fats results in increased expression of S100A4 mRNA] CTD PMID:21051528 S100a4 Rat N-methyl-4-phenylpyridinium increases expression ISO S100A4 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of S100A4 mRNA CTD PMID:24810058 S100a4 Rat N-nitrosodiethylamine increases expression ISO S100A4 (Homo sapiens) 6480464 Diethylnitrosamine results in increased expression of S100A4 mRNA CTD PMID:21527772 S100a4 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Thioacetamide] results in increased expression of S100A4 mRNA CTD PMID:28943392 S100a4 Rat niclosamide decreases expression ISO S100a4 (Mus musculus) 6480464 Niclosamide results in decreased expression of S100A4 protein CTD PMID:34118929 S100a4 Rat niclosamide multiple interactions ISO S100A4 (Homo sapiens) 6480464 Niclosamide inhibits the reaction [Adenosine Triphosphate results in increased expression of S100A4 protein] and Niclosamide inhibits the reaction [MACC1 protein results in increased expression of S100A4 protein] CTD PMID:29733962 and PMID:36008464 S100a4 Rat niclosamide multiple interactions ISO S100a4 (Mus musculus) 6480464 Niclosamide inhibits the reaction [Adenosine Triphosphate results in increased expression of S100A4 protein] CTD PMID:29733962 S100a4 Rat niclosamide decreases expression ISO S100A4 (Homo sapiens) 6480464 Niclosamide results in decreased expression of S100A4 mRNA and Niclosamide results in decreased expression of S100A4 protein CTD PMID:21685359 more ... S100a4 Rat Nutlin-3 multiple interactions ISO S100A4 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of S100A4 protein CTD PMID:38460933 S100a4 Rat oxaliplatin increases expression ISO S100A4 (Homo sapiens) 6480464 oxaliplatin results in increased expression of S100A4 mRNA CTD PMID:16510598 S100a4 Rat ozone decreases expression ISO S100a4 (Mus musculus) 6480464 Ozone results in decreased expression of S100A4 mRNA CTD PMID:17095637 and PMID:33026818 S100a4 Rat ozone multiple interactions ISO S100a4 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of S100A4 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of S100A4 mRNA CTD PMID:34911549 S100a4 Rat ozone increases expression EXP 6480464 Ozone results in increased expression of S100A4 mRNA CTD PMID:16716893 S100a4 Rat Pachymic acid multiple interactions ISO S100A4 (Homo sapiens) 6480464 pachymic acid analog inhibits the reaction [AGT protein results in increased expression of S100A4 protein] CTD PMID:28578904 S100a4 Rat paclitaxel increases expression ISO S100A4 (Homo sapiens) 6480464 Paclitaxel results in increased expression of S100A4 mRNA CTD PMID:19682730 S100a4 Rat panobinostat multiple interactions ISO S100A4 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of S100A4 mRNA CTD PMID:27188386 S100a4 Rat panobinostat increases expression ISO S100A4 (Homo sapiens) 6480464 panobinostat results in increased expression of S100A4 mRNA CTD PMID:26272509 S100a4 Rat paracetamol affects expression ISO S100a4 (Mus musculus) 6480464 Acetaminophen affects the expression of S100A4 mRNA CTD PMID:17562736 S100a4 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of S100A4 mRNA CTD PMID:33387578 S100a4 Rat paracetamol decreases expression ISO S100A4 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of S100A4 mRNA CTD PMID:29067470 S100a4 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of S100A4 mRNA CTD PMID:30317802 S100a4 Rat paraquat increases expression ISO S100a4 (Mus musculus) 6480464 Paraquat results in increased expression of S100A4 mRNA and Paraquat results in increased expression of S100A4 protein CTD PMID:35817254 S100a4 Rat parathion decreases methylation ISO S100A4 (Homo sapiens) 6480464 Parathion results in decreased methylation of S100A4 promoter CTD PMID:22847954 S100a4 Rat pentetic acid multiple interactions ISO S100A4 (Homo sapiens) 6480464 Pentetic Acid inhibits the reaction [Copper promotes the reaction [S100A4 protein binds to S100A4 protein]] CTD PMID:21924240 S100a4 Rat perfluorohexanesulfonic acid increases expression ISO S100a4 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of S100A4 mRNA CTD PMID:37995155 S100a4 Rat perfluorononanoic acid decreases expression ISO S100A4 (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in decreased expression of S100A4 mRNA CTD PMID:38568856 S100a4 Rat perfluorooctanoic acid decreases expression ISO S100A4 (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of S100A4 mRNA CTD PMID:38568856 S100a4 Rat phenytoin increases expression ISO S100A4 (Homo sapiens) 6480464 Phenytoin results in increased expression of S100A4 mRNA CTD PMID:14741686 S100a4 Rat phorbol 13-acetate 12-myristate multiple interactions ISO S100A4 (Homo sapiens) 6480464 Atrazine inhibits the reaction [Tetradecanoylphorbol Acetate results in increased expression of S100A4 mRNA] CTD PMID:24211529 S100a4 Rat phorbol 13-acetate 12-myristate increases expression ISO S100A4 (Homo sapiens) 6480464 Tetradecanoylphorbol Acetate results in increased expression of S100A4 mRNA CTD PMID:24211529 S100a4 Rat picoxystrobin increases expression ISO S100A4 (Homo sapiens) 6480464 picoxystrobin results in increased expression of S100A4 mRNA CTD PMID:33512557 S100a4 Rat pirinixic acid multiple interactions ISO S100A4 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of S100A4 mRNA CTD PMID:19710929 S100a4 Rat pirinixic acid increases expression ISO S100a4 (Mus musculus) 6480464 pirinixic acid results in increased expression of S100A4 mRNA CTD PMID:23811191 S100a4 Rat pravastatin affects expression EXP 6480464 Pravastatin affects the expression of S100A4 mRNA CTD PMID:27225895 S100a4 Rat pravastatin increases expression ISO S100a4 (Mus musculus) 6480464 Pravastatin results in increased expression of S100A4 mRNA CTD PMID:27225895 S100a4 Rat pyrimidifen increases expression ISO S100A4 (Homo sapiens) 6480464 pyrimidifen results in increased expression of S100A4 mRNA CTD PMID:33512557 S100a4 Rat quercetin multiple interactions ISO S100A4 (Homo sapiens) 6480464 Quercetin inhibits the reaction [Copper promotes the reaction [S100A4 protein binds to S100A4 protein]] CTD PMID:21924240 S100a4 Rat resveratrol increases expression EXP 6480464 resveratrol results in increased expression of S100A4 mRNA CTD PMID:25905778 S100a4 Rat resveratrol decreases expression ISO S100A4 (Homo sapiens) 6480464 resveratrol results in decreased expression of S100A4 mRNA and resveratrol results in decreased expression of S100A4 protein CTD PMID:26934322 S100a4 Rat rotenone increases expression ISO S100a4 (Mus musculus) 6480464 Rotenone results in increased expression of S100A4 mRNA CTD PMID:23186747 S100a4 Rat SB 203580 multiple interactions ISO S100A4 (Homo sapiens) 6480464 SB 203580 inhibits the reaction [S100A4 protein results in increased expression of MMP13 protein] CTD PMID:16948116 S100a4 Rat SB 431542 multiple interactions ISO S100A4 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 S100a4 Rat scopolamine decreases expression EXP 6480464 Scopolamine results in decreased expression of S100A4 mRNA CTD PMID:17540011 S100a4 Rat senecionine increases expression ISO S100a4 (Mus musculus) 6480464 senecionine results in increased expression of S100A4 protein CTD PMID:35357534 S100a4 Rat silicon dioxide increases expression ISO S100a4 (Mus musculus) 6480464 Silicon Dioxide results in increased expression of S100A4 mRNA CTD PMID:23221170 S100a4 Rat silicon dioxide multiple interactions ISO S100a4 (Mus musculus) 6480464 [SOD3 gene mutant form results in increased susceptibility to Silicon Dioxide] which results in increased expression of S100A4 mRNA CTD PMID:30453980 S100a4 Rat silver atom increases expression ISO S100A4 (Homo sapiens) 6480464 Silver results in increased expression of S100A4 mRNA CTD PMID:26014281 S100a4 Rat silver(0) increases expression ISO S100A4 (Homo sapiens) 6480464 Silver results in increased expression of S100A4 mRNA CTD PMID:26014281 S100a4 Rat sirolimus decreases expression EXP 6480464 Sirolimus results in decreased expression of S100A4 mRNA CTD PMID:21865292 S100a4 Rat sodium arsenite decreases expression ISO S100a4 (Mus musculus) 6480464 sodium arsenite results in decreased expression of S100A4 mRNA CTD PMID:30562058 and PMID:37682722 S100a4 Rat sodium arsenite increases expression ISO S100A4 (Homo sapiens) 6480464 sodium arsenite results in increased expression of S100A4 protein CTD PMID:35750204 S100a4 Rat sodium arsenite decreases expression ISO S100A4 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of S100A4 mRNA CTD PMID:38568856 S100a4 Rat sodium tungstate increases expression ISO S100A4 (Homo sapiens) 6480464 sodium tungstate(VI) results in increased expression of S100A4 mRNA CTD PMID:26164860 S100a4 Rat sulforaphane decreases expression ISO S100A4 (Homo sapiens) 6480464 sulforaphane results in decreased expression of S100A4 mRNA CTD PMID:31838189 S100a4 Rat sunitinib decreases expression ISO S100A4 (Homo sapiens) 6480464 Sunitinib results in decreased expression of S100A4 mRNA CTD PMID:31533062 S100a4 Rat tamibarotene decreases expression ISO S100A4 (Homo sapiens) 6480464 tamibarotene results in decreased expression of S100A4 mRNA CTD PMID:17229644 S100a4 Rat tamibarotene increases expression ISO S100A4 (Homo sapiens) 6480464 tamibarotene results in increased expression of S100A4 mRNA CTD PMID:15498508 S100a4 Rat tebufenpyrad increases expression ISO S100A4 (Homo sapiens) 6480464 4-chloro-N-((4-(1 and 1-dimethylethyl)phenyl)methyl)-3-ethyl-1-methyl-1H-pyrazole-5-carboxamide results in increased expression of S100A4 mRNA CTD PMID:33512557 S100a4 Rat temozolomide increases expression ISO S100A4 (Homo sapiens) 6480464 Temozolomide results in increased expression of S100A4 mRNA CTD PMID:31758290 S100a4 Rat terbufos decreases methylation ISO S100A4 (Homo sapiens) 6480464 terbufos results in decreased methylation of S100A4 promoter CTD PMID:22847954 S100a4 Rat tert-butyl hydroperoxide decreases expression ISO S100A4 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of S100A4 mRNA CTD PMID:15336504 S100a4 Rat testosterone multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of S100A4 mRNA CTD PMID:32741896 S100a4 Rat tetrachloromethane affects expression ISO S100a4 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of S100A4 mRNA CTD PMID:17484886 S100a4 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of S100A4 mRNA CTD PMID:33387578 S100a4 Rat tetrachloromethane increases expression ISO S100a4 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of S100A4 mRNA and Carbon Tetrachloride results in increased expression of S100A4 protein CTD PMID:16818635 more ... S100a4 Rat thapsigargin decreases expression ISO S100A4 (Homo sapiens) 6480464 Thapsigargin results in decreased expression of S100A4 mRNA CTD PMID:22378314 S100a4 Rat thioacetamide multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Thioacetamide] results in increased expression of S100A4 mRNA CTD PMID:28943392 S100a4 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of S100A4 mRNA CTD PMID:34492290 S100a4 Rat thiram decreases expression ISO S100A4 (Homo sapiens) 6480464 Thiram results in decreased expression of S100A4 mRNA CTD PMID:38568856 S100a4 Rat titanium dioxide increases expression ISO S100a4 (Mus musculus) 6480464 titanium dioxide results in increased expression of S100A4 mRNA CTD PMID:23557971 and PMID:27760801 S100a4 Rat titanium dioxide decreases expression ISO S100a4 (Mus musculus) 6480464 titanium dioxide analog results in decreased expression of S100A4 mRNA CTD PMID:25111187 S100a4 Rat toluene decreases expression EXP 6480464 Toluene results in decreased expression of S100A4 mRNA CTD PMID:22967744 S100a4 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of S100A4 mRNA CTD PMID:33387578 S100a4 Rat trichostatin A increases expression ISO S100A4 (Homo sapiens) 6480464 trichostatin A results in increased expression of S100A4 mRNA CTD PMID:24935251 S100a4 Rat triphenyl phosphate affects expression ISO S100A4 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of S100A4 mRNA CTD PMID:37042841 S100a4 Rat Triptolide increases expression EXP 6480464 triptolide results in increased expression of S100A4 protein CTD PMID:32519852 S100a4 Rat tunicamycin decreases expression ISO S100A4 (Homo sapiens) 6480464 Tunicamycin results in decreased expression of S100A4 mRNA CTD PMID:22378314 S100a4 Rat valproic acid affects expression ISO S100A4 (Homo sapiens) 6480464 Valproic Acid affects the expression of S100A4 mRNA CTD PMID:25979313 S100a4 Rat valproic acid multiple interactions ISO S100A4 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of S100A4 mRNA CTD PMID:27188386 S100a4 Rat valproic acid increases expression ISO S100A4 (Homo sapiens) 6480464 Valproic Acid results in increased expression of S100A4 mRNA CTD PMID:23179753 more ... S100a4 Rat valproic acid increases methylation ISO S100A4 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of S100A4 gene CTD PMID:29154799 S100a4 Rat vancomycin decreases expression ISO S100a4 (Mus musculus) 6480464 Vancomycin results in decreased expression of S100A4 mRNA CTD PMID:18930951 S100a4 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of S100A4 mRNA CTD PMID:19015723 S100a4 Rat vincristine increases expression ISO S100A4 (Homo sapiens) 6480464 Vincristine results in increased expression of S100A4 mRNA CTD PMID:23649840 S100a4 Rat vorinostat increases expression ISO S100A4 (Homo sapiens) 6480464 vorinostat results in increased expression of S100A4 mRNA CTD PMID:27188386 S100a4 Rat xanthohumol decreases expression ISO S100A4 (Homo sapiens) 6480464 xanthohumol results in decreased expression of S100A4 protein CTD PMID:23503627 S100a4 Rat zaragozic acid A affects expression ISO S100a4 (Mus musculus) 6480464 squalestatin 1 affects the expression of S100A4 mRNA CTD PMID:27225895 S100a4 Rat zaragozic acid A decreases expression EXP 6480464 squalestatin 1 results in decreased expression of S100A4 mRNA CTD PMID:27225895
(-)-demecolcine (ISO) 1,2-dichloroethane (ISO) 1,3,5-trinitro-1,3,5-triazinane (EXP) 1,4-dithiothreitol (ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP,ISO) 17beta-estradiol 3-benzoate (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2-nitrotoluene (ISO) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (ISO) 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one (ISO) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) acetylsalicylic acid (ISO) acrolein (ISO) actinomycin D (ISO) aflatoxin B1 (EXP) all-trans-retinoic acid (EXP,ISO) amitrole (EXP) ammonium chloride (EXP) amphetamine (EXP) andrographolide (EXP) anthra[1,9-cd]pyrazol-6(2H)-one (ISO) antimycin A (ISO) apocynin (ISO) aristolochic acid A (ISO) arsenous acid (ISO) ATP (ISO) atrazine (ISO) azoxystrobin (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) benzo[b]fluoranthene (ISO) beta-lapachone (ISO) beta-naphthoflavone (ISO) bilirubin IXalpha (ISO) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) bisphenol F (ISO) bleomycin A2 (EXP) calcitriol (ISO) capsaicin (ISO) carbon nanotube (ISO) celastrol (ISO) chloroprene (ISO) choline (ISO) cisplatin (ISO) cobalt dichloride (ISO) copper atom (EXP,ISO) copper(0) (EXP,ISO) copper(II) chloride (ISO) copper(II) sulfate (ISO) cycloheximide (ISO) cyclosporin A (EXP,ISO) cytarabine (ISO) D-penicillamine (EXP) DDE (ISO) deoxynivalenol (ISO) dexamethasone (ISO) dextran sulfate (ISO) diarsenic trioxide (ISO) Diosbulbin B (ISO) dioxygen (ISO) diuron (EXP,ISO) dopamine (EXP) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (ISO) entinostat (ISO) epoxiconazole (ISO) ethanol (ISO) ethylenediaminetetraacetic acid (ISO) ethylparaben (ISO) Evodiamine (ISO) fenoldopam (EXP) fenpyroximate (ISO) fluoranthene (ISO) folic acid (ISO) fonofos (ISO) formaldehyde (ISO) furan (EXP) geldanamycin (ISO) gentamycin (EXP) glycidol (EXP) glycidyl methacrylate (ISO) graphene oxide (ISO) homocysteine (ISO) hydrogen peroxide (ISO) indole-3-methanol (EXP) iohexol (ISO) iopamidol (ISO) isoprenaline (EXP) isotretinoin (ISO) ivermectin (ISO) ketamine (EXP,ISO) L-1,4-dithiothreitol (ISO) L-ascorbic acid (ISO) L-methionine (ISO) lead diacetate (ISO) lipopolysaccharide (ISO) lithium atom (EXP) lithium hydride (EXP) losartan (ISO) Malonoben (ISO) mercury atom (ISO) mercury(0) (ISO) methimazole (EXP) methotrexate (ISO) methyl carbamate (ISO) methyl methanesulfonate (ISO) methylmercury chloride (ISO) methylparaben (ISO) methylseleninic acid (ISO) Miglitol (EXP,ISO) milrinone (EXP) mitomycin C (ISO) N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine (ISO) N-acetyl-L-cysteine (EXP) N-methyl-4-phenylpyridinium (ISO) N-nitrosodiethylamine (EXP,ISO) niclosamide (ISO) Nutlin-3 (ISO) oxaliplatin (ISO) ozone (EXP,ISO) Pachymic acid (ISO) paclitaxel (ISO) panobinostat (ISO) paracetamol (EXP,ISO) paraquat (EXP,ISO) parathion (ISO) pentetic acid (ISO) perfluorohexanesulfonic acid (ISO) perfluorononanoic acid (ISO) perfluorooctanoic acid (ISO) phenytoin (ISO) phorbol 13-acetate 12-myristate (ISO) picoxystrobin (ISO) pirinixic acid (ISO) pravastatin (EXP,ISO) pyrimidifen (ISO) quercetin (ISO) resveratrol (EXP,ISO) rotenone (ISO) SB 203580 (ISO) SB 431542 (ISO) scopolamine (EXP) senecionine (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) sirolimus (EXP) sodium arsenite (ISO) sodium tungstate (ISO) sulforaphane (ISO) sunitinib (ISO) tamibarotene (ISO) tebufenpyrad (ISO) temozolomide (ISO) terbufos (ISO) tert-butyl hydroperoxide (ISO) testosterone (EXP) tetrachloromethane (EXP,ISO) thapsigargin (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) toluene (EXP) trichloroethene (EXP) trichostatin A (ISO) triphenyl phosphate (ISO) Triptolide (EXP) tunicamycin (ISO) valproic acid (ISO) vancomycin (ISO) vinclozolin (EXP) vincristine (ISO) vorinostat (ISO) xanthohumol (ISO) zaragozic acid A (EXP,ISO)
Molecular Function
actin binding (IDA) calcium ion binding (IBA,IDA,IEA,ISO,TAS) calcium-dependent protein binding (IBA,IDA,IMP) chemoattractant activity (IEA,ISO) identical protein binding (IEA,ISO) metal ion binding (IEA) protein binding (IPI,ISO) protein-containing complex binding (TAS) RAGE receptor binding (IBA,IEA,ISO) transition metal ion binding (IEA)
1.
Calcium-ion binding by the potential calcium-ion-binding protein, p9Ka.
Barraclough R, etal., Biochem Biophys Res Commun. 1990 Jun 15;169(2):660-6.
2.
Molecular cloning and sequence of the gene for p9Ka. A cultured myoepithelial cell protein with strong homology to S-100, a calcium-binding protein.
Barraclough R, etal., J Mol Biol 1987 Nov 5;198(1):13-20.
3.
Transformation of normal rat kidney cells by v-K-ras enhances expression of transin 2 and an S-100-related calcium-binding protein.
De Vouge MW and Mukherjee BB, Oncogene 1992 Jan;7(1):109-19.
4.
Protein interactions between S100A4 (p9Ka) and other cellular proteins identified using in vitro methods.
Flynn AM, etal., Biochem Soc Trans. 1996 Aug;24(3):341S.
5.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.
High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.
Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
7.
Gene expression profile of rat adipose tissue at the onset of high-fat-diet obesity.
Li J, etal., Am J Physiol Endocrinol Metab 2002 Jun;282(6):E1334-41.
8.
Nerve growth factor induces the genes for two proteins related to a family of calcium-binding proteins in PC12 cells.
Masiakowski P and Shooter EM, Proc Natl Acad Sci U S A 1988 Feb;85(4):1277-81.
9.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
10.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
11.
An integrated rat genetic map: analysis of linkage conservation with the mouse and human maps.
Remmers EF, etal., Transplant Proc 1999 May;31(3):1549-54.
12.
GOA pipeline
RGD automated data pipeline
13.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
14.
Metastasis-associated S100A4 (Mts1) protein is expressed in subpopulations of sensory and autonomic neurons and in Schwann cells of the adult rat.
Sandelin M, etal., J Comp Neurol 2004 May 24;473(2):233-43.
15.
Calcium, troponin, calmodulin, S100 proteins: from myocardial basics to new therapeutic strategies.
Schaub MC and Heizmann CW, Biochem Biophys Res Commun. 2008 Apr 25;369(1):247-64. Epub 2007 Oct 25.
16.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
17.
The C-terminal region of S100A4 is important for its metastasis-inducing properties.
Zhang S, etal., Oncogene 2005 Jun 23;24(27):4401-11.
S100a4 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 178,388,529 - 178,390,838 (+) NCBI GRCr8 mRatBN7.2 2 176,090,951 - 176,093,258 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 176,091,804 - 176,093,254 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 183,231,137 - 183,233,459 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 181,253,405 - 181,255,727 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 175,853,265 - 175,855,593 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 189,997,278 - 189,999,587 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 189,997,129 - 189,999,604 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 209,431,373 - 209,433,680 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 182,885,070 - 182,887,380 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 182,835,175 - 182,837,486 (+) NCBI Celera 2 170,025,678 - 170,027,982 (+) NCBI Celera RH 3.4 Map 2 1164.6 RGD Cytogenetic Map 2 q34 NCBI
S100A4 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 153,543,621 - 153,545,806 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 153,543,613 - 153,550,136 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 153,516,097 - 153,518,282 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 151,782,719 - 151,784,906 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 150,329,170 - 150,331,355 NCBI Celera 1 126,587,355 - 126,589,542 (-) NCBI Celera Cytogenetic Map 1 q21.3 NCBI HuRef 1 124,879,355 - 124,881,542 (-) NCBI HuRef CHM1_1 1 154,912,044 - 154,914,231 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 152,680,877 - 152,683,062 (-) NCBI T2T-CHM13v2.0
S100a4 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 90,511,077 - 90,513,349 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 90,511,078 - 90,513,352 (+) Ensembl GRCm39 Ensembl GRCm38 3 90,603,770 - 90,606,045 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 90,603,771 - 90,606,045 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 90,407,692 - 90,409,967 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 90,689,697 - 90,691,968 (+) NCBI MGSCv36 mm8 Celera 3 90,645,174 - 90,647,449 (+) NCBI Celera Cytogenetic Map 3 F1 NCBI cM Map 3 39.27 NCBI
S100a4 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955545 192,116 - 195,394 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955545 192,236 - 194,468 (-) NCBI ChiLan1.0 ChiLan1.0
S100A4 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 96,288,008 - 96,290,345 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 96,023,251 - 96,025,528 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 128,898,765 - 128,901,042 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 132,527,846 - 132,530,125 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 132,527,846 - 132,530,122 (-) Ensembl panpan1.1 panPan2
S100A4 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 7 43,494,007 - 43,496,021 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 7 42,986,972 - 42,988,993 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 7 43,443,738 - 43,445,759 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 7 43,440,733 - 43,445,796 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 7 43,146,014 - 43,148,039 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 7 43,199,907 - 43,201,928 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 7 43,483,524 - 43,485,545 (+) NCBI UU_Cfam_GSD_1.0
S100a4 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 24,325,369 - 24,327,658 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936580 3,355,699 - 3,358,242 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936580 3,355,751 - 3,358,030 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
S100A4 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 96,088,201 - 96,091,156 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 96,088,102 - 96,091,160 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 104,908,141 - 104,911,151 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
S100A4 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 10,258,142 - 10,260,390 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 10,258,070 - 10,260,871 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 9,649,628 - 9,651,911 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
S100a4
.
Predicted Target Of
Count of predictions: 38 Count of miRNA genes: 38 Interacting mature miRNAs: 38 Transcripts: ENSRNOT00000015958 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1578648 Bss11 Bone structure and strength QTL 11 4.7 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 2 114837527 211674221 Rat 1358356 Srcrt1 Stress Responsive Cort QTL1 3.66 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 2 161699179 222436696 Rat 1331734 Bp204 Blood pressure QTL 204 3.61192 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 168358098 223265385 Rat 1298074 Bp164 Blood pressure QTL 164 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 1354648 Bp239 Blood pressure QTL 239 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118463 226797303 Rat 1354649 Kidm17 Kidney mass QTL 17 2.9 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 2 81754530 227146641 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 1298076 Bp166 Blood pressure QTL 166 0.0009 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 136445150 202447032 Rat 152025245 Scl81 Serum cholesterol level QTL 81 3.49 blood cholesterol amount (VT:0000180) 2 122609194 206936711 Rat 70162 Bp63 Blood pressure QTL 63 5.64 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 2 169745596 214745596 Rat 1554319 Bmd2 Bone mineral density QTL 2 13.4 0.0001 lumbar vertebra area (VT:0010570) lumbar vertebra cross-sectional area (CMO:0001689) 2 114837675 212549332 Rat 12879836 Kidm61 Kidney mass QTL 61 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 152413072 185122374 Rat 1581569 Uae32 Urinary albumin excretion QTL 32 0.0001 urine protein amount (VT:0005160) urine albumin excretion rate (CMO:0000757) 2 78665619 219826953 Rat 10043136 Iddm54 Insulin dependent diabetes mellitus QTL 54 3.4 0.0001 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 2 143657411 190602963 Rat 12879837 Am2 Aortic mass QTL 2 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 2 152413072 185122374 Rat 12879838 Cm86 Cardiac mass QTL 86 0.002 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 2 152413072 185122374 Rat 1302793 Bw16 Body weight QTL 16 5 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 2 157142209 202446871 Rat 61467 Bp14 Blood pressure QTL 14 2.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 43154682 202446871 Rat 12879839 Cm85 Cardiac mass QTL 85 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 2 152413072 185122374 Rat 61469 Bp16 Blood pressure QTL 16 5.64 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 2 169745596 214745596 Rat 70175 BpQTLCluster3 Blood pressure QTL cluster 3 4.128 arterial blood pressure trait (VT:2000000) absolute change in systolic blood pressure (CMO:0000607) 2 135552573 202446871 Rat 1549833 Bp257 Blood pressure QTL 257 0.003 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 168354880 185122374 Rat 1358900 Bw48 Body weight QTL 48 4.88 body mass (VT:0001259) body weight (CMO:0000012) 2 157142078 211086598 Rat 1359030 Bp277 Blood pressure QTL 277 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 114837527 185876470 Rat 1331760 Bp206 Blood pressure QTL 206 3.62454 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 56043031 202447032 Rat 12879840 Bw179 Body weight QTL 179 0.005 body mass (VT:0001259) body weight (CMO:0000012) 2 152413072 185122374 Rat 1581502 Esta3 Estrogen-induced thymic atrophy QTL 3 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 2 136916935 189599348 Rat 1359032 Hrtrt18 Heart rate QTL 18 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 2 157142078 192625452 Rat 2301966 Bp322 Blood pressure QTL 322 3.58 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 150540301 202447032 Rat 1298080 Bp163 Blood pressure QTL 163 0.02 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118275 202447032 Rat 8662832 Vetf7 Vascular elastic tissue fragility QTL 7 3.5 aorta elastin amount (VT:0003905) aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002) 2 81689826 221035911 Rat 1298085 Bp165 Blood pressure QTL 165 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 1359022 Ppulsi1 Prepulse inhibition QTL 1 3.63 prepulse inhibition trait (VT:0003088) acoustic startle response measurement (CMO:0001519) 2 136916935 213594495 Rat 1641891 Alcrsp17 Alcohol response QTL 17 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 249053267 Rat 724534 Uae6 Urinary albumin excretion QTL 6 10 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 2 78665619 249053267 Rat 61374 Edpm2 Estrogen-dependent pituitary mass QTL 2 4.42 0.86 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 2 76539322 202447032 Rat 8662843 Vetf9 Vascular elastic tissue fragility QTL 9 2.05 thoracic aorta molecular composition trait (VT:0010568) aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003) 2 157142078 226277316 Rat 631501 Bp101 Blood pressure QTL 101 2.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 150341684 202446871 Rat 2307174 Activ3 Activity QTL 3 4.83 0.000058 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 2 168594495 213594495 Rat 1331794 Bp202 Blood pressure QTL 202 3.66819 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 141194931 223265385 Rat 71113 Cari2 Carrageenan-induced inflammation QTL 2 2.7 0.009 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 2 141596551 202447032 Rat 1331805 Cm29 Cardiac mass QTL 29 3.50746 heart mass (VT:0007028) heart wet weight (CMO:0000069) 2 141194931 223265385 Rat 634308 Sach6 Saccharin preference QTL 6 4.9 taste sensitivity trait (VT:0001986) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 2 112456140 212696837 Rat 1598805 Memor8 Memory QTL 8 3 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 2 150341585 189039377 Rat 1358917 Cm42 Cardiac mass QTL 42 2.82 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 724568 Uae13 Urinary albumin excretion QTL 13 4.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 2 143157029 210020885 Rat 1358913 Cm41 Cardiac mass QTL 41 2.73 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 1300165 Rf9 Renal function QTL 9 3.28 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 2 133914684 202447032 Rat 61401 Niddm2 Non-insulin dependent diabetes mellitus QTL 2 4.54 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 144599348 189599348 Rat 631507 Bp105 Blood pressure QTL 105 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 112456140 212696837 Rat 1641925 Alcrsp2 Alcohol response QTL 2 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 221167075 Rat 1354609 Niddm62 Non-insulin dependent diabetes mellitus QTL 62 4.72 0.000006 insulin secretion trait (VT:0003564) plasma insulin level (CMO:0000342) 2 150540301 202447032 Rat 1598833 Bp295 Blood pressure QTL 295 3.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 147798556 192798556 Rat 1354622 Kidm16 Kidney mass QTL 16 3 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 2 81754530 222436696 Rat 631266 Bp132 Blood pressure QTL 132 0.0005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 46123260 202447032 Rat 631522 Bp74 Blood pressure QTL 74 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 172710921 184114403 Rat 7488927 Bp365 Blood pressure QTL 365 0.008 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 162765032 207765032 Rat 1598838 Bp290 Blood pressure QTL 290 1.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 166539266 211539266 Rat 7488925 Bp364 Blood pressure QTL 364 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 160564068 205564068 Rat 2293843 Kiddil6 Kidney dilation QTL 6 3.1 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 42804607 182042367 Rat 2306901 Bp337 Blood pressure QTL 337 0.01 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 164073756 227146641 Rat 1354605 Rf48 Renal function QTL 48 2.9 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 2 74786664 206665859 Rat 6903312 Bw112 Body weight QTL 112 3.2 0.0013 body mass (VT:0001259) body weight (CMO:0000012) 2 143657569 184114274 Rat 1354601 Slep1 Serum leptin concentration QTL 1 5.39 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 2 43171017 184114403 Rat 2293084 Iddm26 Insulin dependent diabetes mellitus QTL 26 2.9 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 174930955 213594495 Rat
D2Mit13
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 2 178,389,917 - 178,390,126 (+) Marker Load Pipeline mRatBN7.2 2 176,092,339 - 176,092,546 (+) MAPPER mRatBN7.2 mRatBN7.2 1 56,794,419 - 56,794,475 (+) MAPPER mRatBN7.2 Rnor_6.0 2 189,998,667 - 189,998,875 NCBI Rnor6.0 Rnor_5.0 2 209,432,762 - 209,432,968 UniSTS Rnor5.0 RGSC_v3.4 2 182,886,459 - 182,886,669 UniSTS RGSC3.4 RGSC_v3.4 2 182,886,458 - 182,886,669 RGD RGSC3.4 RGSC_v3.1 2 182,836,564 - 182,836,775 RGD Celera 2 170,027,065 - 170,027,271 UniSTS SHRSP x BN Map 2 70.0198 UniSTS SHRSP x BN Map 2 70.0198 RGD Cytogenetic Map 2 q34 UniSTS
D2Wox23
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 2 178,388,670 - 178,388,765 (+) Marker Load Pipeline mRatBN7.2 2 176,091,092 - 176,091,187 (+) MAPPER mRatBN7.2 Rnor_6.0 2 189,997,420 - 189,997,514 NCBI Rnor6.0 Rnor_5.0 2 209,431,515 - 209,431,609 UniSTS Rnor5.0 RGSC_v3.4 2 182,885,212 - 182,885,306 UniSTS RGSC3.4 RGSC_v3.1 2 182,835,317 - 182,835,412 RGD Celera 2 170,025,820 - 170,025,912 UniSTS Cytogenetic Map 2 q34 UniSTS
D2Arb37
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 2 178,389,891 - 178,390,171 (+) Marker Load Pipeline mRatBN7.2 2 176,092,313 - 176,092,591 (+) MAPPER mRatBN7.2 Rnor_6.0 2 189,998,641 - 189,998,920 NCBI Rnor6.0 Rnor_5.0 2 209,432,736 - 209,433,013 UniSTS Rnor5.0 RGSC_v3.4 2 182,886,432 - 182,886,714 RGD RGSC3.4 RGSC_v3.4 2 182,886,433 - 182,886,714 UniSTS RGSC3.4 RGSC_v3.1 2 182,836,538 - 182,836,820 RGD Celera 2 170,027,039 - 170,027,316 UniSTS SHRSP x BN Map 2 70.0198 RGD SHRSP x BN Map 2 70.0198 UniSTS Cytogenetic Map 2 q34 UniSTS
RH132651
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 176,089,314 - 176,089,508 (+) MAPPER mRatBN7.2 Rnor_6.0 2 189,995,642 - 189,995,835 NCBI Rnor6.0 Rnor_5.0 2 209,429,737 - 209,429,930 UniSTS Rnor5.0 RGSC_v3.4 2 182,883,434 - 182,883,627 UniSTS RGSC3.4 Celera 2 170,024,042 - 170,024,235 UniSTS RH 3.4 Map 2 1165.4 UniSTS Cytogenetic Map 2 q34 UniSTS
RH94503
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 176,093,136 - 176,093,239 (+) MAPPER mRatBN7.2 Rnor_6.0 2 189,999,466 - 189,999,568 NCBI Rnor6.0 Rnor_5.0 2 209,433,559 - 209,433,661 UniSTS Rnor5.0 RGSC_v3.4 2 182,887,260 - 182,887,362 UniSTS RGSC3.4 Celera 2 170,027,862 - 170,027,964 UniSTS RH 3.4 Map 2 1164.6 UniSTS Cytogenetic Map 2 q34 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
109
91
90
59
25
59
6
218
97
89
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000015958 ⟹ ENSRNOP00000015958
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 176,091,804 - 176,093,254 (+) Ensembl Rnor_6.0 Ensembl 2 189,997,129 - 189,999,604 (+) Ensembl
RefSeq Acc Id:
NM_012618 ⟹ NP_036750
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 178,388,529 - 178,390,837 (+) NCBI mRatBN7.2 2 176,090,951 - 176,093,257 (+) NCBI Rnor_6.0 2 189,997,278 - 189,999,586 (+) NCBI Rnor_5.0 2 209,431,373 - 209,433,680 (+) NCBI RGSC_v3.4 2 182,885,070 - 182,887,380 (+) RGD Celera 2 170,025,678 - 170,027,982 (+) RGD
Sequence:
AAACCTCTCTGTTCAGCACTTCCTCTCTCTTGGTCTGGTCTCAACGGTCACCATGGCGAGACCCTTGGAGGAGGCCCTGGATGTAATAGTGTCCACCTTCCACAAATACTCAGGCAACGAGGGTGACA
hide sequence
RefSeq Acc Id:
XM_006232592 ⟹ XP_006232654
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 178,389,362 - 178,390,838 (+) NCBI mRatBN7.2 2 176,091,780 - 176,093,258 (+) NCBI Rnor_6.0 2 189,998,123 - 189,999,587 (+) NCBI Rnor_5.0 2 209,431,373 - 209,433,680 (+) NCBI
Sequence:
GAGTTGGGGAGTGAGTAAGCTGAGTGAGGGATGGAAAACTGCTGTTGTTGAGGCCAGGCCTGGGGGGGAGGCACAGAAGGCTGCTGGCATGAATTTCTAGAGTTTGAGTGGTCTCAACGGTCACCATG
hide sequence
RefSeq Acc Id:
NP_036750 ⟸ NM_012618
- UniProtKB:
P05942 (UniProtKB/Swiss-Prot), A6J6P7 (UniProtKB/TrEMBL)
- Sequence:
MARPLEEALDVIVSTFHKYSGNEGDKFKLNKTELKELLTRELPSFLGRRTDEAAFQKLMNNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGCPDKEPRKK
hide sequence
RefSeq Acc Id:
XP_006232654 ⟸ XM_006232592
- Peptide Label:
isoform X1
- UniProtKB:
P05942 (UniProtKB/Swiss-Prot), A6J6P7 (UniProtKB/TrEMBL)
- Sequence:
MARPLEEALDVIVSTFHKYSGNEGDKFKLNKTELKELLTRELPSFLGRRTDEAAFQKLMNNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGCPDKEPRKK
hide sequence
Ensembl Acc Id:
ENSRNOP00000015958 ⟸ ENSRNOT00000015958
RGD ID: 13691508 Promoter ID: EPDNEW_R2033 Type: single initiation site Name: S100a4_1 Description: S100 calcium-binding protein A4 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 2 189,997,278 - 189,997,338 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-06-10
S100a4
S100 calcium-binding protein A4
Symbol and Name status set to approved
70586 APPROVED
2001-04-19
P9ka
Protein 9 Ka homologous to calcium-binding protein
Symbol and name withdrawn
61478 WITHDRAWN
2001-04-19
S100a4
S100 calcium-binding protein A4
Symbol and name updated to reflect Human and Mouse nomenclature
61478 APPROVED
Note Type
Note
Reference
gene_disease
has metastasis-inducing capabilities
gene_process
involved in the regulation of cell cycle progression, modulating intercellular adhesion, and invasive and metastatic properties of cancer cells
gene_regulation
expression increases at the onset of high-fat-diet obesity
625747
gene_regulation
expression is induced by nerve growth factor (NGF)
729699
