Symbol:
Npy
Name:
neuropeptide Y
RGD ID:
3197
Description:
Enables neuropeptide Y receptor binding activity. Involved in several processes, including adult feeding behavior; positive regulation of ERK1 and ERK2 cascade; and positive regulation of metabolic process. Located in several cellular components, including perikaryon; perinuclear region of cytoplasm; and terminal bouton. Is active in neuronal dense core vesicle. Used to study absence epilepsy; alcohol use disorder; depressive disorder; and hypertension. Biomarker of several diseases, including cerebral infarction; median neuropathy; neurodegenerative disease (multiple); obesity; and status epilepticus. Human ortholog(s) of this gene implicated in several diseases, including Huntington's disease; alcohol dependence; alcohol use disorder; artery disease (multiple); and epilepsy (multiple). Orthologous to human NPY (neuropeptide Y); PARTICIPATES IN neuropeptide Y metabolic pathway; INTERACTS WITH (+)-pilocarpine; (S)-amphetamine; (S)-nicotine.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
LOC100912228; NPY02; pro-neuropeptide Y; pro-neuropeptide Y-like; RATNPY; RATNPY02
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
NPY (neuropeptide Y) HGNC
Ensembl, HomoloGene, Inparanoid, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Npy (neuropeptide Y) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Npy (neuropeptide Y) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
NPY (neuropeptide Y) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
NPY (neuropeptide Y) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Npy (neuropeptide Y) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
NPY (neuropeptide Y) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
NPY (neuropeptide Y) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Npy (neuropeptide Y) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Npy (neuropeptide Y)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
NPY (neuropeptide Y)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
npy (neuropeptide Y)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
npy
Alliance
DIOPT (OMA|OrthoFinder|PANTHER)
Allele / Splice:
Npyem6Sage
Genetic Models:
iNP-Npyem6Sage /Iusm
iNP-Npyem6Sage-/- /Iusm
iNP-Npyem6Sage+/- /Iusm
Is Marker For:
Strains:
SHR.BN-(Il6-Npy )
iP/Iusm
iNP/Iusm
BB.SHR-(D4Mit6-Spr )/K
NP.P-(D4Rat119-D4Rat55 )/Iusm QTLs:
Bp21
Bp135
Candidate Gene For:
Eau1 Scwia1 Aia3 Alc18 Bp79 Sach4 Alc16 Alc14 Bw40 Alc21 Alc22 Bp330 Bw126
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 80,212,111 - 80,219,310 (+) NCBI GRCr8 mRatBN7.2 4 78,881,294 - 78,888,495 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 78,881,264 - 78,888,495 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 84,098,422 - 84,105,619 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 79,873,911 - 79,881,112 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 78,314,242 - 78,321,437 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 79,557,856 - 79,565,059 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 79,573,998 - 79,581,208 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 79,557,854 - 79,565,097 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 144,233,753 - 144,240,956 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 78,038,013 - 78,045,187 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 78,314,142 - 78,321,317 (+) NCBI Celera 4 73,795,148 - 73,802,371 (+) NCBI Celera RH 3.4 Map 4 508.6 RGD RH 3.4 Map 4 507.8 RGD Cytogenetic Map 4 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Npy Rat (+)-pilocarpine decreases response to substance ISO Npy (Mus musculus) 6480464 NPY protein results in decreased susceptibility to Pilocarpine CTD PMID:15451008 Npy Rat (+)-pilocarpine increases expression EXP 6480464 Pilocarpine results in increased expression of NPY protein CTD PMID:12231234 Npy Rat (+)-pilocarpine increases expression ISO Npy (Mus musculus) 6480464 Pilocarpine results in increased expression of NPY protein CTD PMID:12821374 Npy Rat (R)-noradrenaline affects response to substance ISO NPY (Homo sapiens) 6480464 NPY protein affects the susceptibility to Norepinephrine CTD PMID:15003356 Npy Rat (S)-amphetamine decreases expression EXP 6480464 Dextroamphetamine results in decreased expression of NPY mRNA and Dextroamphetamine results in decreased expression of NPY protein CTD PMID:19497417 Npy Rat (S)-nicotine decreases expression EXP 6480464 Nicotine results in decreased expression of NPY protein CTD PMID:33091441 Npy Rat (S)-nicotine multiple interactions EXP 6480464 Hexamethonium inhibits the reaction [Nicotine results in increased expression of NPY mRNA] CTD PMID:2233698 Npy Rat (S)-nicotine increases expression EXP 6480464 Nicotine results in increased expression of NPY mRNA and Nicotine results in increased expression of NPY protein CTD PMID:1907749 more ... Npy Rat 1,2-dichloroethane decreases expression ISO Npy (Mus musculus) 6480464 ethylene dichloride results in decreased expression of NPY mRNA CTD PMID:28960355 Npy Rat 1,3,5-trinitro-1,3,5-triazinane increases expression EXP 6480464 cyclonite results in increased expression of NPY mRNA CTD PMID:25559034 Npy Rat 17alpha-ethynylestradiol decreases expression ISO Npy (Mus musculus) 6480464 Ethinyl Estradiol results in decreased expression of NPY mRNA CTD PMID:29112739 Npy Rat 17alpha-ethynylestradiol multiple interactions ISO Npy (Mus musculus) 6480464 ESR1 gene mutant form inhibits the reaction [Ethinyl Estradiol results in decreased expression of NPY mRNA] CTD PMID:29112739 Npy Rat 17beta-estradiol decreases expression ISO Npy (Mus musculus) 6480464 Estradiol results in decreased expression of NPY mRNA CTD PMID:30524225 Npy Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of NPY mRNA CTD PMID:32145629 Npy Rat 2,2',4,4'-Tetrabromodiphenyl ether multiple interactions ISO Npy (Mus musculus) 6480464 ESR1 gene mutant form inhibits the reaction [2 more ... CTD PMID:29112739 Npy Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO Npy (Mus musculus) 6480464 2 more ... CTD PMID:29112739 Npy Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Npy (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of NPY mRNA CTD PMID:19465110 Npy Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Npy (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of NPY mRNA CTD PMID:24680724 Npy Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of NPY mRNA CTD PMID:15093705 and PMID:23871856 Npy Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of NPY mRNA CTD PMID:15977195 and PMID:22298810 Npy Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with LEP protein] affects the expression of NPY mRNA and AHR gene mutant form inhibits the reaction [Tetrachlorodibenzodioxin results in increased expression of NPY mRNA] CTD PMID:15977195 and PMID:23871856 Npy Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:21724226 Npy Rat 2-deoxy-D-glucose increases expression EXP 6480464 Deoxyglucose results in increased expression of NPY mRNA CTD PMID:10683841 Npy Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Npy (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of NPY mRNA CTD PMID:19285098 Npy Rat 3,4-methylenedioxymethamphetamine decreases expression EXP 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of NPY protein CTD PMID:17910739 Npy Rat 4,4'-sulfonyldiphenol decreases expression ISO Npy (Mus musculus) 6480464 bisphenol S results in decreased expression of NPY mRNA CTD PMID:30951980 Npy Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of NPY mRNA CTD PMID:24780913 Npy Rat acarbose decreases expression EXP 6480464 Acarbose results in decreased expression of NPY protein CTD PMID:18290871 Npy Rat aflatoxin B1 decreases methylation ISO NPY (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of NPY gene CTD PMID:27153756 Npy Rat aldehydo-D-glucose increases expression EXP 6480464 Glucose deficiency results in increased expression of NPY mRNA and Glucose results in increased expression of NPY protein CTD PMID:11177238 and PMID:31778773 Npy Rat aldehydo-D-glucose multiple interactions ISO Npy (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in decreased expression of NPY mRNA CTD PMID:37567420 Npy Rat aldehydo-D-glucose multiple interactions EXP 6480464 17-(dimethylaminoethylamino)-17-demethoxygeldanamycin inhibits the reaction [Dexamethasone inhibits the reaction [Glucose results in increased expression of NPY protein]] and Dexamethasone inhibits the reaction [Glucose results in increased expression of NPY protein] CTD PMID:31778773 Npy Rat aldehydo-D-glucose decreases expression EXP 6480464 Glucose results in decreased expression of NPY mRNA and Glucose results in decreased expression of NPY protein CTD PMID:16210367 and PMID:18627777 Npy Rat all-trans-retinoic acid decreases expression ISO NPY (Homo sapiens) 6480464 Tretinoin results in decreased expression of NPY mRNA CTD PMID:23724009 Npy Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of NPY mRNA CTD PMID:35163327 Npy Rat AM-251 multiple interactions EXP 6480464 [AM 251 co-treated with Water deficiency co-treated with Sodium Chloride and Dietary deficiency] results in increased expression of NPY mRNA CTD PMID:26468265 Npy Rat amitriptyline increases expression EXP 6480464 Amitriptyline results in increased expression of NPY mRNA CTD PMID:22341215 Npy Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of NPY mRNA CTD PMID:16483693 Npy Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of NPY mRNA CTD PMID:15183010 Npy Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of NPY mRNA and Amphetamine results in decreased expression of NPY protein CTD PMID:12005258 more ... Npy Rat amphetamine affects response to substance EXP 6480464 NPY protein affects the susceptibility to Amphetamine CTD PMID:16101753 Npy Rat amphetamine affects expression EXP 6480464 Amphetamine affects the expression of NPY protein CTD PMID:16896163 Npy Rat amphetamine decreases response to substance ISO Npy (Mus musculus) 6480464 NPY protein results in decreased susceptibility to Amphetamine CTD PMID:12183048 Npy Rat amphetamine increases response to substance EXP 6480464 NPY protein results in increased susceptibility to Amphetamine CTD PMID:12005258 Npy Rat amphetamine multiple interactions EXP 6480464 FOS protein promotes the reaction [Amphetamine results in decreased expression of NPY mRNA] more ... CTD PMID:15985714 more ... Npy Rat anthra[1,9-cd]pyrazol-6(2H)-one multiple interactions ISO Npy (Mus musculus) 6480464 pyrazolanthrone affects the reaction [bisphenol A affects the expression of NPY mRNA] CTD PMID:32960947 Npy Rat arsenite(3-) increases methylation ISO NPY (Homo sapiens) 6480464 arsenite results in increased methylation of NPY promoter CTD PMID:23974009 Npy Rat arsenous acid increases expression ISO NPY (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of NPY mRNA CTD PMID:11027660 Npy Rat aspartame decreases expression EXP 6480464 Aspartame results in decreased expression of NPY protein CTD PMID:11890951 Npy Rat ATP affects response to substance ISO NPY (Homo sapiens) 6480464 NPY protein affects the susceptibility to Adenosine Triphosphate CTD PMID:15003356 Npy Rat Aurothioglucose decreases expression ISO Npy (Mus musculus) 6480464 Aurothioglucose results in decreased expression of NPY mRNA CTD PMID:9794456 Npy Rat Azoxymethane multiple interactions ISO Npy (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of NPY mRNA CTD PMID:29950665 Npy Rat belinostat increases expression ISO NPY (Homo sapiens) 6480464 belinostat results in increased expression of NPY mRNA CTD PMID:26272509 Npy Rat belinostat multiple interactions ISO NPY (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of NPY mRNA CTD PMID:27188386 Npy Rat benzo[a]pyrene decreases expression ISO Npy (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of NPY mRNA CTD PMID:19770486 Npy Rat benzo[a]pyrene increases methylation ISO NPY (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of NPY 5' UTR CTD PMID:27901495 Npy Rat benzo[a]pyrene affects methylation ISO NPY (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of NPY promoter CTD PMID:27901495 Npy Rat bexarotene increases expression EXP 6480464 bexarotene results in increased expression of NPY mRNA CTD PMID:17630414 Npy Rat bezafibrate increases expression ISO Npy (Mus musculus) 6480464 Bezafibrate results in increased expression of NPY mRNA CTD PMID:18787029 Npy Rat bis(2-ethylhexyl) phthalate decreases expression EXP 6480464 Diethylhexyl Phthalate results in decreased expression of NPY mRNA CTD PMID:28871463 Npy Rat bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of NPY protein CTD PMID:37061009 Npy Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of NPY mRNA CTD PMID:18180321 and PMID:38750585 Npy Rat bisphenol A decreases expression ISO Npy (Mus musculus) 6480464 bisphenol A results in decreased expression of NPY mRNA CTD PMID:32156529 and PMID:35598803 Npy Rat bisphenol A affects expression ISO Npy (Mus musculus) 6480464 bisphenol A affects the expression of NPY mRNA CTD PMID:32960947 Npy Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of NPY mRNA CTD PMID:32145629 and PMID:36779543 Npy Rat bisphenol A increases expression ISO Npy (Mus musculus) 6480464 bisphenol A results in increased expression of NPY mRNA CTD PMID:30500912 and PMID:32575098 Npy Rat bisphenol A multiple interactions ISO Npy (Mus musculus) 6480464 4-(2-phenyl-5 more ... CTD PMID:30500912 more ... Npy Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of NPY mRNA CTD PMID:25181051 Npy Rat bisphenol F decreases expression ISO Npy (Mus musculus) 6480464 bisphenol F results in decreased expression of NPY mRNA CTD PMID:30951980 Npy Rat bucladesine increases expression EXP 6480464 Bucladesine results in increased expression of NPY mRNA CTD PMID:19912776 Npy Rat C60 fullerene increases expression EXP 6480464 fullerene C60 results in increased expression of NPY mRNA CTD PMID:19167457 Npy Rat cadmium atom increases expression ISO NPY (Homo sapiens) 6480464 Cadmium results in increased expression of NPY mRNA CTD PMID:21694771 Npy Rat cannabidiol decreases expression EXP 6480464 Cannabidiol results in decreased expression of NPY mRNA CTD PMID:31941059 Npy Rat cannabigerol decreases expression EXP 6480464 cannabigerol results in decreased expression of NPY mRNA CTD PMID:31941059 Npy Rat capsaicin multiple interactions EXP 6480464 Capsaicin inhibits the reaction [NPY protein affects the susceptibility to Potassium] CTD PMID:18055875 Npy Rat capsazepine multiple interactions ISO Npy (Mus musculus) 6480464 capsazepine inhibits the reaction [Olanzapine results in increased expression of NPY mRNA] CTD PMID:32652086 Npy Rat carbachol multiple interactions ISO Npy (Mus musculus) 6480464 NPY protein inhibits the reaction [Carbachol results in increased secretion of GCG protein] CTD PMID:3329090 Npy Rat carbon nanotube increases expression ISO Npy (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Npy Rat chlordecone decreases expression ISO Npy (Mus musculus) 6480464 Chlordecone results in decreased expression of NPY mRNA CTD PMID:33711761 Npy Rat chlorisondamine multiple interactions EXP 6480464 Chlorisondamine inhibits the reaction [Reserpine results in increased expression of NPY mRNA] and Chlorisondamine promotes the reaction [Reserpine results in increased expression of NPY mRNA] CTD PMID:1714554 Npy Rat chlorpyrifos increases expression EXP 6480464 Chlorpyrifos results in increased expression of NPY mRNA and Chlorpyrifos results in increased expression of NPY protein CTD PMID:20682304 and PMID:26775027 Npy Rat chlorpyrifos multiple interactions ISO NPY (Homo sapiens) 6480464 [APOE gene polymorphism affects the susceptibility to Chlorpyrifos] which affects the expression of NPY mRNA CTD PMID:31472362 Npy Rat choline multiple interactions ISO Npy (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of NPY mRNA CTD PMID:20938992 Npy Rat clofibrate multiple interactions ISO Npy (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of NPY mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of NPY mRNA] CTD PMID:17585979 Npy Rat clonidine decreases expression EXP 6480464 Clonidine results in decreased expression of NPY mRNA CTD PMID:1878751 Npy Rat clonidine multiple interactions EXP 6480464 Yohimbine inhibits the reaction [Clonidine results in decreased expression of NPY mRNA] CTD PMID:1878751 Npy Rat clonidine increases expression EXP 6480464 Clonidine results in increased expression of NPY mRNA CTD PMID:1878751 Npy Rat clonidine (amino form) decreases expression EXP 6480464 Clonidine results in decreased expression of NPY mRNA CTD PMID:1878751 Npy Rat clonidine (amino form) multiple interactions EXP 6480464 Yohimbine inhibits the reaction [Clonidine results in decreased expression of NPY mRNA] CTD PMID:1878751 Npy Rat clonidine (amino form) increases expression EXP 6480464 Clonidine results in increased expression of NPY mRNA CTD PMID:1878751 Npy Rat clonidine (imino form) decreases expression EXP 6480464 Clonidine results in decreased expression of NPY mRNA CTD PMID:1878751 Npy Rat clonidine (imino form) multiple interactions EXP 6480464 Yohimbine inhibits the reaction [Clonidine results in decreased expression of NPY mRNA] CTD PMID:1878751 Npy Rat clonidine (imino form) increases expression EXP 6480464 Clonidine results in increased expression of NPY mRNA CTD PMID:1878751 Npy Rat clozapine decreases expression EXP 6480464 Clozapine results in decreased expression of NPY mRNA CTD PMID:16516965 Npy Rat cocaine affects expression EXP 6480464 Cocaine affects the expression of NPY mRNA CTD PMID:17851536 and PMID:20187946 Npy Rat cocaine decreases expression EXP 6480464 Cocaine results in decreased expression of NPY mRNA CTD PMID:16076954 Npy Rat corticosterone decreases expression EXP 6480464 Corticosterone results in decreased expression of NPY mRNA CTD PMID:15755911 Npy Rat cortisol affects expression ISO NPY (Homo sapiens) 6480464 Hydrocortisone affects the expression of NPY protein CTD PMID:7955553 Npy Rat cyanocob(III)alamin multiple interactions ISO Npy (Mus musculus) 6480464 Vitamin B 12 affects the reaction [bisphenol A affects the expression of NPY mRNA] CTD PMID:32960947 Npy Rat cytarabine decreases expression ISO NPY (Homo sapiens) 6480464 Cytarabine results in decreased expression of NPY mRNA CTD PMID:21198554 Npy Rat D-glucose decreases expression EXP 6480464 Glucose results in decreased expression of NPY mRNA and Glucose results in decreased expression of NPY protein CTD PMID:16210367 and PMID:18627777 Npy Rat D-glucose multiple interactions ISO Npy (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in decreased expression of NPY mRNA CTD PMID:37567420 Npy Rat D-glucose multiple interactions EXP 6480464 17-(dimethylaminoethylamino)-17-demethoxygeldanamycin inhibits the reaction [Dexamethasone inhibits the reaction [Glucose results in increased expression of NPY protein]] and Dexamethasone inhibits the reaction [Glucose results in increased expression of NPY protein] CTD PMID:31778773 Npy Rat D-glucose increases expression EXP 6480464 Glucose deficiency results in increased expression of NPY mRNA and Glucose results in increased expression of NPY protein CTD PMID:11177238 and PMID:31778773 Npy Rat deoxynivalenol increases expression EXP 6480464 deoxynivalenol results in increased expression of NPY mRNA CTD PMID:32738333 Npy Rat dexamethasone multiple interactions EXP 6480464 17-(dimethylaminoethylamino)-17-demethoxygeldanamycin inhibits the reaction [Dexamethasone inhibits the reaction [Glucose results in increased expression of NPY protein]] more ... CTD PMID:20504635 and PMID:31778773 Npy Rat dexamethasone increases expression EXP 6480464 Dexamethasone results in increased expression of NPY mRNA CTD PMID:1671012 and PMID:31778773 Npy Rat dextran sulfate multiple interactions ISO Npy (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of NPY mRNA CTD PMID:29950665 Npy Rat diarsenic trioxide increases expression ISO NPY (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of NPY mRNA CTD PMID:11027660 Npy Rat diazinon increases expression EXP 6480464 Diazinon results in increased expression of NPY mRNA CTD PMID:20682304 Npy Rat dieldrin increases expression EXP 6480464 Dieldrin results in increased expression of NPY mRNA CTD PMID:20682304 Npy Rat diprotium oxide multiple interactions EXP 6480464 [AM 251 co-treated with Water deficiency co-treated with Sodium Chloride and Dietary deficiency] results in increased expression of NPY mRNA CTD PMID:26468265 Npy Rat dorsomorphin multiple interactions ISO NPY (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Npy Rat dorsomorphin multiple interactions ISO Npy (Mus musculus) 6480464 dorsomorphin affects the reaction [bisphenol A affects the expression of NPY mRNA] CTD PMID:32960947 Npy Rat entinostat increases expression ISO NPY (Homo sapiens) 6480464 entinostat results in increased expression of NPY mRNA CTD PMID:27188386 Npy Rat enzyme inhibitor multiple interactions EXP 6480464 Enzyme Inhibitors inhibits the reaction [Phenylpropanolamine results in decreased expression of NPY protein] CTD PMID:24792324 Npy Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of NPY mRNA CTD PMID:11095510 Npy Rat ethanol affects expression ISO Npy (Mus musculus) 6480464 Ethanol affects the expression of NPY mRNA CTD PMID:30319688 Npy Rat fluoxetine increases expression ISO Npy (Mus musculus) 6480464 Fluoxetine results in increased expression of NPY mRNA CTD PMID:20816900 Npy Rat fluoxetine decreases secretion EXP 6480464 Fluoxetine results in decreased secretion of NPY mRNA and Fluoxetine results in decreased secretion of NPY protein CTD PMID:8737424 Npy Rat fluoxetine affects expression EXP 6480464 Fluoxetine affects the expression of NPY mRNA CTD PMID:9729278 Npy Rat fluoxetine decreases expression EXP 6480464 Fluoxetine results in decreased expression of NPY mRNA CTD PMID:16042082 Npy Rat folic acid multiple interactions ISO Npy (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of NPY mRNA CTD PMID:20938992 Npy Rat fructose decreases expression EXP 6480464 Fructose results in decreased expression of NPY mRNA CTD PMID:18627777 Npy Rat fructose multiple interactions ISO Npy (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in decreased expression of NPY mRNA CTD PMID:37567420 Npy Rat furan decreases expression EXP 6480464 furan results in decreased expression of NPY mRNA CTD PMID:26194646 Npy Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of NPY mRNA CTD PMID:22061828 Npy Rat glucose decreases expression EXP 6480464 Glucose results in decreased expression of NPY mRNA and Glucose results in decreased expression of NPY protein CTD PMID:16210367 and PMID:18627777 Npy Rat glucose multiple interactions ISO Npy (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in decreased expression of NPY mRNA CTD PMID:37567420 Npy Rat glucose multiple interactions EXP 6480464 17-(dimethylaminoethylamino)-17-demethoxygeldanamycin inhibits the reaction [Dexamethasone inhibits the reaction [Glucose results in increased expression of NPY protein]] and Dexamethasone inhibits the reaction [Glucose results in increased expression of NPY protein] CTD PMID:31778773 Npy Rat glucose increases expression EXP 6480464 Glucose deficiency results in increased expression of NPY mRNA and Glucose results in increased expression of NPY protein CTD PMID:11177238 and PMID:31778773 Npy Rat Glutathione ethyl ester multiple interactions EXP 6480464 S-ethyl glutathione inhibits the reaction [Amphetamine results in decreased expression of NPY mRNA] more ... CTD PMID:24792324 and PMID:25825358 Npy Rat glycidol decreases expression EXP 6480464 glycidol results in decreased expression of NPY mRNA CTD PMID:24915197 Npy Rat guanethidine decreases expression EXP 6480464 Guanethidine results in decreased expression of NPY protein CTD PMID:14527964 and PMID:9460767 Npy Rat guanethidine decreases secretion ISO NPY (Homo sapiens) 6480464 Guanethidine results in decreased secretion of NPY protein CTD PMID:15003356 Npy Rat haloperidol multiple interactions EXP 6480464 Haloperidol promotes the reaction [Amphetamine results in decreased expression of NPY protein] CTD PMID:15985714 Npy Rat haloperidol increases expression EXP 6480464 Haloperidol results in increased expression of NPY protein CTD PMID:7644023 Npy Rat haloperidol decreases expression EXP 6480464 Haloperidol results in decreased expression of NPY mRNA CTD PMID:16516965 Npy Rat Hexamethonium multiple interactions EXP 6480464 Hexamethonium inhibits the reaction [Nicotine results in increased expression of NPY mRNA] CTD PMID:2233698 Npy Rat kainic acid decreases response to substance ISO Npy (Mus musculus) 6480464 NPY protein results in decreased susceptibility to Kainic Acid CTD PMID:15451008 Npy Rat kainic acid multiple interactions EXP 6480464 Thiopental inhibits the reaction [Kainic Acid results in increased expression of NPY mRNA] CTD PMID:9427505 Npy Rat kainic acid increases expression EXP 6480464 Kainic Acid results in increased expression of NPY mRNA CTD PMID:9427505 Npy Rat ketamine increases response to substance ISO Npy (Mus musculus) 6480464 NPY protein results in increased susceptibility to Ketamine CTD PMID:11454027 Npy Rat L-methionine multiple interactions ISO Npy (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of NPY mRNA CTD PMID:20938992 Npy Rat limonene decreases expression ISO NPY (Homo sapiens) 6480464 limonene results in decreased expression of NPY protein CTD PMID:22757684 Npy Rat limonene decreases expression EXP 6480464 limonene results in decreased expression of NPY mRNA CTD PMID:22757684 Npy Rat linalool increases expression ISO NPY (Homo sapiens) 6480464 linalool results in increased expression of NPY protein CTD PMID:22757684 Npy Rat linalool increases expression EXP 6480464 linalool results in increased expression of NPY mRNA CTD PMID:22757684 Npy Rat lithium atom increases expression EXP 6480464 Lithium results in increased expression of NPY mRNA and Lithium results in increased expression of NPY protein CTD PMID:17572454 Npy Rat lithium hydride increases expression EXP 6480464 Lithium results in increased expression of NPY mRNA and Lithium results in increased expression of NPY protein CTD PMID:17572454 Npy Rat masoprocol multiple interactions ISO Npy (Mus musculus) 6480464 Masoprocol affects the reaction [bisphenol A affects the expression of NPY mRNA] CTD PMID:32960947 Npy Rat mercury dibromide multiple interactions ISO NPY (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of NPY mRNA CTD PMID:27188386 Npy Rat metformin multiple interactions ISO Npy (Mus musculus) 6480464 Metformin inhibits the reaction [Olanzapine results in increased expression of NPY mRNA] CTD PMID:32652086 Npy Rat methamphetamine increases expression ISO Npy (Mus musculus) 6480464 Methamphetamine results in increased expression of NPY mRNA CTD PMID:15930374 Npy Rat methamphetamine decreases expression EXP 6480464 Methamphetamine results in decreased expression of NPY protein CTD PMID:17910739 Npy Rat methylmercury chloride decreases expression ISO Npy (Mus musculus) 6480464 methylmercuric chloride results in decreased expression of NPY mRNA CTD PMID:33301842 and PMID:33338554 Npy Rat monosodium L-glutamate decreases expression ISO Npy (Mus musculus) 6480464 Sodium Glutamate results in decreased expression of NPY mRNA CTD PMID:9794456 Npy Rat monosodium L-glutamate decreases expression EXP 6480464 Sodium Glutamate results in decreased expression of NPY mRNA CTD PMID:19151514 Npy Rat morphine increases expression ISO Npy (Mus musculus) 6480464 Morphine results in increased expression of NPY mRNA CTD PMID:20144693 and PMID:21178816 Npy Rat Muraglitazar decreases expression EXP 6480464 muraglitazar results in decreased expression of NPY mRNA CTD PMID:21515302 Npy Rat N-acetyl-L-cysteine multiple interactions ISO Npy (Mus musculus) 6480464 Acetylcysteine affects the reaction [bisphenol A affects the expression of NPY mRNA] CTD PMID:32960947 Npy Rat nickel atom decreases expression EXP 6480464 Nickel results in decreased expression of NPY mRNA CTD PMID:20682304 Npy Rat nicotine decreases expression EXP 6480464 Nicotine results in decreased expression of NPY protein CTD PMID:33091441 Npy Rat nicotine multiple interactions EXP 6480464 Hexamethonium inhibits the reaction [Nicotine results in increased expression of NPY mRNA] CTD PMID:2233698 Npy Rat nicotine increases expression EXP 6480464 Nicotine results in increased expression of NPY mRNA and Nicotine results in increased expression of NPY protein CTD PMID:1907749 more ... Npy Rat nitroglycerin increases expression EXP 6480464 Nitroglycerin results in increased expression of NPY protein CTD PMID:10426492 Npy Rat olanzapine decreases expression EXP 6480464 olanzapine results in decreased expression of NPY mRNA CTD PMID:16516965 Npy Rat olanzapine increases expression ISO Npy (Mus musculus) 6480464 Olanzapine results in increased expression of NPY mRNA CTD PMID:32652086 Npy Rat olanzapine multiple interactions ISO Npy (Mus musculus) 6480464 capsazepine inhibits the reaction [Olanzapine results in increased expression of NPY mRNA] more ... CTD PMID:32652086 Npy Rat olanzapine increases expression EXP 6480464 olanzapine results in increased expression of NPY protein CTD PMID:21695181 Npy Rat orlistat increases expression ISO NPY (Homo sapiens) 6480464 orlistat results in increased expression of NPY protein CTD PMID:15962606 Npy Rat orphenadrine affects expression EXP 6480464 Orphenadrine affects the expression of NPY mRNA CTD PMID:23665939 Npy Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of NPY mRNA CTD PMID:25729387 Npy Rat oxidopamine increases expression EXP 6480464 Oxidopamine results in increased expression of NPY mRNA CTD PMID:15303306 Npy Rat oxidopamine decreases expression EXP 6480464 Oxidopamine results in decreased expression of NPY protein CTD PMID:3805164 and PMID:9460767 Npy Rat Oxotremorine increases expression EXP 6480464 Oxotremorine results in increased expression of NPY protein CTD PMID:1907749 Npy Rat ozone increases expression EXP 6480464 Ozone results in increased expression of NPY mRNA CTD PMID:16716893 Npy Rat paclitaxel increases expression EXP 6480464 Paclitaxel results in increased expression of NPY protein CTD PMID:17686523 Npy Rat panobinostat multiple interactions ISO NPY (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of NPY mRNA CTD PMID:27188386 Npy Rat panobinostat increases expression ISO NPY (Homo sapiens) 6480464 panobinostat results in increased expression of NPY mRNA CTD PMID:26272509 Npy Rat paracetamol multiple interactions ISO Npy (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of NPY mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of NPY mRNA] CTD PMID:17585979 Npy Rat paracetamol decreases expression ISO Npy (Mus musculus) 6480464 Acetaminophen results in decreased expression of NPY mRNA CTD PMID:17585979 Npy Rat paricalcitol increases expression ISO Npy (Mus musculus) 6480464 paricalcitol results in increased expression of NPY mRNA CTD PMID:25037058 Npy Rat pentobarbital increases response to substance ISO Npy (Mus musculus) 6480464 NPY protein results in increased susceptibility to Pentobarbital CTD PMID:11454027 Npy Rat pentobarbital multiple interactions ISO Npy (Mus musculus) 6480464 NPY1R protein affects the reaction [NPY protein results in increased susceptibility to Pentobarbital] CTD PMID:11454027 Npy Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of NPY mRNA CTD PMID:35163327 Npy Rat phenacetin increases expression EXP 6480464 Phenacetin results in increased expression of NPY mRNA CTD PMID:17082564 Npy Rat phenformin affects expression EXP 6480464 Phenformin affects the expression of NPY mRNA CTD PMID:31324951 Npy Rat phenylephrine multiple interactions ISO Npy (Mus musculus) 6480464 [Phenylephrine co-treated with ADRA1B protein] results in decreased expression of NPY protein more ... CTD PMID:10660688 and PMID:11499749 Npy Rat phenylhydrazine increases expression EXP 6480464 phenylhydrazine results in increased expression of NPY mRNA CTD PMID:17082564 Npy Rat phenylmercury acetate increases expression ISO NPY (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of NPY mRNA CTD PMID:26272509 Npy Rat phenylmercury acetate multiple interactions ISO NPY (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of NPY mRNA CTD PMID:27188386 Npy Rat phenylpropanolamine multiple interactions EXP 6480464 [Prazosin co-treated with SCH 23390] inhibits the reaction [Phenylpropanolamine results in decreased expression of NPY protein] more ... CTD PMID:21989786 more ... Npy Rat phenylpropanolamine decreases expression EXP 6480464 Phenylpropanolamine results in decreased expression of NPY mRNA and Phenylpropanolamine results in decreased expression of NPY protein CTD PMID:17684035 more ... Npy Rat phorbol 13-acetate 12-myristate multiple interactions ISO Npy (Mus musculus) 6480464 Tetradecanoylphorbol Acetate inhibits the reaction [NPY protein promotes the reaction [Phenylephrine results in increased phosphorylation of MAPK1 protein]] and Tetradecanoylphorbol Acetate inhibits the reaction [NPY protein promotes the reaction [Phenylephrine results in increased phosphorylation of MAPK3 protein]] CTD PMID:10660688 Npy Rat phorbol 13-acetate 12-myristate decreases expression EXP 6480464 Tetradecanoylphorbol Acetate results in decreased expression of NPY protein CTD PMID:19912776 Npy Rat pioglitazone multiple interactions ISO Npy (Mus musculus) 6480464 [N-nitroso-tris-chloroethylurea co-treated with pioglitazone] results in increased expression of NPY mRNA CTD PMID:27935865 Npy Rat pirinixic acid decreases expression ISO Npy (Mus musculus) 6480464 pirinixic acid results in decreased expression of NPY mRNA CTD PMID:17426115 Npy Rat pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of NPY mRNA CTD PMID:19162173 Npy Rat potassium atom multiple interactions ISO Npy (Mus musculus) 6480464 NPY protein inhibits the reaction [CALCA protein affects the susceptibility to Potassium] CTD PMID:18055875 Npy Rat potassium atom increases secretion EXP 6480464 Potassium results in increased secretion of NPY protein CTD PMID:29320738 Npy Rat potassium atom increases response to substance EXP 6480464 NPY protein results in increased susceptibility to Potassium CTD PMID:18055875 Npy Rat potassium atom multiple interactions EXP 6480464 Capsaicin inhibits the reaction [NPY protein affects the susceptibility to Potassium] more ... CTD PMID:18055875 and PMID:29320738 Npy Rat potassium chloride increases expression EXP 6480464 Potassium Chloride results in increased expression of NPY mRNA CTD PMID:2233698 Npy Rat prazosin multiple interactions EXP 6480464 [Prazosin co-treated with SCH 23390] inhibits the reaction [Phenylpropanolamine results in decreased expression of NPY protein] CTD PMID:21989786 Npy Rat progesterone increases expression ISO NPY (Homo sapiens) 6480464 Progesterone results in increased expression of NPY mRNA CTD PMID:18070364 Npy Rat progesterone decreases expression ISO Npy (Mus musculus) 6480464 Progesterone results in decreased expression of NPY mRNA CTD PMID:22238285 Npy Rat progesterone increases secretion EXP 6480464 NPY protein results in increased secretion of Progesterone CTD PMID:20150881 Npy Rat propofol multiple interactions EXP 6480464 Propofol inhibits the reaction [Potassium results in increased secretion of NPY protein] CTD PMID:29320738 Npy Rat quinpirole multiple interactions ISO Npy (Mus musculus) 6480464 NPY protein results in decreased susceptibility to [2 more ... CTD PMID:12183048 Npy Rat RES-701-1 multiple interactions EXP 6480464 RES 701-1 inhibits the reaction [EDN1 protein results in decreased secretion of NPY protein] CTD PMID:12234805 Npy Rat reserpine multiple interactions EXP 6480464 Chlorisondamine inhibits the reaction [Reserpine results in increased expression of NPY mRNA] more ... CTD PMID:1714554 and PMID:20504635 Npy Rat reserpine increases expression EXP 6480464 Reserpine results in increased expression of NPY mRNA and Reserpine results in increased expression of NPY protein CTD PMID:1671012 more ... Npy Rat reserpine decreases expression EXP 6480464 Reserpine results in decreased expression of NPY mRNA and Reserpine results in decreased expression of NPY protein CTD PMID:2233698 more ... Npy Rat resveratrol multiple interactions ISO NPY (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of NPY mRNA CTD PMID:23557933 Npy Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of NPY mRNA CTD PMID:27900601 Npy Rat rotenone affects expression EXP 6480464 Rotenone affects the expression of NPY mRNA CTD PMID:28374803 Npy Rat ruthenium red multiple interactions ISO Npy (Mus musculus) 6480464 Ruthenium Red inhibits the reaction [Olanzapine results in increased expression of NPY mRNA] CTD PMID:32652086 Npy Rat SB 431542 multiple interactions ISO NPY (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Npy Rat SCH 23390 increases expression EXP 6480464 SCH 23390 results in increased expression of NPY protein CTD PMID:7644023 Npy Rat SCH 23390 multiple interactions EXP 6480464 [Prazosin co-treated with SCH 23390] inhibits the reaction [Phenylpropanolamine results in decreased expression of NPY protein] CTD PMID:21989786 Npy Rat sevoflurane multiple interactions EXP 6480464 PHLDA1 protein promotes the reaction [Sevoflurane results in decreased expression of NPY protein] CTD PMID:36155068 Npy Rat sevoflurane decreases expression EXP 6480464 Sevoflurane results in decreased expression of NPY protein CTD PMID:36155068 Npy Rat silicon dioxide increases expression ISO NPY (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of NPY mRNA CTD PMID:25895662 Npy Rat silicon dioxide increases expression ISO Npy (Mus musculus) 6480464 Silicon Dioxide results in increased expression of NPY mRNA CTD PMID:29341224 Npy Rat SKF 38393 multiple interactions ISO Npy (Mus musculus) 6480464 NPY protein results in decreased susceptibility to [2 more ... CTD PMID:12183048 Npy Rat Soman increases expression EXP 6480464 Soman results in increased expression of NPY mRNA CTD PMID:19281266 Npy Rat streptozocin multiple interactions EXP 6480464 INS protein inhibits the reaction [Streptozocin results in increased expression of NPY mRNA] CTD PMID:20219977 Npy Rat streptozocin increases expression EXP 6480464 Streptozocin results in increased expression of NPY mRNA CTD PMID:20219977 Npy Rat succimer multiple interactions ISO Npy (Mus musculus) 6480464 [Succimer binds to Magnetite Nanoparticles] which results in increased expression of NPY mRNA CTD PMID:21641980 Npy Rat tauroursodeoxycholic acid multiple interactions ISO Npy (Mus musculus) 6480464 ursodoxicoltaurine affects the reaction [bisphenol A affects the expression of NPY mRNA] CTD PMID:32960947 Npy Rat terbutaline multiple interactions ISO Npy (Mus musculus) 6480464 NPY protein inhibits the reaction [Terbutaline results in increased secretion of GCG protein] CTD PMID:3329090 Npy Rat Tesaglitazar decreases expression EXP 6480464 tesaglitazar results in decreased expression of NPY mRNA CTD PMID:21515302 Npy Rat tetrachloromethane increases expression ISO Npy (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of NPY mRNA CTD PMID:31919559 Npy Rat tetrodotoxin multiple interactions EXP 6480464 Tetrodotoxin inhibits the reaction [Veratridine results in increased expression of NPY mRNA] CTD PMID:2233698 Npy Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of NPY mRNA CTD PMID:34492290 Npy Rat thiopental multiple interactions EXP 6480464 Thiopental inhibits the reaction [Kainic Acid results in increased expression of NPY mRNA] CTD PMID:9427505 Npy Rat titanium dioxide increases expression ISO Npy (Mus musculus) 6480464 titanium dioxide results in increased expression of NPY mRNA CTD PMID:19464567 Npy Rat titanium dioxide decreases methylation ISO Npy (Mus musculus) 6480464 titanium dioxide results in decreased methylation of NPY promoter CTD PMID:35295148 Npy Rat titanium dioxide increases methylation ISO Npy (Mus musculus) 6480464 titanium dioxide results in increased methylation of NPY gene CTD PMID:35295148 Npy Rat titanium dioxide multiple interactions ISO Npy (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of NPY mRNA CTD PMID:29950665 Npy Rat topiramate increases expression EXP 6480464 topiramate results in increased expression of NPY protein CTD PMID:17572454 Npy Rat topotecan increases expression EXP 6480464 Topotecan results in increased expression of NPY mRNA CTD PMID:25729387 Npy Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of NPY mRNA CTD PMID:25729387 Npy Rat tribromoethanol increases response to substance ISO Npy (Mus musculus) 6480464 NPY protein results in increased susceptibility to tribromoethanol CTD PMID:11454027 Npy Rat tributylstannane decreases expression ISO Npy (Mus musculus) 6480464 tributyltin results in decreased expression of NPY protein CTD PMID:27310180 Npy Rat Tributyltin oxide increases expression ISO Npy (Mus musculus) 6480464 bis(tri-n-butyltin)oxide results in increased expression of NPY mRNA CTD PMID:18958704 Npy Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of NPY mRNA CTD PMID:33387578 Npy Rat trichostatin A increases expression ISO NPY (Homo sapiens) 6480464 trichostatin A results in increased expression of NPY mRNA CTD PMID:24935251 and PMID:26272509 Npy Rat trichostatin A multiple interactions EXP 6480464 trichostatin A inhibits the reaction [Dexamethasone results in increased expression of NPY mRNA] CTD PMID:31778773 Npy Rat trichostatin A multiple interactions ISO NPY (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of NPY mRNA CTD PMID:27188386 Npy Rat triclosan increases expression ISO NPY (Homo sapiens) 6480464 Triclosan results in increased expression of NPY mRNA CTD PMID:30510588 Npy Rat triphenyl phosphate multiple interactions ISO Npy (Mus musculus) 6480464 [tris(1 more ... CTD PMID:29112739 Npy Rat troglitazone decreases expression EXP 6480464 troglitazone results in decreased expression of NPY mRNA CTD PMID:21515302 Npy Rat undecane increases expression EXP 6480464 undecane results in increased expression of NPY protein CTD PMID:17337753 Npy Rat valproic acid affects expression ISO NPY (Homo sapiens) 6480464 Valproic Acid affects the expression of NPY mRNA CTD PMID:25979313 Npy Rat valproic acid multiple interactions ISO NPY (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of NPY mRNA CTD PMID:27188386 Npy Rat valproic acid increases expression ISO NPY (Homo sapiens) 6480464 Valproic Acid results in increased expression of NPY mRNA CTD PMID:23179753 more ... Npy Rat valproic acid increases expression ISO Npy (Mus musculus) 6480464 Valproic Acid results in increased expression of NPY mRNA CTD PMID:24896083 Npy Rat vanadium atom increases expression ISO NPY (Homo sapiens) 6480464 Vanadium results in increased expression of NPY mRNA CTD PMID:19000753 Npy Rat vanadium(0) increases expression ISO NPY (Homo sapiens) 6480464 Vanadium results in increased expression of NPY mRNA CTD PMID:19000753 Npy Rat vanadyl sulfate increases expression EXP 6480464 vanadyl sulfate results in increased expression of NPY mRNA CTD PMID:11294500 Npy Rat vancomycin increases expression ISO Npy (Mus musculus) 6480464 Vancomycin results in increased expression of NPY mRNA CTD PMID:18930951 Npy Rat veratridine multiple interactions EXP 6480464 Tetrodotoxin inhibits the reaction [Veratridine results in increased expression of NPY mRNA] CTD PMID:2233698 Npy Rat veratridine increases expression EXP 6480464 Veratridine results in increased expression of NPY mRNA CTD PMID:2233698 Npy Rat vincaleukoblastine decreases expression EXP 6480464 Vinblastine results in decreased expression of NPY mRNA CTD PMID:1671012 Npy Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of NPY mRNA CTD PMID:23034163 Npy Rat vorinostat multiple interactions ISO NPY (Homo sapiens) 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of NPY mRNA CTD PMID:27188386 Npy Rat vorinostat increases expression ISO NPY (Homo sapiens) 6480464 vorinostat results in increased expression of NPY mRNA CTD PMID:26272509 Npy Rat water multiple interactions EXP 6480464 [AM 251 co-treated with Water deficiency co-treated with Sodium Chloride and Dietary deficiency] results in increased expression of NPY mRNA CTD PMID:26468265 Npy Rat XL147 multiple interactions ISO Npy (Mus musculus) 6480464 [N-nitroso-tris-chloroethylurea co-treated with XL147] results in increased expression of NPY mRNA CTD PMID:27935865 Npy Rat yohimbine multiple interactions EXP 6480464 Yohimbine inhibits the reaction [Clonidine results in decreased expression of NPY mRNA] CTD PMID:1878751 Npy Rat zalcitabine multiple interactions EXP 6480464 [gp120 protein and Human immunodeficiency virus 1 co-treated with Zalcitabine] results in increased expression of NPY mRNA CTD PMID:18606552 Npy Rat zinc atom decreases expression EXP 6480464 Zinc deficiency results in decreased expression of NPY mRNA CTD PMID:12672911 and PMID:16413754 Npy Rat zinc(0) decreases expression EXP 6480464 Zinc deficiency results in decreased expression of NPY mRNA CTD PMID:12672911 and PMID:16413754
absence epilepsy (IDA,ISO) AIDS Dementia Complex (ISO) alcohol dependence (ISO) alcohol use disorder (IAGP,ISO) Alzheimer's disease (IEP,ISO) Anorexia (IEP,ISO) anxiety disorder (ISO) arteriosclerosis (ISO) asthma (ISO) atherosclerosis (ISO) Brain Injuries (IEP) cardiovascular system disease (ISO) Cerebral Hemorrhage (IEP) cerebral infarction (IEP,ISO) Chronic Bronchitis (ISO) Cocaine-Related Disorders (ISO) congestive heart failure (IEP) dementia (ISO) depressive disorder (IDA,IEP,ISO) Endotoxemia (IDA) epilepsy (ISO) Experimental Colitis (IMP) Experimental Diabetes Mellitus (IEP) Experimental Seizures (IEP,IMP) Febrile Seizures (IEP) Huntington's disease (IEP,ISO) Hyperalgesia (IEP) Hypercholesterolemia (ISO) Hyperkinesis (ISO) hypertension (IEP,IMP,ISO) Hypertrophy (ISO) hypothyroidism (IEP) Intestinal Ischemia (IEP) Left Ventricular Hypertrophy (ISO) median neuropathy (IEP) Memory Disorders (ISO) Muscle Rigidity (ISO) Nasal Obstruction (ISO) Neurobehavioral Manifestations (ISO) obesity (IEP) peripheral artery disease (ISO) peripheral nervous system disease (ISO) pleomorphic xanthoastrocytoma (ISO) Primary Graft Dysfunction (IEP) rhinitis (ISO) Sleep Deprivation (IEP) status epilepticus (IEP) substance-related disorder (ISO) temporal lobe epilepsy (ISO) type 2 diabetes mellitus (ISO) Weight Loss (ISO) withdrawal disorder (ISO)
(+)-pilocarpine (EXP,ISO) (R)-noradrenaline (ISO) (S)-amphetamine (EXP) (S)-nicotine (EXP) 1,2-dichloroethane (ISO) 1,3,5-trinitro-1,3,5-triazinane (EXP) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2-deoxy-D-glucose (EXP) 3,4-methylenedioxymethamphetamine (EXP,ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) acarbose (EXP) aflatoxin B1 (ISO) aldehydo-D-glucose (EXP,ISO) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) AM-251 (EXP) amitriptyline (EXP) ammonium chloride (EXP) amphetamine (EXP,ISO) anthra[1,9-cd]pyrazol-6(2H)-one (ISO) arsenite(3-) (ISO) arsenous acid (ISO) aspartame (EXP) ATP (ISO) Aurothioglucose (ISO) Azoxymethane (ISO) belinostat (ISO) benzo[a]pyrene (ISO) bexarotene (EXP) bezafibrate (ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) bisphenol F (ISO) bucladesine (EXP) C60 fullerene (EXP) cadmium atom (ISO) cannabidiol (EXP) cannabigerol (EXP) capsaicin (EXP) capsazepine (ISO) carbachol (ISO) carbon nanotube (ISO) chlordecone (ISO) chlorisondamine (EXP) chlorpyrifos (EXP,ISO) choline (ISO) clofibrate (ISO) clonidine (EXP) clonidine (amino form) (EXP) clonidine (imino form) (EXP) clozapine (EXP) cocaine (EXP) corticosterone (EXP) cortisol (ISO) cyanocob(III)alamin (ISO) cytarabine (ISO) D-glucose (EXP,ISO) deoxynivalenol (EXP) dexamethasone (EXP) dextran sulfate (ISO) diarsenic trioxide (ISO) diazinon (EXP) dieldrin (EXP) diprotium oxide (EXP) dorsomorphin (ISO) entinostat (ISO) enzyme inhibitor (EXP) ethanol (EXP,ISO) fluoxetine (EXP,ISO) folic acid (ISO) fructose (EXP,ISO) furan (EXP) gentamycin (EXP) glucose (EXP,ISO) Glutathione ethyl ester (EXP) glycidol (EXP) guanethidine (EXP,ISO) haloperidol (EXP) Hexamethonium (EXP) kainic acid (EXP,ISO) ketamine (ISO) L-methionine (ISO) limonene (EXP,ISO) linalool (EXP,ISO) lithium atom (EXP) lithium hydride (EXP) masoprocol (ISO) mercury dibromide (ISO) metformin (ISO) methamphetamine (EXP,ISO) methylmercury chloride (ISO) monosodium L-glutamate (EXP,ISO) morphine (ISO) Muraglitazar (EXP) N-acetyl-L-cysteine (ISO) nickel atom (EXP) nicotine (EXP) nitroglycerin (EXP) olanzapine (EXP,ISO) orlistat (ISO) orphenadrine (EXP) oxaliplatin (EXP) oxidopamine (EXP) Oxotremorine (EXP) ozone (EXP) paclitaxel (EXP) panobinostat (ISO) paracetamol (ISO) paricalcitol (ISO) pentobarbital (ISO) perfluorooctanoic acid (EXP) phenacetin (EXP) phenformin (EXP) phenylephrine (ISO) phenylhydrazine (EXP) phenylmercury acetate (ISO) phenylpropanolamine (EXP) phorbol 13-acetate 12-myristate (EXP,ISO) pioglitazone (ISO) pirinixic acid (EXP,ISO) potassium atom (EXP,ISO) potassium chloride (EXP) prazosin (EXP) progesterone (EXP,ISO) propofol (EXP) quinpirole (ISO) RES-701-1 (EXP) reserpine (EXP) resveratrol (ISO) rotenone (EXP) ruthenium red (ISO) SB 431542 (ISO) SCH 23390 (EXP) sevoflurane (EXP) silicon dioxide (ISO) SKF 38393 (ISO) Soman (EXP) streptozocin (EXP) succimer (ISO) tauroursodeoxycholic acid (ISO) terbutaline (ISO) Tesaglitazar (EXP) tetrachloromethane (ISO) tetrodotoxin (EXP) thioacetamide (EXP) thiopental (EXP) titanium dioxide (ISO) topiramate (EXP) topotecan (EXP) tribromoethanol (ISO) tributylstannane (ISO) Tributyltin oxide (ISO) trichloroethene (EXP) trichostatin A (EXP,ISO) triclosan (ISO) triphenyl phosphate (ISO) troglitazone (EXP) undecane (EXP) valproic acid (ISO) vanadium atom (ISO) vanadium(0) (ISO) vanadyl sulfate (EXP) vancomycin (ISO) veratridine (EXP) vincaleukoblastine (EXP) vinclozolin (EXP) vorinostat (ISO) water (EXP) XL147 (ISO) yohimbine (EXP) zalcitabine (EXP) zinc atom (EXP) zinc(0) (EXP)
1.
NPY in rat retina is present in neurons, in endothelial cells and also in microglial and Muller cells.
Alvaro AR, etal., Neurochem Int. 2007 Apr;50(5):757-63. Epub 2007 Feb 8.
2.
Differential modulation of synaptic transmission by neuropeptide Y in rat neocortical neurons.
Bacci A, etal., Proc Natl Acad Sci U S A 2002 Dec 24;99(26):17125-30.
3.
Chronic quinolinic acid lesions in rats closely resemble Huntington's disease.
Beal MF, etal., J Neurosci. 1991 Jun;11(6):1649-59.
4.
Somatostatin and neuropeptide Y immunoreactivity in Parkinson's disease dementia with Alzheimer's changes.
Beal MF, etal., Synapse. 1988;2(4):463-7.
5.
NPY modulates epinephrine-induced leukocytosis via Y-1 and Y-5 receptor activation in vivo: sympathetic co-transmission during leukocyte mobilization.
Bedoui S, etal., J Neuroimmunol 2002 Nov;132(1-2):25-33.
6.
Capture of Dense Core Vesicles at Synapses by JNK-Dependent Phosphorylation of Synaptotagmin-4.
Bharat V, etal., Cell Rep. 2017 Nov 21;21(8):2118-2133. doi: 10.1016/j.celrep.2017.10.084.
7.
The antidepressant effects of running and escitalopram are associated with levels of hippocampal NPY and Y1 receptor but not cell proliferation in a rat model of depression.
Bjornebekk A, etal., Hippocampus. 2010 Jul;20(7):820-8. doi: 10.1002/hipo.20683.
8.
Nerve stimulation induced overflow of neuropeptide Y and modulation by angiotensin II in spontaneously hypertensive rats.
Byku M, etal., Am J Physiol Heart Circ Physiol. 2008 Nov;295(5):H2188-97. doi: 10.1152/ajpheart.00384.2008. Epub 2008 Oct 3.
9.
Renal and cardiac neuropeptide Y and NPY receptors in a rat model of congestive heart failure.
Callanan EY, etal., Am J Physiol Renal Physiol. 2007 Dec;293(6):F1811-7. Epub 2007 Sep 5.
10.
Hypothyroidism Induces Hypophagia Associated with Alterations in Protein Expression of Neuropeptide Y and Proopiomelanocortin in the Arcuate Nucleus, Independently of Hypothalamic Nuclei-Specific Changes in Leptin Signaling.
Calvino C, etal., Thyroid. 2016 Jan;26(1):134-43. doi: 10.1089/thy.2015.0384. Epub 2015 Dec 1.
11.
The feeding response to melanin-concentrating hormone is attenuated by antagonism of the NPY Y(1)-receptor in the rat.
Chaffer CL and Morris MJ, Endocrinology 2002 Jan;143(1):191-7.
12.
Alteration of NPY and Y1 receptor in dorsomedial and ventromedial areas of hypothalamus in anorectic tumor-bearing rats.
Chance WT, etal., Peptides. 2007 Feb;28(2):295-301. Epub 2007 Jan 17.
13.
Neuropeptide Y protects rat cortical neurons against beta-amyloid toxicity and re-establishes synthesis and release of nerve growth factor.
Croce N, etal., ACS Chem Neurosci. 2012 Apr 18;3(4):312-8. doi: 10.1021/cn200127e. Epub 2012 Jan 30.
14.
Urocortin I inhibits the effects of ghrelin and neuropeptide Y on feeding and energy substrate utilization.
Currie PJ, etal., Brain Res. 2011 Apr 18;1385:127-34. doi: 10.1016/j.brainres.2011.01.114.
15.
The anti-inflammatory effect of neuropeptide Y (NPY) in rats is dependent on dipeptidyl peptidase 4 (DP4) activity and age.
Dimitrijevic M, etal., Peptides. 2008 Dec;29(12):2179-87. doi: 10.1016/j.peptides.2008.08.017. Epub 2008 Sep 3.
16.
Support for involvement of glutamate decarboxylase 1 and neuropeptide y in anxiety susceptibility.
Donner J, etal., Am J Med Genet B Neuropsychiatr Genet. 2012 Apr;159B(3):316-27. doi: 10.1002/ajmg.b.32029. Epub 2012 Feb 10.
17.
The role of neuropeptide Y and aquaporin 4 in the pathogenesis of intestinal dysfunction caused by traumatic brain injury.
Duan H, etal., J Surg Res. 2013 Oct;184(2):1006-12. doi: 10.1016/j.jss.2013.03.096. Epub 2013 Apr 18.
18.
Endogenous neuropeptide Y prevents recurrence of experimental febrile seizures by increasing seizure threshold.
Dube C, etal., J Mol Neurosci. 2005;25(3):275-84.
19.
Long-term valproate treatment increases brain neuropeptide Y expression and decreases seizure expression in a genetic rat model of absence epilepsy.
Elms J, etal., PLoS One. 2013 Sep 9;8(9):e73505. doi: 10.1371/journal.pone.0073505. eCollection 2013.
20.
Neuropeptide Y1 and Y5 receptors mediate the effects of neuropeptide Y on the hypothalamic-pituitary-thyroid axis.
Fekete C, etal., Endocrinology 2002 Dec;143(12):4513-9.
21.
Immunolesion of norepinephrine and epinephrine afferents to medial hypothalamus alters basal and 2-deoxy-D-glucose-induced neuropeptide Y and agouti gene-related protein messenger ribonucleic acid expression in the arcuate nucleus.
Fraley GS and Ritter S, Endocrinology 2003 Jan;144(1):75-83.
22.
Neuropeptide Y level in paraventricular nucleus of experimental diabetic rats: correlation with sympathetic activity and body weight.
Ganguly PK Int J Gen Med. 2010 Oct 5;3:321-5. doi: 10.2147/IJGM.S7749.
23.
Hypothalamic levels of NPY, MCH, and prepro-orexin mRNA during pregnancy and lactation in the rat: role of prolactin.
Garcia MC, etal., FASEB J 2003 Aug;17(11):1392-400.
24.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
25.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
26.
Decreased cerebrospinal fluid neuropeptide Y (NPY) in patients with treatment refractory unipolar major depression: preliminary evidence for association with preproNPY gene polymorphism.
Heilig M, etal., J Psychiatr Res 2004 Mar-Apr;38(2):113-21.
27.
Neuropeptide Y is expressed by rat mononuclear blood leukocytes and strongly down-regulated during inflammation.
Holler J, etal., J Immunol. 2008 Nov 15;181(10):6906-12.
28.
Hypothalamic expression of mutant huntingtin contributes to the development of depressive-like behavior in the BAC transgenic mouse model of Huntington's disease.
Hult Lundh S, etal., Hum Mol Genet. 2013 Sep 1;22(17):3485-97. doi: 10.1093/hmg/ddt203. Epub 2013 May 22.
29.
Early maternal deprivation alters hippocampal levels of neuropeptide Y and calcitonin-gene related peptide in adult rats.
Husum H, etal., Neuropharmacology 2002 May;42(6):798-806.
30.
Neuropeptide y and neuropeptide y y5 receptor interaction restores impaired growth potential of aging bone marrow stromal cells.
Igura K, etal., Rejuvenation Res. 2011 Aug;14(4):393-403. doi: 10.1089/rej.2010.1129. Epub 2011 May 19.
31.
Leucine7 to proline7 polymorphism in the preproneuropeptide Y is associated with the progression of carotid atherosclerosis, blood pressure and serum lipids in Finnish men.
Karvonen MK, etal., Atherosclerosis. 2001 Nov;159(1):145-51.
32.
Localization of quantitative trait loci regulating adjuvant-induced arthritis in rats: evidence for genetic factors common to multiple autoimmune diseases.
Kawahito Y, etal., J Immunol 1998 Oct 15;161(8):4411-9
33.
Changes in neuropeptide Y protein expression following photothrombotic brain infarction and epileptogenesis.
Kharlamov EA, etal., Brain Res. 2007 Jan 5;1127(1):151-62. Epub 2006 Nov 22.
34.
Association of age at onset in Huntington disease with functional promoter variations in NPY and NPY2R.
Kloster E, etal., J Mol Med (Berl). 2014 Feb;92(2):177-84.
35.
Changes in hypothalamic corticotropin-releasing hormone, neuropeptide Y, and proopiomelanocortin gene expression during chronic rapid eye movement sleep deprivation of rats.
Koban M, etal., Endocrinology. 2006 Jan;147(1):421-31. doi: 10.1210/en.2005-0695. Epub 2005 Oct 6.
36.
Plasma neuropeptide Y is reduced in patients with Alzheimer's disease.
Koide S, etal., Neurosci Lett. 1995 Sep 29;198(2):149-51.
37.
Circadian clock gene polymorphisms in alcohol use disorders and alcohol consumption.
Kovanen L, etal., Alcohol Alcohol. 2010 Jul-Aug;45(4):303-11. doi: 10.1093/alcalc/agq035. Epub 2010 Jun 16.
38.
Hypothalamic CART is a new anorectic peptide regulated by leptin.
Kristensen P, etal., Nature. 1998 May 7;393(6680):72-6.
39.
Differential susceptibility of interneurons expressing neuropeptide Y or parvalbumin in the aged hippocampus to acute seizure activity.
Kuruba R, etal., PLoS One. 2011;6(9):e24493. doi: 10.1371/journal.pone.0024493. Epub 2011 Sep 6.
40.
High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.
Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
41.
A functional neuropeptide Y Leu7Pro polymorphism associated with alcohol dependence in a large population sample from the United States.
Lappalainen J, etal., Arch Gen Psychiatry. 2002 Sep;59(9):825-31.
42.
Of mice and men: neuropeptide Y and its receptors are associated with atherosclerotic lesion burden and vulnerability.
Li L, etal., J Cardiovasc Transl Res. 2011 Jun;4(3):351-62. doi: 10.1007/s12265-011-9271-5. Epub 2011 Apr 6.
43.
Decreased NPY innervation of the hypothalamic nuclei in rats with cancer anorexia.
Makarenko IG, etal., Brain Res 2003 Jan 24;961(1):100-8.
44.
Increased neuropeptide Y-like immunoreactivity in cerebrospinal fluid and plasma of human immunodeficiency virus-infected patients: relationship to HIV encephalopathy.
Malessa R, etal., J Neurol Sci. 1996 Mar;136(1-2):154-8.
45.
Neuropeptide Y: identification of a novel rat mRNA splice-variant that is downregulated in the hippocampus and the prefrontal cortex of a depression-like model.
Melas PA, etal., Peptides. 2012 May;35(1):49-55. doi: 10.1016/j.peptides.2012.02.020. Epub 2012 Mar 3.
46.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
47.
Central neuropeptide Y signaling ameliorates N(omega)-nitro-L-arginine methyl ester hypertension in the rat through a Y1 receptor mechanism.
Michalkiewicz M, etal., Hypertension 2005 Apr;45(4):780-5. Epub 2005 Feb 7.
48.
Neuropeptide Y suppresses absence seizures in a genetic rat model primarily through effects on Y receptors.
Morris MJ, etal., Eur J Neurosci. 2007 Feb;25(4):1136-43.
49.
Leptin inhibits hypothalamic Npy and Agrp gene expression via a mechanism that requires phosphatidylinositol 3-OH-kinase signaling.
Morrison CD, etal., Am J Physiol Endocrinol Metab. 2005 Dec;289(6):E1051-7. Epub 2005 Jul 26.
50.
Reduced tissue immigration of monocytes by neuropeptide Y during endotoxemia is associated with Y2 receptor activation.
Nave H, etal., J Neuroimmunol. 2004 Oct;155(1-2):1-12.
51.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
52.
Neuropeptide Y gene therapy decreases chronic spontaneous seizures in a rat model of temporal lobe epilepsy.
Noe F, etal., Brain. 2008 Jun;131(Pt 6):1506-15. doi: 10.1093/brain/awn079. Epub 2008 May 13.
53.
Leu7Pro polymorphism in the neuropeptide Y (NPY) gene is associated with impaired glucose tolerance and type 2 diabetes in Swedish men.
Nordman S, etal., Exp Clin Endocrinol Diabetes. 2005 May;113(5):282-7.
54.
Amelioration of dextran sulfate sodium-induced colitis by neuropeptide Y antisense oligodeoxynucleotide.
Pang XH, etal., Int J Colorectal Dis. 2010 Sep;25(9):1047-53. doi: 10.1007/s00384-010-0964-z. Epub 2010 Jun 5.
55.
Quantitative study of NPY-expressing GABAergic neurons and axons in rat spinal dorsal horn.
Polgar E, etal., J Comp Neurol. 2011 Apr 15;519(6):1007-23. doi: 10.1002/cne.22570.
56.
Leptin regulates appetite-related neuropeptides in the hypothalamus of developing rats without affecting food intake.
Proulx K, etal., Endocrinology 2002 Dec;143(12):4683-92.
57.
Npy deletion in an alcohol non-preferring rat model elicits differential effects on alcohol consumption and body weight.
Qiu B, etal., J Genet Genomics. 2016 Jul 20;43(7):421-30. doi: 10.1016/j.jgg.2016.04.010. Epub 2016 Apr 29.
58.
Nicotine evoked improvement in learning and memory is mediated through NPY Y1 receptors in rat model of Alzheimer's disease.
Rangani RJ, etal., Peptides. 2012 Feb;33(2):317-28. doi: 10.1016/j.peptides.2012.01.004. Epub 2012 Jan 16.
59.
GOA pipeline
RGD automated data pipeline
60.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
61.
Divergent regulation of hypothalamic neuropeptide Y and agouti-related protein by photoperiod in F344 rats with differential food intake and growth.
Ross AW, etal., J Neuroendocrinol. 2009 Jul;21(7):610-9. Epub 2009 Apr 13.
62.
A biometrical genome search in rats reveals the multigenic basis of blood pressure variation.
Schork NJ, etal., Genome Res 1995 Sep;5(2):164-72
63.
Testosterone (T)-induced changes in arcuate nucleus cocaine-amphetamine-regulated transcript and NPY mRNA are attenuated in old compared to young male brown Norway rats: contribution of T to age-related changes in cocaine-amphetamine-regulated transcript and NPY gene expression.
Sohn EH, etal., Endocrinology 2002 Mar;143(3):954-63.
64.
Hippocampal NPY gene transfer attenuates seizures without affecting epilepsy-induced impairment of LTP.
Sorensen AT, etal., Exp Neurol. 2009 Feb;215(2):328-33. doi: 10.1016/j.expneurol.2008.10.015. Epub 2008 Nov 10.
65.
Neuropeptide Y infusion into the shell region of the rat nucleus accumbens increases extracellular levels of dopamine.
Sorensen G, etal., Neuroreport. 2009 Jul 15;20(11):1023-6.
66.
Effect of polymorphism on expression of the neuropeptide Y gene in inbred alcohol-preferring and -nonpreferring rats.
Spence JP, etal., Neuroscience 2005;131(4):871-6.
67.
Regulation of KIF1A-Driven Dense Core Vesicle Transport: Ca2+/CaM Controls DCV Binding and Liprin-α/TANC2 Recruits DCVs to Postsynaptic Sites.
Stucchi R, etal., Cell Rep. 2018 Jul 17;24(3):685-700. doi: 10.1016/j.celrep.2018.06.071.
68.
Identification of genomic regions controlling experimental autoimmune uveoretinitis in rats.
Sun SH, etal., Int Immunol 1999 Apr;11(4):529-34
69.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
70.
Neuropeptide Y receptor Y2 gene polymorphism interacts with plasma neuropeptide Y levels in predicting left ventricular hypertrophy in dialysis patients.
Testa A, etal., J Hypertens. 2010 Aug;28(8):1745-51.
71.
Ultrastructural Characterization of Corticotropin-Releasing Factor and Neuropeptide Y in the Rat Locus Coeruleus: Anatomical Evidence for Putative Interactions.
Theisen CC, etal., Neuroscience. 2018 Aug 1;384:21-40. doi: 10.1016/j.neuroscience.2018.04.043. Epub 2018 May 22.
72.
Behavioral insensitivity to restraint stress, absent fear suppression of behavior and impaired spatial learning in transgenic rats with hippocampal neuropeptide Y overexpression.
Thorsell A, etal., Proc Natl Acad Sci U S A 2000 Nov 7;97(23):12852-7.
73.
Neuropeptide Y modulates c-Fos protein expression in the cuneate nucleus and contributes to mechanical hypersensitivity following rat median nerve injury.
Tsai YJ, etal., J Neurotrauma. 2009 Sep;26(9):1609-21. doi: 10.1089/neu.2008.0642.
74.
Overpressure blast-wave induced brain injury elevates oxidative stress in the hypothalamus and catecholamine biosynthesis in the rat adrenal medulla.
Tumer N, etal., Neurosci Lett. 2013 Jun 7;544:62-7. doi: 10.1016/j.neulet.2013.03.042. Epub 2013 Apr 6.
75.
Involvement of neuropeptide Y in the acute, chronic and withdrawal responses of morphine in nociception in neuropathic rats: behavioral and neuroanatomical correlates.
Upadhya MA, etal., Neuropeptides. 2009 Aug;43(4):303-14. doi: 10.1016/j.npep.2009.05.003. Epub 2009 Jun 24.
76.
Difference of NPY and its receptor gene expressions between obesity and obesity-resistant rats in response to high-fat diet.
Wang C, etal., Horm Metab Res. 2007 Apr;39(4):262-7.
77.
Activation of neuropeptide Y Y1 receptors inhibits glutamate release through reduction of voltage-dependent Ca2+ entry in the rat cerebral cortex nerve terminals: suppression of this inhibitory effect by the protein kinase C-dependent facilitatory pathway.
Wang SJ, Neuroscience. 2005;134(3):987-1000. doi: 10.1016/j.neuroscience.2005.04.053.
78.
Localization in rats of genetic loci regulating susceptibility to experimental erosive arthritis and related autoimmune diseases.
Wilder RL, etal., Transplant Proc 1999 May;31(3):1585-8
79.
Transcellular induction of neuropeptide Y expression by NT4 and BDNF.
Wirth MJ, etal., Proc Natl Acad Sci U S A. 2005 Feb 22;102(8):3064-9. Epub 2005 Feb 9.
80.
Zhongguo wei zhong bing ji jiu yi xue = Chinese critical care medicine = Zhongguo weizhongbing jijiuyixue
Xu ZQ, etal., Zhongguo Wei Zhong Bing Ji Jiu Yi Xue. 2004 Apr;16(4):218-20.
81.
Expression, physiological action, and coexpression patterns of neuropeptide Y in rat taste-bud cells.
Zhao FL, etal., Proc Natl Acad Sci U S A. 2005 Aug 2;102(31):11100-5. Epub 2005 Jul 22.
82.
[Number changes and axonal sprouting of neuropeptide Y interneurons in the hippocampus of pilocarpine-induced rats].
Zhiguo W, etal., Zhong Nan Da Xue Xue Bao Yi Xue Ban. 2009 Feb;34(2):93-8.
Npy Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 80,212,111 - 80,219,310 (+) NCBI GRCr8 mRatBN7.2 4 78,881,294 - 78,888,495 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 78,881,264 - 78,888,495 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 84,098,422 - 84,105,619 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 79,873,911 - 79,881,112 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 78,314,242 - 78,321,437 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 79,557,856 - 79,565,059 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 79,573,998 - 79,581,208 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 79,557,854 - 79,565,097 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 144,233,753 - 144,240,956 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 78,038,013 - 78,045,187 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 78,314,142 - 78,321,317 (+) NCBI Celera 4 73,795,148 - 73,802,371 (+) NCBI Celera RH 3.4 Map 4 508.6 RGD RH 3.4 Map 4 507.8 RGD Cytogenetic Map 4 q24 NCBI
NPY Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 7 24,284,190 - 24,291,862 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 7 24,284,188 - 24,291,862 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 7 24,323,809 - 24,331,481 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 7 24,290,334 - 24,298,002 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 7 24,097,048 - 24,104,717 NCBI Celera 7 24,312,617 - 24,320,302 (+) NCBI Celera Cytogenetic Map 7 p15.3 NCBI HuRef 7 24,208,802 - 24,216,490 (+) NCBI HuRef CHM1_1 7 24,325,406 - 24,333,092 (+) NCBI CHM1_1 T2T-CHM13v2.0 7 24,422,184 - 24,429,876 (+) NCBI T2T-CHM13v2.0 CRA_TCAGchr7v2 7 24,375,683 - 24,383,371 (+) NCBI
Npy Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 49,799,690 - 49,806,487 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 49,799,690 - 49,806,487 (+) Ensembl GRCm39 Ensembl GRCm38 6 49,822,710 - 49,829,507 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 49,822,710 - 49,829,507 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 49,772,728 - 49,779,506 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 49,752,315 - 49,759,093 (+) NCBI MGSCv36 mm8 Celera 6 50,334,213 - 50,340,981 (+) NCBI Celera Cytogenetic Map 6 B2.3 NCBI cM Map 6 24.04 NCBI
Npy Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955410 26,348,504 - 26,355,297 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955410 26,348,388 - 26,355,232 (+) NCBI ChiLan1.0 ChiLan1.0
NPY Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 6 29,145,106 - 29,152,854 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 7 77,469,833 - 77,477,581 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 7 24,963,056 - 24,970,803 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 7 24,566,963 - 24,574,657 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 7 24,568,041 - 24,574,657 (+) Ensembl panpan1.1 panPan2
NPY Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 14 37,824,579 - 37,831,289 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 14 37,823,861 - 37,831,443 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 14 37,373,133 - 37,380,851 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 14 37,758,052 - 37,765,788 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 14 37,758,938 - 37,765,943 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 14 37,872,113 - 37,879,841 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 14 37,564,477 - 37,572,202 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 14 37,908,665 - 37,916,390 (+) NCBI UU_Cfam_GSD_1.0
Npy Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 82,077,623 - 82,085,085 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936478 1,290,505 - 1,296,874 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936478 1,289,437 - 1,296,819 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
NPY Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 18 47,985,725 - 47,992,667 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 18 47,985,796 - 47,993,726 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 18 52,929,745 - 52,937,666 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
NPY Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 21 34,068,533 - 34,076,205 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 21 34,068,530 - 34,075,127 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666042 70,564,869 - 70,572,551 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Npy
.
Predicted Target Of
Count of predictions: 127 Count of miRNA genes: 106 Interacting mature miRNAs: 110 Transcripts: ENSRNOT00000013145 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
1358352 Srcrt3 Stress Responsive Cort QTL 3 2.29 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 38465774 146803430 Rat 1549843 Bw53 Body weight QTL 53 0.0001 body mass (VT:0001259) body weight gain (CMO:0000420) 4 61697658 103194791 Rat 61445 Strs3 Sensitivity to stroke QTL 3 3 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 4 40433388 85433388 Rat 6893678 Bw108 Body weight QTL 108 2.6 0.006 body mass (VT:0001259) body weight (CMO:0000012) 4 43457976 88457976 Rat 10755501 Bp390 Blood pressure QTL 390 2.5 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 4 26775591 168368347 Rat 1357342 Bw40 Body weight QTL 40 0.001 body mass (VT:0001259) body weight (CMO:0000012) 4 76647384 117676292 Rat 631556 Bp135 Blood pressure QTL 135 0.017 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 78881294 117676292 Rat 1358363 Sradr3 Stress Responsive Adrenal Weight QTL 3 6.19 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 4 57486946 102486946 Rat 61330 Eau1 Experimental allergic uveoretinitis QTL 1 0.0003 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 4 70362013 132642728 Rat 70167 Bw22 Body weight QTL 22 3.1 body mass (VT:0001259) body weight (CMO:0000012) 4 76647384 117676292 Rat 61336 Bp21 Blood pressure QTL 21 4.6 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 57114705 78881294 Rat 1549839 Bw52 Body weight QTL 52 0.0001 body mass (VT:0001259) body weight gain (CMO:0000420) 4 61697658 115089733 Rat 724522 Bp146 Blood pressure QTL 146 2.2 0.0021 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 73630210 118630210 Rat 8694439 Bw168 Body weight QTL 168 9.57 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 4 40433414 85433414 Rat 8655906 Rf60 Renal function QTL 60 3.8 blood creatinine amount (VT:0005328) creatinine clearance (CMO:0000765) 4 29494195 81006281 Rat 1354660 Salc1 Saline consumption QTL 1 11.26 drinking behavior trait (VT:0001422) saline drink intake rate (CMO:0001627) 4 44463908 148090542 Rat 2300179 Bmd50 Bone mineral density QTL 50 5.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 4 60928534 105928534 Rat 1298082 Stresp4 Stress response QTL 4 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 50119848 146803430 Rat 70192 BpQTLcluster5 Blood pressure QTL cluster 5 4.183 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 4 62933508 114921294 Rat 2317586 Eae25 Experimental allergic encephalomyelitis QTL 25 9.300000190734863 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis duration (CMO:0001424) 4 78882817 83007655 Rat 61364 Iddm2 Insulin dependent diabetes mellitus QTL 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 78885890 102684881 Rat 1300139 Hrtrt6 Heart rate QTL 6 2.85 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 39524264 116179656 Rat 70200 Alc18 Alcohol consumption QTL 18 9.2 drinking behavior trait (VT:0001422) ethanol intake volume to total fluid intake volume ratio (CMO:0001591) 4 56647873 149491524 Rat 1578657 Bss12 Bone structure and strength QTL 12 8.9 femur morphology trait (VT:0000559) femoral neck cross-sectional area (CMO:0001697) 4 60220938 105220938 Rat 1578658 Bss13 Bone structure and strength QTL 13 8 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 4 60220938 105220938 Rat 4889969 Bss96 Bone structure and strength QTL 96 4.9 tibia size trait (VT:0100001) tibia cortical bone volume (CMO:0001725) 4 56647776 78882945 Rat 2316958 Gluco58 Glucose level QTL 58 10 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 11320076 180699135 Rat 4889972 Bss97 Bone structure and strength QTL 97 5.6 tibia size trait (VT:0100001) tibia total bone volume (CMO:0001724) 4 56647776 78882945 Rat 6478684 Anxrr30 Anxiety related response QTL 30 0.00087 defecation behavior trait (VT:0010462) defecation rate (CMO:0000998) 4 62753847 107753847 Rat 2302051 Pia28 Pristane induced arthritis QTL 28 5.3 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112) 4 73630210 118630210 Rat 5685012 Bmd87 Bone mineral density QTL 87 5.1 tibia mineral mass (VT:1000283) bone mineral content (CMO:0001554) 4 56647776 78882945 Rat 5685009 Bmd86 Bone mineral density QTL 86 3.7 tibia mineral mass (VT:1000283) bone mineral density (CMO:0001226) 4 56647776 78882945 Rat 8552782 Vie1 Viral induced encephalitis QTL 1 26.4 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 4 34430484 82490359 Rat 634311 Sach7 Saccharin preference QTL 7 taste sensitivity trait (VT:0001986) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 4 57114432 81266970 Rat 738009 Sach4 Saccharine consumption QTL 4 4.9 0.000016 consumption behavior trait (VT:0002069) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 4 59948935 154902892 Rat 631261 Tcas3 Tongue tumor susceptibility QTL 3 6.88 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 4 10814170 91360527 Rat 2312567 Glom19 Glomerulus QTL 19 1.9 0.006 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 4 45456990 146803430 Rat 6478772 Anxrr49 Anxiety related response QTL 49 0.15488 defecation behavior trait (VT:0010462) defecation rate (CMO:0000998) 4 62753847 107753847 Rat 631646 Stl4 Serum triglyceride level QTL 4 6.5 0.0001 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 4 73169846 132642728 Rat 2312569 Pur19 Proteinuria QTL 19 3.4 0.001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 4 65882107 96130297 Rat 8655961 Kidm43 Kidney mass QTL 43 18 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 4 36303261 103194984 Rat 1354612 Foco1 Food consumption QTL 1 8.87 eating behavior trait (VT:0001431) food intake rate (CMO:0000427) 4 44463908 148090542 Rat 634344 Hcar7 Hepatocarcinoma resistance QTL 7 7.8 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 4 70808386 115808386 Rat 2303168 Bp330 Blood pressure QTL 330 4.25 0.017 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 5214602 146446691 Rat 8552801 Bw143 Body weight QTL 143 7.3 body mass (VT:0001259) change in body weight to body weight ratio (CMO:0002216) 4 34430484 82490359 Rat 738031 Alc14 Alcohol consumption QTL 14 7.6 0.00003 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 8552807 Vie4 Viral induced encephalitis QTL 4 7.3 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 4 62933508 82490359 Rat 631662 Hcar2 Hepatocarcinoma resistance QTL 2 3.1 0.0003 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 4 78878504 123878504 Rat 619616 Bp79 Blood pressure QTL 79 0.0292 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 5214602 78882945 Rat 1576305 Emca6 Estrogen-induced mammary cancer QTL 6 5.8 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 4 44463720 155883716 Rat 61418 Pia5 Pristane induced arthritis QTL 5 4.5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 62277855 128289560 Rat 631651 Bp124 Blood pressure QTL 124 3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 62879517 107879517 Rat 8552809 Vie5 Viral induced encephalitis QTL 5 25.3 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 4 34430484 82490359 Rat 738016 Alc16 Alcohol consumption QTL 16 3.6 0.00015 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1558651 Swd3 Spike wave discharge measurement QTL 3 4.62 0.000024 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge frequency (CMO:0001742) 4 58432133 92991462 Rat 1641833 Alc21 Alcohol consumption QTL 21 8.6 0.0001 drinking behavior trait (VT:0001422) ethanol drink intake rate (CMO:0001407) 4 56698790 126192555 Rat 631546 Bp86 Blood pressure QTL 86 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 57114432 91360801 Rat 631674 Iddm14 Insulin dependent diabetes mellitus QTL 14 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 4 64528739 157573521 Rat 6478743 Anxrr40 Anxiety related response QTL 40 0.83076 defecation behavior trait (VT:0010462) defecation rate (CMO:0000998) 4 62753847 107753847 Rat 7394826 Bw126 Body weight QTL 126 0.002 body mass (VT:0001259) body weight gain (CMO:0000420) 4 62933269 87483707 Rat 12798520 Anxrr55 Anxiety related response QTL 55 4.45 0.01 locomotor behavior trait (VT:0001392) number of rearing movements with lid-pushing in an experimental apparatus (CMO:0002715) 4 32583980 114627242 Rat 631671 Iddm11 Insulin dependent diabetes mellitus QTL 11 3.6 0.0012 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 4 58635877 78886137 Rat
D4Wox21
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 4 80,213,634 - 80,213,769 (+) Marker Load Pipeline mRatBN7.2 4 78,882,817 - 78,882,954 (+) MAPPER mRatBN7.2 Rnor_6.0 4 79,575,534 - 79,575,667 NCBI Rnor6.0 Rnor_6.0 4 79,559,380 - 79,559,514 NCBI Rnor6.0 Rnor_5.0 4 144,235,277 - 144,235,411 UniSTS Rnor5.0 Rnor_5.0 4 144,249,326 - 144,249,459 UniSTS Rnor5.0 RGSC_v3.4 4 78,039,510 - 78,039,646 UniSTS RGSC3.4 RGSC_v3.4 4 78,039,509 - 78,039,646 RGD RGSC3.4 RGSC_v3.1 4 78,315,639 - 78,315,776 RGD Celera 4 73,796,672 - 73,796,816 UniSTS RH 3.4 Map 4 504.2 UniSTS RH 3.4 Map 4 504.2 RGD RH 2.0 Map 4 547.5 RGD Cytogenetic Map 4 q24 UniSTS
D4Hri1
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 4 80,213,634 - 80,213,760 (+) Marker Load Pipeline mRatBN7.2 4 78,882,817 - 78,882,945 (+) MAPPER mRatBN7.2 Rnor_6.0 4 79,575,534 - 79,575,658 NCBI Rnor6.0 Rnor_6.0 4 79,559,380 - 79,559,505 NCBI Rnor6.0 Rnor_5.0 4 144,235,277 - 144,235,402 UniSTS Rnor5.0 Rnor_5.0 4 144,249,326 - 144,249,450 UniSTS Rnor5.0 RGSC_v3.4 4 78,039,510 - 78,039,637 UniSTS RGSC3.4 RGSC_v3.4 4 78,039,509 - 78,039,637 RGD RGSC3.4 Celera 4 73,796,672 - 73,796,807 UniSTS Cytogenetic Map 4 q24 UniSTS
D4Mgh4
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 78,878,504 - 78,878,711 (+) MAPPER mRatBN7.2 Rnor_6.0 4 79,570,971 - 79,571,177 NCBI Rnor6.0 Rnor_6.0 4 79,555,067 - 79,555,273 NCBI Rnor6.0 Rnor_5.0 4 144,230,964 - 144,231,170 UniSTS Rnor5.0 Rnor_5.0 4 144,244,763 - 144,244,969 UniSTS Rnor5.0 RGSC_v3.4 4 78,035,196 - 78,035,403 RGD RGSC3.4 RGSC_v3.4 4 78,035,197 - 78,035,403 UniSTS RGSC3.4 RGSC_v3.1 4 78,311,326 - 78,311,533 RGD Celera 4 73,792,358 - 73,792,564 UniSTS RH 3.4 Map 4 504.3 UniSTS RH 3.4 Map 4 504.3 RGD RH 2.0 Map 4 551.7 RGD SHRSP x BN Map 4 37.38 RGD FHH x ACI Map 4 46.9099 RGD Cytogenetic Map 4 q24 UniSTS
D4Wox22
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 4 80,216,804 - 80,216,952 (+) Marker Load Pipeline mRatBN7.2 4 78,885,989 - 78,886,137 (+) MAPPER mRatBN7.2 Rnor_6.0 4 79,578,703 - 79,578,854 NCBI Rnor6.0 Rnor_6.0 4 79,562,550 - 79,562,701 NCBI Rnor6.0 Rnor_5.0 4 144,238,447 - 144,238,598 UniSTS Rnor5.0 Rnor_5.0 4 144,252,495 - 144,252,646 UniSTS Rnor5.0 RGSC_v3.4 4 78,042,682 - 78,042,833 UniSTS RGSC3.4 RGSC_v3.4 4 78,042,681 - 78,042,833 RGD RGSC3.4 RGSC_v3.1 4 78,318,811 - 78,318,963 RGD Celera 4 73,799,852 - 73,800,013 UniSTS RH 3.4 Map 4 508.4 UniSTS RH 3.4 Map 4 508.4 RGD RH 2.0 Map 4 543.9 RGD Cytogenetic Map 4 q24 UniSTS
D4Arb7
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 4 80,216,682 - 80,216,972 (+) Marker Load Pipeline mRatBN7.2 4 78,885,867 - 78,886,157 (+) MAPPER mRatBN7.2 Rnor_6.0 4 79,562,428 - 79,562,721 NCBI Rnor6.0 Rnor_6.0 4 79,578,581 - 79,578,874 NCBI Rnor6.0 Rnor_5.0 4 144,252,373 - 144,252,666 UniSTS Rnor5.0 Rnor_5.0 4 144,238,325 - 144,238,618 UniSTS Rnor5.0 RGSC_v3.4 4 78,042,559 - 78,042,853 RGD RGSC3.4 RGSC_v3.4 4 78,042,560 - 78,042,853 UniSTS RGSC3.4 RGSC_v3.1 4 78,318,689 - 78,318,983 RGD Celera 4 73,799,730 - 73,800,033 UniSTS FHH x ACI Map 4 46.9099 RGD FHH x ACI Map 4 46.9099 UniSTS Cytogenetic Map 4 q24 UniSTS
D4Mit7
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 4 80,216,705 - 80,217,004 (+) Marker Load Pipeline mRatBN7.2 4 78,885,890 - 78,886,189 (+) MAPPER mRatBN7.2 Rnor_6.0 4 79,562,451 - 79,562,753 RGD Rnor6.0
D4Mit24
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 78,882,815 - 78,882,945 (+) MAPPER mRatBN7.2 Rnor_6.0 4 79,575,532 - 79,575,658 NCBI Rnor6.0 Rnor_6.0 4 79,559,378 - 79,559,505 NCBI Rnor6.0 Rnor_5.0 4 144,235,275 - 144,235,402 UniSTS Rnor5.0 Rnor_5.0 4 144,249,324 - 144,249,450 UniSTS Rnor5.0 RGSC_v3.4 4 78,039,507 - 78,039,637 RGD RGSC3.4 RGSC_v3.4 4 78,039,508 - 78,039,637 UniSTS RGSC3.4 RGSC_v3.1 4 78,315,637 - 78,315,767 RGD Celera 4 73,796,670 - 73,796,807 UniSTS RH 3.4 Map 4 500.0 RGD RH 3.4 Map 4 500.0 UniSTS RH 2.0 Map 4 554.5 RGD Cytogenetic Map 4 q24 UniSTS
D4Arb35
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 4 80,213,632 - 80,213,779 (+) Marker Load Pipeline mRatBN7.2 4 78,882,815 - 78,882,964 (+) MAPPER mRatBN7.2 Rnor_6.0 4 79,559,378 - 79,559,524 NCBI Rnor6.0 Rnor_6.0 4 79,575,532 - 79,575,677 NCBI Rnor6.0 Rnor_5.0 4 144,249,324 - 144,249,469 UniSTS Rnor5.0 Rnor_5.0 4 144,235,275 - 144,235,421 UniSTS Rnor5.0 RGSC_v3.4 4 78,039,507 - 78,039,656 RGD RGSC3.4 RGSC_v3.4 4 78,039,508 - 78,039,656 UniSTS RGSC3.4 RGSC_v3.1 4 78,315,637 - 78,315,786 RGD Celera 4 73,796,670 - 73,796,826 UniSTS FHH x ACI Map 4 46.34 RGD FHH x ACI Map 4 46.34 UniSTS Cytogenetic Map 4 q24 UniSTS
D14Mit29
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 4 80,216,705 - 80,217,004 (+) Marker Load Pipeline mRatBN7.2 4 78,885,890 - 78,886,189 (+) MAPPER mRatBN7.2 Rnor_6.0 4 79,562,451 - 79,562,753 NCBI Rnor6.0 Rnor_6.0 4 79,578,604 - 79,578,906 NCBI Rnor6.0 Rnor_5.0 4 144,252,396 - 144,252,698 UniSTS Rnor5.0 Rnor_5.0 4 144,238,348 - 144,238,650 UniSTS Rnor5.0 RGSC_v3.4 4 78,042,583 - 78,042,885 UniSTS RGSC3.4 Celera 4 73,799,753 - 73,800,065 UniSTS Cytogenetic Map 4 q24 UniSTS
RH94804
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 78,886,166 - 78,886,421 (+) MAPPER mRatBN7.2 Rnor_6.0 4 79,578,884 - 79,579,138 NCBI Rnor6.0 Rnor_6.0 4 79,562,731 - 79,562,985 NCBI Rnor6.0 Rnor_5.0 4 144,252,676 - 144,252,930 UniSTS Rnor5.0 Rnor_5.0 4 144,238,628 - 144,238,882 UniSTS Rnor5.0 RGSC_v3.4 4 78,042,863 - 78,043,117 UniSTS RGSC3.4 Celera 4 73,800,043 - 73,800,297 UniSTS RH 3.4 Map 4 508.6 UniSTS Cytogenetic Map 4 q24 UniSTS
D14Mit29.1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 78,885,833 - 78,885,943 (+) MAPPER mRatBN7.2 Rnor_6.0 4 79,578,547 - 79,578,656 NCBI Rnor6.0 Rnor_6.0 4 79,562,394 - 79,562,503 NCBI Rnor6.0 Rnor_5.0 4 144,238,291 - 144,238,400 UniSTS Rnor5.0 Rnor_5.0 4 144,252,339 - 144,252,448 UniSTS Rnor5.0 RGSC_v3.4 4 78,042,526 - 78,042,635 UniSTS RGSC3.4 Celera 4 73,799,696 - 73,799,805 UniSTS Cytogenetic Map 4 q24 UniSTS
RH94574
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 4 80,219,176 - 80,219,275 (+) Marker Load Pipeline mRatBN7.2 4 78,888,361 - 78,888,460 (+) MAPPER mRatBN7.2 Rnor_6.0 4 79,564,926 - 79,565,024 NCBI Rnor6.0 Rnor_6.0 4 79,581,079 - 79,581,177 NCBI Rnor6.0 Rnor_5.0 4 144,254,871 - 144,254,969 UniSTS Rnor5.0 Rnor_5.0 4 144,240,823 - 144,240,921 UniSTS Rnor5.0 RGSC_v3.4 4 78,045,058 - 78,045,156 UniSTS RGSC3.4 Celera 4 73,802,238 - 73,802,336 UniSTS Cytogenetic Map 4 q24 UniSTS
This gene Npy is modified in the following models/strains:
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
12
12
77
67
59
35
13
35
12
113
49
53
17
28
24
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000013145 ⟹ ENSRNOP00000013146
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 4 79,557,854 - 79,565,097 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000074351 ⟹ ENSRNOP00000066713
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 78,881,264 - 78,888,495 (+) Ensembl Rnor_6.0 Ensembl 4 79,573,998 - 79,581,208 (+) Ensembl
RefSeq Acc Id:
NM_012614 ⟹ NP_036746
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 80,212,111 - 80,219,310 (+) NCBI mRatBN7.2 4 78,881,294 - 78,888,495 (+) NCBI Rnor_6.0 4 79,557,856 - 79,565,059 (+) NCBI Rnor_5.0 4 144,233,753 - 144,240,956 (+) NCBI RGSC_v3.4 4 78,038,013 - 78,045,187 (+) RGD Celera 4 73,795,148 - 73,802,371 (+) NCBI
Sequence:
GACCCGCTCTACGCATCCCACCGGTGGAGCTCATTCCTCGCAGAGGCGCCCAGAGCAGAGCACCCGCTGCGCAGAGACCACAGCCCGCCCGCCATGATGCTAGGTAACAAACGAATGGGGCTGTGTGG
hide sequence
RefSeq Acc Id:
NP_036746 ⟸ NM_012614
- Peptide Label:
preproprotein
- UniProtKB:
P07808 (UniProtKB/Swiss-Prot), F2W8A6 (UniProtKB/TrEMBL), M0RAZ3 (UniProtKB/TrEMBL), F2W8A7 (UniProtKB/TrEMBL)
- Sequence:
MMLGNKRMGLCGLTLALSLLVCLGILAEGYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENAPRTRLEDPSMW
hide sequence
Ensembl Acc Id:
ENSRNOP00000013146 ⟸ ENSRNOT00000013145
Ensembl Acc Id:
ENSRNOP00000066713 ⟸ ENSRNOT00000074351
RGD ID: 13693045 Promoter ID: EPDNEW_R3565 Type: single initiation site Name: Npy_1 Description: neuropeptide Y SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 4 79,574,024 - 79,574,084 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2021-03-09
Npy
neuropeptide Y
LOC100912228
pro-neuropeptide Y-like
Data merged from RGD:6487865
737654 PROVISIONAL
2012-07-05
LOC100912228
pro-neuropeptide Y-like
Symbol and Name status set to provisional
70820 PROVISIONAL
2002-06-10
Npy
Neuropeptide Y
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_expression
present in the hypothalamus of obese rats, especially in the paraventricular nucleus
70437
gene_expression
abundant in central and peripheral nervous system
628512
gene_expression
expressed throughout nervous system; increased expression in brain areas undergoing seizures
628420
gene_function
hypothalamic-derived neuropeptide
628420
gene_function
hypothalamic-derived neuropeptide
628512
gene_function
inhibitory neurotransmitter that controls blood pressure
1357410
gene_other
exogenous Npy has long-lasting effects on postsynaptic current amplitude in neocortex
628420
gene_physical_interaction
binds to G protein coupled pancreatic polypeptide (Pp) receptors Y1,Y2 and Y5
628420
gene_process
regulates appetite
70437
gene_process
activates G-protein coupled receptors
70437
gene_process
may function as an endogenous antiepileptic agent
628512
gene_process
involved in energy homeostasis
628420
gene_process
may be involved in modulation of Ca2+ dependent GABA release onto pyramidal neurons
628420
gene_process
involved in modulation of feeding behaviour, anxiety, memory consolidation, and regulation of blood pressure; may decrease excitatory postsynaptic current and increase monosynaptic inhibitory postsynaptic current
628420
gene_process
mediates effects of leptin on energy homeostasis; may influence hypothalamic-pituitary-thyroid axis (HPT axis)
628420
gene_process
mediates the control of stress and fear related behavior
1357416
gene_regulation
decrease in hypothalamic NPY innervation observed in anorectic TB rats
727497
gene_transcript
polymorphism at position +4666 defined by microsatellite marker D4Mit7, contributes to reduced levels of mRNA expression in brain regions of alcohol preferring (iP) rats
1357412
