Symbol:
Lipe
Name:
lipase E, hormone sensitive type
RGD ID:
3010
Description:
Enables lipase activity and retinyl-palmitate esterase activity. Involved in female pregnancy; response to xenobiotic stimulus; and triglyceride catabolic process. Located in extracellular space. Used to study arteriosclerosis and heart disease. Biomarker of obesity. Human ortholog(s) of this gene implicated in familial partial lipodystrophy type 6 and hypertension. Orthologous to human LIPE (lipase E, hormone sensitive type); PARTICIPATES IN insulin signaling pathway; INTERACTS WITH (+)-catechin; (R)-adrenaline; (S)-nicotine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
Hormone - sensitive lipase testicular isoform; hormone-sensitive lipase; HSL; lipase E; lipase E, hormone sensitive; lipase hormone sensitive; lipase, hormone sensitive; monoacylglycerol lipase LIPE; REH; retinyl ester hydrolase
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
LIPE (lipase E, hormone sensitive type) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Lipe (lipase, hormone sensitive) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Lipe (lipase E, hormone sensitive type) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
LIPE (lipase E, hormone sensitive type) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
LIPE (lipase E, hormone sensitive type) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Lipe (lipase E, hormone sensitive type) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
LIPE (lipase E, hormone sensitive type) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
LIPE (lipase E, hormone sensitive type) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Lipe (lipase E, hormone sensitive type) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Lipe (lipase, hormone sensitive)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
LIPE (lipase E, hormone sensitive type)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
lipeb (lipase, hormone-sensitive b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
lipea (lipase, hormone-sensitive a)
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
hosl-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Hsl
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
lipe
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Allele / Splice:
Lipem1Mcwi
Lipem2Mcwi
Genetic Models:
FHH-Lipem1Mcwi
BN-Lipem2Mcwi
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 90,093,433 - 90,112,117 (-) NCBI GRCr8 mRatBN7.2 1 80,965,612 - 80,984,313 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 80,965,627 - 80,984,310 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 86,357,834 - 86,376,510 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 94,909,045 - 94,927,749 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 88,113,613 - 88,132,294 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 82,248,031 - 82,266,727 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 82,248,046 - 82,266,727 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 83,511,504 - 83,530,200 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 80,663,791 - 80,682,480 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 80,741,901 - 80,760,591 (-) NCBI Celera 1 75,407,246 - 75,425,931 (-) NCBI Celera Cytogenetic Map 1 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Lipe Rat (+)-catechin multiple interactions EXP 6480464 Catechin inhibits the reaction [Dietary Fats results in decreased expression of LIPE mRNA] CTD PMID:23365609 Lipe Rat (25R)-cholest-5-ene-3beta,26-diol multiple interactions ISO Lipe (Mus musculus) 6480464 LIPE protein promotes the reaction [27-hydroxycholesterol results in increased expression of STAR mRNA] and LIPE protein promotes the reaction [27-hydroxycholesterol results in increased expression of STAR protein] CTD PMID:23362264 Lipe Rat (R)-adrenaline multiple interactions ISO LIPE (Homo sapiens) 6480464 Theophylline inhibits the reaction [Epinephrine results in increased activity of LIPE protein] CTD PMID:7155675 Lipe Rat (R)-adrenaline increases expression ISO Lipe (Mus musculus) 6480464 Epinephrine results in increased expression of LIPE mRNA CTD PMID:10777495 Lipe Rat (R)-adrenaline affects localization EXP 6480464 Epinephrine affects the localization of LIPE protein CTD PMID:11160373 Lipe Rat (R)-adrenaline increases activity ISO LIPE (Homo sapiens) 6480464 Epinephrine results in increased activity of LIPE protein CTD PMID:7155675 Lipe Rat (R)-lipoic acid multiple interactions ISO Lipe (Mus musculus) 6480464 N-(2-(4-bromocinnamylamino)ethyl)-5-isoquinolinesulfonamide inhibits the reaction [Thioctic Acid results in increased phosphorylation of LIPE protein] CTD PMID:22941773 Lipe Rat (R)-lipoic acid increases phosphorylation ISO Lipe (Mus musculus) 6480464 Thioctic Acid results in increased phosphorylation of LIPE protein CTD PMID:22941773 Lipe Rat (S)-nicotine decreases expression EXP 6480464 Nicotine results in decreased expression of LIPE mRNA CTD PMID:29155039 Lipe Rat 1,2-dimethylhydrazine increases expression ISO Lipe (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of LIPE mRNA CTD PMID:22206623 Lipe Rat 17beta-estradiol multiple interactions ISO Lipe (Mus musculus) 6480464 [Polyphenols co-treated with Estradiol] results in decreased expression of LIPE mRNA CTD PMID:30077407 Lipe Rat 17beta-estradiol multiple interactions ISO LIPE (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in decreased expression of LIPE mRNA CTD PMID:30165855 Lipe Rat 17beta-estradiol decreases expression ISO Lipe (Mus musculus) 6480464 Estradiol results in decreased expression of LIPE mRNA CTD PMID:30077407 Lipe Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Lipe (Mus musculus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Tetrachlorodibenzodioxin co-treated with 2 more ... CTD PMID:30722647 Lipe Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Lipe (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Lipe Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of LIPE mRNA CTD PMID:19490992 and PMID:34747641 Lipe Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of LIPE mRNA CTD PMID:33387578 Lipe Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of LIPE mRNA CTD PMID:32109520 Lipe Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Lipe (Mus musculus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Tetrachlorodibenzodioxin co-treated with 2 more ... CTD PMID:30722647 Lipe Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Lipe (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of LIPE mRNA CTD PMID:26290441 and PMID:28238261 Lipe Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of LIPE mRNA CTD PMID:21346803 Lipe Rat 2-amino-2-deoxy-D-glucopyranose 6-phosphate increases expression ISO Lipe (Mus musculus) 6480464 glucosamine 6-phosphate results in increased expression of LIPE mRNA CTD PMID:19427183 Lipe Rat 26-hydroxycholesterol multiple interactions ISO Lipe (Mus musculus) 6480464 LIPE protein promotes the reaction [27-hydroxycholesterol results in increased expression of STAR mRNA] and LIPE protein promotes the reaction [27-hydroxycholesterol results in increased expression of STAR protein] CTD PMID:23362264 Lipe Rat 3',5'-cyclic AMP increases activity ISO LIPE (Homo sapiens) 6480464 Cyclic AMP results in increased activity of LIPE protein CTD PMID:7155675 Lipe Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:23196670 Lipe Rat 3,3',5-triiodo-L-thyronine increases expression ISO Lipe (Mus musculus) 6480464 Triiodothyronine results in increased expression of LIPE mRNA CTD PMID:30209975 Lipe Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO Lipe (Mus musculus) 6480464 [Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS protein] results in increased expression of LIPE mRNA more ... CTD PMID:28285642 more ... Lipe Rat 4,4'-sulfonyldiphenol increases expression ISO LIPE (Homo sapiens) 6480464 bisphenol S results in increased expression of LIPE mRNA and bisphenol S results in increased expression of LIPE protein CTD PMID:27685785 more ... Lipe Rat 4,4'-sulfonyldiphenol decreases expression ISO Lipe (Mus musculus) 6480464 bisphenol S results in decreased expression of LIPE mRNA CTD PMID:33297965 and PMID:39298647 Lipe Rat 4,4'-sulfonyldiphenol affects methylation ISO Lipe (Mus musculus) 6480464 bisphenol S affects the methylation of LIPE exon and bisphenol S affects the methylation of LIPE gene CTD PMID:31683443 and PMID:33297965 Lipe Rat 4,4'-sulfonyldiphenol multiple interactions ISO Lipe (Mus musculus) 6480464 [Dietary Fats co-treated with bisphenol S] affects the expression of LIPE mRNA CTD PMID:27241191 Lipe Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of LIPE mRNA CTD PMID:24780913 Lipe Rat acrylamide decreases expression ISO LIPE (Homo sapiens) 6480464 Acrylamide results in decreased expression of LIPE mRNA CTD PMID:32763439 Lipe Rat aldehydo-D-glucosamine 6-phosphate increases expression ISO Lipe (Mus musculus) 6480464 glucosamine 6-phosphate results in increased expression of LIPE mRNA CTD PMID:19427183 Lipe Rat all-trans-retinyl palmitate increases hydrolysis ISO LIPE (Homo sapiens) 6480464 LIPE protein results in increased hydrolysis of retinol palmitate CTD PMID:16741517 Lipe Rat all-trans-retinyl palmitate multiple interactions ISO LIPE (Homo sapiens) 6480464 PLIN3 protein inhibits the reaction [LIPE protein results in increased hydrolysis of retinol palmitate] CTD PMID:16741517 Lipe Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of LIPE mRNA CTD PMID:35163327 Lipe Rat amiodarone multiple interactions ISO Lipe (Mus musculus) 6480464 INS inhibits the reaction [Amiodarone results in increased phosphorylation of LIPE protein] CTD PMID:28962527 Lipe Rat amiodarone increases phosphorylation ISO Lipe (Mus musculus) 6480464 Amiodarone results in increased phosphorylation of LIPE protein CTD PMID:28962527 and PMID:34259586 Lipe Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of LIPE mRNA CTD PMID:16483693 Lipe Rat ATP increases activity ISO LIPE (Homo sapiens) 6480464 Adenosine Triphosphate results in increased activity of LIPE protein CTD PMID:7155675 Lipe Rat beta-D-glucosamine 6-sulfate decreases expression ISO Lipe (Mus musculus) 6480464 glucosamine 6-O-sulfate results in decreased expression of LIPE mRNA CTD PMID:19520133 Lipe Rat beta-lapachone decreases expression ISO LIPE (Homo sapiens) 6480464 beta-lapachone results in decreased expression of LIPE mRNA CTD PMID:38218311 Lipe Rat bexarotene decreases expression EXP 6480464 bexarotene results in decreased expression of LIPE mRNA CTD PMID:16648578 Lipe Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Lipe (Mus musculus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Tetrachlorodibenzodioxin co-treated with 2 more ... CTD PMID:30722647 more ... Lipe Rat bis(2-ethylhexyl) phthalate increases expression ISO Lipe (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of LIPE mRNA CTD PMID:32522588 Lipe Rat bisphenol A increases expression ISO Lipe (Mus musculus) 6480464 bisphenol A results in increased expression of LIPE mRNA CTD PMID:26944108 and PMID:35504408 Lipe Rat bisphenol A increases expression ISO LIPE (Homo sapiens) 6480464 bisphenol A results in increased expression of LIPE protein CTD PMID:34186270 Lipe Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of LIPE mRNA CTD PMID:35504408 and PMID:36835180 Lipe Rat bisphenol A decreases phosphorylation EXP 6480464 bisphenol A results in decreased phosphorylation of LIPE protein CTD PMID:34165232 Lipe Rat bisphenol A multiple interactions EXP 6480464 bisphenol A promotes the reaction [Fructose results in decreased expression of LIPE mRNA] more ... CTD PMID:31661889 and PMID:34165232 Lipe Rat bisphenol A multiple interactions ISO Lipe (Mus musculus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Tetrachlorodibenzodioxin co-treated with 2 more ... CTD PMID:30722647 Lipe Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of LIPE gene CTD PMID:28505145 Lipe Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of LIPE mRNA and bisphenol A results in decreased expression of LIPE protein CTD PMID:25181051 more ... Lipe Rat bisphenol AF increases expression ISO LIPE (Homo sapiens) 6480464 bisphenol AF results in increased expression of LIPE protein CTD PMID:34186270 Lipe Rat Bisphenol B increases expression ISO LIPE (Homo sapiens) 6480464 bisphenol B results in increased expression of LIPE protein CTD PMID:34186270 Lipe Rat bisphenol F increases expression ISO LIPE (Homo sapiens) 6480464 bisphenol F results in increased expression of LIPE protein CTD PMID:34186270 Lipe Rat boric acid multiple interactions ISO Lipe (Mus musculus) 6480464 boric acid inhibits the reaction [[Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS protein] results in increased expression of LIPE mRNA] CTD PMID:28285642 Lipe Rat bucladesine affects localization EXP 6480464 Bucladesine affects the localization of LIPE protein CTD PMID:11160373 Lipe Rat bucladesine increases activity ISO Lipe (Mus musculus) 6480464 Bucladesine results in increased activity of LIPE protein CTD PMID:23362264 Lipe Rat bucladesine increases expression ISO Lipe (Mus musculus) 6480464 Bucladesine results in increased expression of LIPE mRNA CTD PMID:23362264 Lipe Rat bucladesine multiple interactions ISO Lipe (Mus musculus) 6480464 [Bucladesine co-treated with LIPE protein] results in increased expression of ABCA1 protein more ... CTD PMID:23362264 Lipe Rat Butylbenzyl phthalate multiple interactions ISO Lipe (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of LIPE mRNA CTD PMID:39150890 Lipe Rat cadmium dichloride multiple interactions ISO Lipe (Mus musculus) 6480464 [MT1 gene mutant form results in increased susceptibility to Cadmium Chloride] which results in decreased expression of LIPE mRNA and [MT2 gene mutant form results in increased susceptibility to Cadmium Chloride] which results in decreased expression of LIPE mRNA CTD PMID:23921151 Lipe Rat carbon nanotube increases expression ISO Lipe (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Lipe Rat choline multiple interactions ISO Lipe (Mus musculus) 6480464 [Choline deficiency co-treated with Methionine deficiency] results in increased phosphorylation of LIPE protein and Methionine inhibits the reaction [[Choline deficiency co-treated with Methionine deficiency] results in increased phosphorylation of LIPE protein] CTD PMID:25178843 Lipe Rat chromium(6+) affects expression ISO Lipe (Mus musculus) 6480464 chromium hexavalent ion affects the expression of LIPE mRNA CTD PMID:28472532 Lipe Rat cisplatin multiple interactions ISO LIPE (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of LIPE mRNA CTD PMID:27392435 Lipe Rat cisplatin increases expression ISO LIPE (Homo sapiens) 6480464 Cisplatin results in increased expression of LIPE mRNA CTD PMID:27392435 Lipe Rat CL316243 increases expression EXP 6480464 disodium (R more ... CTD PMID:20184727 Lipe Rat clofibrate increases expression EXP 6480464 Clofibrate results in increased expression of LIPE mRNA CTD PMID:11328961 Lipe Rat clofibrate increases expression ISO Lipe (Mus musculus) 6480464 Clofibrate results in increased expression of LIPE mRNA CTD PMID:23811191 Lipe Rat cobalt dichloride decreases expression ISO LIPE (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of LIPE mRNA CTD PMID:12032628 and PMID:22917661 Lipe Rat colforsin daropate hydrochloride affects localization EXP 6480464 Colforsin affects the localization of LIPE protein CTD PMID:11160373 Lipe Rat copper atom increases expression EXP 6480464 Copper deficiency results in increased expression of LIPE mRNA CTD PMID:26033743 Lipe Rat copper(0) increases expression EXP 6480464 Copper deficiency results in increased expression of LIPE mRNA CTD PMID:26033743 Lipe Rat corosolic acid increases expression ISO LIPE (Homo sapiens) 6480464 corosolic acid results in increased expression of LIPE mRNA CTD PMID:37939859 Lipe Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of LIPE mRNA CTD PMID:26577399 Lipe Rat deoxycholic acid decreases expression ISO Lipe (Mus musculus) 6480464 Deoxycholic Acid results in decreased expression of LIPE mRNA CTD PMID:23911798 Lipe Rat desferrioxamine B decreases expression ISO LIPE (Homo sapiens) 6480464 Deferoxamine results in decreased expression of LIPE mRNA CTD PMID:12032628 Lipe Rat dexamethasone increases phosphorylation ISO Lipe (Mus musculus) 6480464 Dexamethasone results in increased phosphorylation of LIPE protein CTD PMID:28292967 Lipe Rat dexamethasone multiple interactions ISO Lipe (Mus musculus) 6480464 [Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS protein] results in increased expression of LIPE mRNA more ... CTD PMID:28285642 more ... Lipe Rat dexamethasone increases expression ISO LIPE (Homo sapiens) 6480464 Dexamethasone results in increased expression of LIPE mRNA CTD PMID:25047013 Lipe Rat Dibutyl phosphate affects expression ISO LIPE (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of LIPE mRNA CTD PMID:37042841 Lipe Rat dibutyl phthalate multiple interactions ISO Lipe (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of LIPE mRNA CTD PMID:39150890 Lipe Rat dichlorine multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in increased expression of LIPE mRNA CTD PMID:18636392 Lipe Rat dichloroacetic acid increases expression ISO Lipe (Mus musculus) 6480464 Dichloroacetic Acid results in increased expression of LIPE mRNA CTD PMID:28962523 Lipe Rat diethyl phthalate multiple interactions ISO Lipe (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of LIPE mRNA CTD PMID:39150890 Lipe Rat diisobutyl phthalate multiple interactions ISO Lipe (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of LIPE mRNA CTD PMID:39150890 Lipe Rat diisononyl phthalate multiple interactions ISO Lipe (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of LIPE mRNA CTD PMID:39150890 Lipe Rat dioxygen decreases expression ISO LIPE (Homo sapiens) 6480464 Oxygen deficiency results in decreased expression of LIPE mRNA CTD PMID:12032628 Lipe Rat dioxygen increases expression ISO Lipe (Mus musculus) 6480464 Oxygen deficiency results in increased expression of LIPE mRNA CTD PMID:23539316 Lipe Rat disodium selenite increases phosphorylation EXP 6480464 Sodium Selenite results in increased phosphorylation of LIPE protein CTD PMID:24140496 Lipe Rat doxorubicin decreases expression ISO LIPE (Homo sapiens) 6480464 Doxorubicin results in decreased expression of LIPE mRNA CTD PMID:29803840 Lipe Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of LIPE mRNA CTD PMID:29391264 Lipe Rat ethanol increases expression ISO Lipe (Mus musculus) 6480464 Ethanol results in increased expression of LIPE mRNA CTD PMID:22173916 Lipe Rat ethanol increases phosphorylation ISO Lipe (Mus musculus) 6480464 Ethanol results in increased phosphorylation of LIPE protein CTD PMID:28882574 Lipe Rat ethanol multiple interactions EXP 6480464 Scopoletin inhibits the reaction [Ethanol results in increased phosphorylation of LIPE protein] and Silymarin inhibits the reaction [Ethanol results in increased phosphorylation of LIPE protein] CTD PMID:26115886 Lipe Rat ethanol increases phosphorylation EXP 6480464 Ethanol results in increased phosphorylation of LIPE protein CTD PMID:26115886 Lipe Rat ethanol multiple interactions ISO Lipe (Mus musculus) 6480464 gadolinium chloride inhibits the reaction [Ethanol results in increased phosphorylation of LIPE protein] and rosiglitazone inhibits the reaction [Ethanol results in increased expression of LIPE mRNA] CTD PMID:22173916 and PMID:28882574 Lipe Rat finasteride decreases expression EXP 6480464 Finasteride results in decreased expression of LIPE mRNA CTD PMID:24136188 Lipe Rat flavonoids decreases expression EXP 6480464 Flavonoids results in decreased expression of LIPE mRNA CTD PMID:18035473 Lipe Rat fructose multiple interactions EXP 6480464 bisphenol A promotes the reaction [Fructose results in decreased expression of LIPE mRNA] more ... CTD PMID:31661889 Lipe Rat fructose decreases expression EXP 6480464 Fructose results in decreased expression of LIPE mRNA and Fructose results in decreased expression of LIPE protein CTD PMID:31661889 Lipe Rat gadolinium trichloride multiple interactions ISO Lipe (Mus musculus) 6480464 gadolinium chloride inhibits the reaction [Ethanol results in increased phosphorylation of LIPE protein] CTD PMID:28882574 Lipe Rat genistein multiple interactions ISO Lipe (Mus musculus) 6480464 [Genistein co-treated with mono-(2-ethylhexyl)phthalate] results in increased expression of LIPE mRNA CTD PMID:27181934 Lipe Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of LIPE mRNA CTD PMID:33387578 Lipe Rat Gingerenone A multiple interactions ISO Lipe (Mus musculus) 6480464 gingerenone A inhibits the reaction [Dietary Fats results in decreased phosphorylation of LIPE protein] CTD PMID:28556482 Lipe Rat glycidol decreases expression EXP 6480464 glycidol results in decreased expression of LIPE mRNA CTD PMID:24915197 Lipe Rat glyphosate increases expression ISO Lipe (Mus musculus) 6480464 Glyphosate results in increased expression of LIPE mRNA CTD PMID:35897073 Lipe Rat imidacloprid increases expression ISO Lipe (Mus musculus) 6480464 imidacloprid results in increased expression of LIPE mRNA CTD PMID:33487623 Lipe Rat isoprenaline increases phosphorylation ISO Lipe (Mus musculus) 6480464 Isoproterenol results in increased phosphorylation of LIPE protein CTD PMID:21042876 Lipe Rat isoprenaline affects localization EXP 6480464 Isoproterenol affects the localization of LIPE protein CTD PMID:10894095 and PMID:11160373 Lipe Rat isoprenaline multiple interactions EXP 6480464 Papaverine inhibits the reaction [Isoproterenol affects the localization of LIPE protein] and Papaverine inhibits the reaction [Isoproterenol results in increased activity of LIPE protein] CTD PMID:10894095 Lipe Rat isoprenaline increases activity EXP 6480464 Isoproterenol results in increased activity of LIPE protein CTD PMID:10894095 Lipe Rat isoprenaline multiple interactions ISO Lipe (Mus musculus) 6480464 Sirolimus promotes the reaction [Isoproterenol results in increased phosphorylation of LIPE protein] CTD PMID:21042876 Lipe Rat L-methionine increases phosphorylation ISO Lipe (Mus musculus) 6480464 Methionine deficiency results in increased phosphorylation of LIPE protein CTD PMID:25178843 Lipe Rat L-methionine multiple interactions ISO Lipe (Mus musculus) 6480464 [Choline deficiency co-treated with Methionine deficiency] results in increased phosphorylation of LIPE protein and Methionine inhibits the reaction [[Choline deficiency co-treated with Methionine deficiency] results in increased phosphorylation of LIPE protein] CTD PMID:25178843 Lipe Rat Licarin A multiple interactions ISO Lipe (Mus musculus) 6480464 [licarin A affects the susceptibility to [INS protein co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone]] which results in increased expression of LIPE mRNA more ... CTD PMID:29288687 Lipe Rat lipoic acid multiple interactions ISO Lipe (Mus musculus) 6480464 N-(2-(4-bromocinnamylamino)ethyl)-5-isoquinolinesulfonamide inhibits the reaction [Thioctic Acid results in increased phosphorylation of LIPE protein] CTD PMID:22941773 Lipe Rat lipoic acid increases phosphorylation ISO Lipe (Mus musculus) 6480464 Thioctic Acid results in increased phosphorylation of LIPE protein CTD PMID:22941773 Lipe Rat loliolide decreases expression ISO Lipe (Mus musculus) 6480464 loliolide results in decreased expression of LIPE protein CTD PMID:33567534 Lipe Rat methamphetamine increases expression EXP 6480464 Methamphetamine results in increased expression of LIPE mRNA CTD PMID:35863504 Lipe Rat mono(2-ethylhexyl) phthalate increases expression ISO Lipe (Mus musculus) 6480464 mono-(2-ethylhexyl)phthalate results in increased expression of LIPE mRNA CTD PMID:25543134 Lipe Rat mono(2-ethylhexyl) phthalate increases phosphorylation ISO Lipe (Mus musculus) 6480464 mono-(2-ethylhexyl)phthalate results in increased phosphorylation of LIPE protein CTD PMID:30648648 Lipe Rat mono(2-ethylhexyl) phthalate multiple interactions ISO Lipe (Mus musculus) 6480464 [Genistein co-treated with mono-(2-ethylhexyl)phthalate] results in increased expression of LIPE mRNA and Acetylcysteine inhibits the reaction [mono-(2-ethylhexyl)phthalate results in increased phosphorylation of LIPE protein] CTD PMID:27181934 and PMID:30648648 Lipe Rat monosodium L-glutamate decreases activity EXP 6480464 Sodium Glutamate results in decreased activity of LIPE protein CTD PMID:11319642 Lipe Rat monosodium L-glutamate decreases expression EXP 6480464 Sodium Glutamate results in decreased expression of LIPE mRNA CTD PMID:11319642 Lipe Rat Muraglitazar increases expression EXP 6480464 muraglitazar results in increased expression of LIPE mRNA CTD PMID:21515302 Lipe Rat N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide multiple interactions ISO Lipe (Mus musculus) 6480464 N-(2-(4-bromocinnamylamino)ethyl)-5-isoquinolinesulfonamide affects the reaction [Bucladesine results in increased expression of and results in increased phosphorylation of LIPE protein] more ... CTD PMID:22941773 more ... Lipe Rat N-acetyl-L-cysteine multiple interactions ISO Lipe (Mus musculus) 6480464 Acetylcysteine inhibits the reaction [mono-(2-ethylhexyl)phthalate results in increased phosphorylation of LIPE protein] CTD PMID:30648648 Lipe Rat N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of LIPE mRNA CTD PMID:20360939 Lipe Rat nickel atom decreases expression ISO LIPE (Homo sapiens) 6480464 Nickel results in decreased expression of LIPE mRNA CTD PMID:25583101 Lipe Rat nicotine decreases expression EXP 6480464 Nicotine results in decreased expression of LIPE mRNA CTD PMID:29155039 Lipe Rat nicotinic acid decreases activity ISO LIPE (Homo sapiens) 6480464 Niacin results in decreased activity of LIPE protein CTD PMID:14749208 Lipe Rat nicotinic acid decreases expression ISO LIPE (Homo sapiens) 6480464 Niacin results in decreased expression of LIPE mRNA CTD PMID:19131065 Lipe Rat ozone decreases expression ISO Lipe (Mus musculus) 6480464 Ozone results in decreased expression of LIPE mRNA CTD PMID:12763052 Lipe Rat ozone multiple interactions ISO LIPE (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of LIPE mRNA CTD PMID:35430440 Lipe Rat ozone multiple interactions EXP 6480464 [Fish Oils co-treated with Ozone] results in increased expression of LIPE mRNA more ... CTD PMID:18636392 and PMID:33217375 Lipe Rat papaverine multiple interactions EXP 6480464 Papaverine inhibits the reaction [Isoproterenol affects the localization of LIPE protein] and Papaverine inhibits the reaction [Isoproterenol results in increased activity of LIPE protein] CTD PMID:10894095 Lipe Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of LIPE mRNA CTD PMID:33387578 Lipe Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of LIPE mRNA CTD PMID:35163327 Lipe Rat perfluorooctanoic acid increases expression EXP 6480464 perfluorooctanoic acid results in increased expression of LIPE mRNA CTD PMID:28511854 Lipe Rat phosphatidylcholine increases expression ISO Lipe (Mus musculus) 6480464 Phosphatidylcholines results in increased expression of LIPE mRNA CTD PMID:23911798 Lipe Rat pirinixic acid multiple interactions ISO Lipe (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of LIPE mRNA CTD PMID:19710929 Lipe Rat pirinixic acid increases expression ISO Lipe (Mus musculus) 6480464 pirinixic acid results in increased expression of LIPE mRNA CTD PMID:17426115 more ... Lipe Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of LIPE mRNA CTD PMID:19162173 Lipe Rat quercetin multiple interactions ISO Lipe (Mus musculus) 6480464 Quercetin inhibits the reaction [Dietary Fats results in decreased expression of LIPE mRNA] CTD PMID:24025686 Lipe Rat resveratrol multiple interactions ISO Lipe (Mus musculus) 6480464 resveratrol results in increased expression of and results in increased phosphorylation of LIPE protein CTD PMID:25140191 Lipe Rat resveratrol increases expression EXP 6480464 resveratrol results in increased expression of LIPE mRNA and resveratrol results in increased expression of LIPE protein CTD PMID:23824959 and PMID:24012391 Lipe Rat resveratrol decreases expression EXP 6480464 resveratrol results in decreased expression of LIPE mRNA CTD PMID:21569266 Lipe Rat resveratrol increases expression ISO Lipe (Mus musculus) 6480464 resveratrol results in increased expression of LIPE mRNA CTD PMID:25140191 Lipe Rat rimonabant affects expression ISO Lipe (Mus musculus) 6480464 Rimonabant affects the expression of LIPE mRNA CTD PMID:20110567 Lipe Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of LIPE mRNA CTD PMID:28374803 Lipe Rat scopoletin multiple interactions EXP 6480464 Scopoletin inhibits the reaction [Ethanol results in increased phosphorylation of LIPE protein] CTD PMID:26115886 Lipe Rat sirolimus multiple interactions ISO Lipe (Mus musculus) 6480464 Sirolimus promotes the reaction [Isoproterenol results in increased phosphorylation of LIPE protein] CTD PMID:21042876 Lipe Rat sodium arsenite increases expression ISO Lipe (Mus musculus) 6480464 sodium arsenite results in increased expression of LIPE mRNA CTD PMID:31170414 Lipe Rat streptozocin multiple interactions EXP 6480464 vanadyl sulfate inhibits the reaction [Streptozocin results in increased expression of LIPE mRNA] CTD PMID:16684804 Lipe Rat streptozocin multiple interactions ISO Lipe (Mus musculus) 6480464 [Streptozocin co-treated with [APOE protein affects the susceptibility to Dietary Fats]] affects the expression of HSL mRNA CTD PMID:39047806 Lipe Rat streptozocin increases expression EXP 6480464 Streptozocin results in increased expression of LIPE mRNA CTD PMID:16684804 Lipe Rat sulindac decreases expression EXP 6480464 Sulindac results in decreased expression of LIPE mRNA CTD PMID:24136188 Lipe Rat sunitinib decreases expression ISO LIPE (Homo sapiens) 6480464 Sunitinib results in decreased expression of LIPE mRNA CTD PMID:31533062 Lipe Rat tamoxifen decreases expression ISO Lipe (Mus musculus) 6480464 Tamoxifen results in decreased expression of LIPE mRNA CTD PMID:20937368 and PMID:25123088 Lipe Rat telmisartan multiple interactions ISO Lipe (Mus musculus) 6480464 PPARD promotes the reaction [telmisartan results in increased expression of LIPE protein] CTD PMID:20176998 Lipe Rat telmisartan increases expression ISO Lipe (Mus musculus) 6480464 telmisartan results in increased expression of LIPE protein CTD PMID:20176998 Lipe Rat tenofovir disoproxil fumarate affects expression ISO LIPE (Homo sapiens) 6480464 Tenofovir affects the expression of LIPE mRNA CTD PMID:20032539 Lipe Rat Tesaglitazar increases expression EXP 6480464 tesaglitazar results in increased expression of LIPE mRNA CTD PMID:21515302 Lipe Rat theophylline multiple interactions ISO LIPE (Homo sapiens) 6480464 Theophylline inhibits the reaction [Epinephrine results in increased activity of LIPE protein] CTD PMID:7155675 Lipe Rat theophylline affects localization EXP 6480464 Theophylline affects the localization of LIPE protein CTD PMID:11160373 Lipe Rat theophylline increases activity ISO LIPE (Homo sapiens) 6480464 Theophylline results in increased activity of LIPE protein CTD PMID:7155675 Lipe Rat titanium dioxide increases expression ISO Lipe (Mus musculus) 6480464 titanium dioxide results in increased expression of LIPE mRNA CTD PMID:23557971 Lipe Rat titanium dioxide decreases methylation ISO Lipe (Mus musculus) 6480464 titanium dioxide results in decreased methylation of LIPE gene CTD PMID:35295148 Lipe Rat titanium dioxide increases methylation ISO Lipe (Mus musculus) 6480464 titanium dioxide results in increased methylation of LIPE gene and titanium dioxide results in increased methylation of LIPE promoter CTD PMID:35295148 Lipe Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of LIPE mRNA CTD PMID:33387578 Lipe Rat troglitazone increases expression ISO Lipe (Mus musculus) 6480464 troglitazone results in increased expression of LIPE mRNA CTD PMID:12732648 Lipe Rat troglitazone increases expression EXP 6480464 troglitazone results in increased expression of LIPE mRNA CTD PMID:21515302 Lipe Rat tuberostemonine increases expression ISO LIPE (Homo sapiens) 6480464 tuberostemonine results in increased expression of LIPE mRNA CTD PMID:37236577 Lipe Rat valproic acid increases expression ISO Lipe (Mus musculus) 6480464 Valproic Acid results in increased expression of LIPE mRNA CTD PMID:24489787 Lipe Rat valproic acid increases expression ISO LIPE (Homo sapiens) 6480464 Valproic Acid results in increased expression of LIPE mRNA CTD PMID:29501571 Lipe Rat vanadyl sulfate multiple interactions EXP 6480464 vanadyl sulfate inhibits the reaction [Streptozocin results in increased expression of LIPE mRNA] CTD PMID:16684804 Lipe Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of LIPE mRNA CTD PMID:22570695 and PMID:23034163 Lipe Rat zidovudine affects expression ISO LIPE (Homo sapiens) 6480464 Zidovudine affects the expression of LIPE mRNA CTD PMID:20032539
Imported Annotations - KEGG (archival)
(+)-catechin (EXP) (25R)-cholest-5-ene-3beta,26-diol (ISO) (R)-adrenaline (EXP,ISO) (R)-lipoic acid (ISO) (S)-nicotine (EXP) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,6-dinitrotoluene (EXP) 2-amino-2-deoxy-D-glucopyranose 6-phosphate (ISO) 26-hydroxycholesterol (ISO) 3',5'-cyclic AMP (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3,3',5-triiodo-L-thyronine (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) acrylamide (ISO) aldehydo-D-glucosamine 6-phosphate (ISO) all-trans-retinyl palmitate (ISO) alpha-Zearalanol (EXP) amiodarone (ISO) ammonium chloride (EXP) ATP (ISO) beta-D-glucosamine 6-sulfate (ISO) beta-lapachone (ISO) bexarotene (EXP) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) boric acid (ISO) bucladesine (EXP,ISO) Butylbenzyl phthalate (ISO) cadmium dichloride (ISO) carbon nanotube (ISO) choline (ISO) chromium(6+) (ISO) cisplatin (ISO) CL316243 (EXP) clofibrate (EXP,ISO) cobalt dichloride (ISO) colforsin daropate hydrochloride (EXP) copper atom (EXP) copper(0) (EXP) corosolic acid (ISO) Cuprizon (EXP) deoxycholic acid (ISO) desferrioxamine B (ISO) dexamethasone (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) dichlorine (EXP) dichloroacetic acid (ISO) diethyl phthalate (ISO) diisobutyl phthalate (ISO) diisononyl phthalate (ISO) dioxygen (ISO) disodium selenite (EXP) doxorubicin (ISO) endosulfan (EXP) ethanol (EXP,ISO) finasteride (EXP) flavonoids (EXP) fructose (EXP) gadolinium trichloride (ISO) genistein (ISO) gentamycin (EXP) Gingerenone A (ISO) glycidol (EXP) glyphosate (ISO) imidacloprid (ISO) isoprenaline (EXP,ISO) L-methionine (ISO) Licarin A (ISO) lipoic acid (ISO) loliolide (ISO) methamphetamine (EXP) mono(2-ethylhexyl) phthalate (ISO) monosodium L-glutamate (EXP) Muraglitazar (EXP) N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide (ISO) N-acetyl-L-cysteine (ISO) N-nitrosodiethylamine (EXP) nickel atom (ISO) nicotine (EXP) nicotinic acid (ISO) ozone (EXP,ISO) papaverine (EXP) paracetamol (EXP) perfluorooctanoic acid (EXP) phosphatidylcholine (ISO) pirinixic acid (EXP,ISO) quercetin (ISO) resveratrol (EXP,ISO) rimonabant (ISO) rotenone (EXP) scopoletin (EXP) sirolimus (ISO) sodium arsenite (ISO) streptozocin (EXP,ISO) sulindac (EXP) sunitinib (ISO) tamoxifen (ISO) telmisartan (ISO) tenofovir disoproxil fumarate (ISO) Tesaglitazar (EXP) theophylline (EXP,ISO) titanium dioxide (ISO) trichloroethene (EXP) troglitazone (EXP,ISO) tuberostemonine (ISO) valproic acid (ISO) vanadyl sulfate (EXP) vinclozolin (EXP) zidovudine (ISO)
Cellular Component
caveola (IEA,ISS) cytoplasm (IEA,ISS) cytosol (IBA,IEA,ISO,ISS,TAS) extracellular space (IDA) lipid droplet (IEA,ISO,ISS,TAS) membrane (IEA,ISO,ISS) mitochondrion (ISS) nucleus (ISS) plasma membrane (IEA)
Molecular Function
all-trans-retinyl-palmitate hydrolase, all-trans-retinol forming activity (IEA) diacylglycerol lipase activity (IDA,IEA,ISO,ISS) hydrolase activity (IEA) hydrolase activity, acting on ester bonds (IDA) lipase activity (IEA) monoacylglycerol lipase activity (IDA,IEA,ISO) protein binding (IPI,ISO) protein kinase binding (ISO) retinyl-palmitate esterase activity (IDA,IEA,ISO) rRNA primary transcript binding (ISS) serine hydrolase activity (ISO) sterol ester esterase activity (IBA,IDA,IEA,ISO) triacylglycerol lipase activity (IBA,IDA,IEA,ISO)
1.
Association and insulin regulated translocation of hormone-sensitive lipase with PTRF.
Aboulaich N, etal., Biochem Biophys Res Commun. 2006 Nov 24;350(3):657-61. Epub 2006 Sep 28.
2.
Vectorial proteomics reveal targeting, phosphorylation and specific fragmentation of polymerase I and transcript release factor (PTRF) at the surface of caveolae in human adipocytes.
Aboulaich N, etal., Biochem J. 2004 Oct 15;383(Pt 2):237-48.
3.
The combination of ApoCIII, hepatic lipase and hormono sensitive lipase gene polymorphisms suggests an association with susceptibility to gestational hypertension.
Bernard N, etal., J Hum Genet. 2007;52(3):244-54. Epub 2007 Feb 15.
4.
Paradoxical effect on atherosclerosis of hormone-sensitive lipase overexpression in macrophages.
Escary JL, etal., J Lipid Res. 1999 Mar;40(3):397-404.
5.
PPARgamma agonism increases rat adipose tissue lipolysis, expression of glyceride lipases, and the response of lipolysis to hormonal control.
Festuccia WT, etal., Diabetologia. 2006 Oct;49(10):2427-36. Epub 2006 Aug 14.
6.
Positional specificity of hormone-sensitive lipase from rat adipose tissue.
Fredrikson G and Belfrage P, J Biol Chem. 1983 Dec 10;258(23):14253-6.
7.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
8.
The cytoskeleton in 'couch potato-ism': Insights from a murine model of impaired actin dynamics.
Gertz K, etal., Exp Neurol. 2018 Aug;306:34-44. doi: 10.1016/j.expneurol.2018.04.004. Epub 2018 Apr 21.
9.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
10.
Low level expression of hormone-sensitive lipase in arterial macrophage-derived foam cells: potential explanation for low rates of cholesteryl ester hydrolysis.
Harte RA, etal., Atherosclerosis. 2000 Apr;149(2):343-50.
11.
Nucleotide sequence of rat adipose hormone sensitive lipase cDNA.
Holm C, etal., Nucleic Acids Res 1988 Oct 25;16(20):9879.
12.
Molecular cloning, genomic organization, and expression of a testicular isoform of hormone-sensitive lipase.
Holst LS, etal., Genomics 1996 Aug 1;35(3):441-7.
13.
Cloning and functional characterization of PTRF, a novel protein which induces dissociation of paused ternary transcription complexes.
Jansa P, etal., EMBO J. 1998 May 15;17(10):2855-64.
14.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
15.
[Gene expression of hormone sensitive lipase and lipoprotein lipase in obesity-prone and obesity-resistant rats induced by high-fat diet]
Ma W, etal., Wei Sheng Yan Jiu. 2007 May;36(3):320-2.
16.
Skeletal muscle PLIN3 and PLIN5 are serine phosphorylated at rest and following lipolysis during adrenergic or contractile stimulation.
Macpherson RE, etal., Physiol Rep. 2013 Sep;1(4):e00084. doi: 10.1002/phy2.84. Epub 2013 Sep 17.
17.
Expression, activity, and localization of hormone-sensitive lipase in rat mammary gland during pregnancy and lactation.
Martin-Hidalgo A, etal., J Lipid Res. 2005 Apr;46(4):658-68. Epub 2005 Jan 16.
18.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
19.
Analysis of lipolysis in adipocytes using a fluorescent fatty acid derivative.
Muller G, etal., Biochimie. 2003 Dec;85(12):1245-56.
20.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
21.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
22.
Sensitive assay for hormone-sensitive lipase using NBD-labeled monoacylglycerol to detect low activities in rat adipocytes.
Petry S, etal., J Lipid Res. 2005 Mar;46(3):603-14. Epub 2005 Jan 1.
23.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
24.
Changes in mammary fat pad composition and lipolytic capacity throughout pregnancy.
Pujol E, etal., Cell Tissue Res. 2006 Mar;323(3):505-511. Epub 2005 Nov 22.
25.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
26.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
27.
Masoprocol decreases serum triglyceride concentrations in rats with fructose-induced hypertriglyceridemia.
Scribner KA, etal., Metabolism. 2000 Sep;49(9):1106-10.
28.
Hormone-sensitive lipase functions as an oligomer.
Shen WJ, etal., Biochemistry. 2000 Mar 7;39(9):2392-8. doi: 10.1021/bi992283h.
29.
Interaction of hormone-sensitive lipase with steroidogenic acute regulatory protein: facilitation of cholesterol transfer in adrenal.
Shen WJ, etal., J Biol Chem. 2003 Oct 31;278(44):43870-6. Epub 2003 Aug 18.
30.
Interaction of rat hormone-sensitive lipase with adipocyte lipid-binding protein.
Shen WJ, etal., Proc Natl Acad Sci U S A 1999 May 11;96(10):5528-32.
31.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
32.
Cardiac overexpression of hormone-sensitive lipase inhibits myocardial steatosis and fibrosis in streptozotocin diabetic mice.
Ueno M, etal., Am J Physiol Endocrinol Metab. 2008 Jun;294(6):E1109-18. Epub 2008 Apr 15.
33.
Mutational analysis of the "regulatory module" of hormone-sensitive lipase.
Wang J, etal., Biochemistry. 2005 Feb 15;44(6):1953-9.
34.
Hormone-sensitive lipase is reduced in the adipose tissue of patients with type 2 diabetes mellitus: influence of IL-6 infusion.
Watt MJ, etal., Diabetologia. 2005 Jan;48(1):105-12. Epub 2004 Dec 18.
35.
Retinyl ester hydrolysis and retinol efflux from BFC-1beta adipocytes.
Wei S, etal., J Biol Chem. 1997 May 30;272(22):14159-65. doi: 10.1074/jbc.272.22.14159.
Lipe Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 90,093,433 - 90,112,117 (-) NCBI GRCr8 mRatBN7.2 1 80,965,612 - 80,984,313 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 80,965,627 - 80,984,310 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 86,357,834 - 86,376,510 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 94,909,045 - 94,927,749 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 88,113,613 - 88,132,294 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 82,248,031 - 82,266,727 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 82,248,046 - 82,266,727 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 83,511,504 - 83,530,200 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 80,663,791 - 80,682,480 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 80,741,901 - 80,760,591 (-) NCBI Celera 1 75,407,246 - 75,425,931 (-) NCBI Celera Cytogenetic Map 1 q21 NCBI
LIPE Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 42,401,514 - 42,427,388 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 42,401,497 - 42,427,388 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 42,905,666 - 42,931,540 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 47,597,506 - 47,623,418 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 47,597,505 - 47,623,418 NCBI Celera 19 39,706,455 - 39,732,367 (-) NCBI Celera Cytogenetic Map 19 q13.2 NCBI HuRef 19 39,335,797 - 39,361,703 (-) NCBI HuRef CHM1_1 19 42,907,316 - 42,933,231 (-) NCBI CHM1_1 T2T-CHM13v2.0 19 45,220,900 - 45,246,776 (-) NCBI T2T-CHM13v2.0
Lipe Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 25,078,952 - 25,097,911 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 25,078,952 - 25,098,135 (-) Ensembl GRCm39 Ensembl GRCm38 7 25,379,527 - 25,398,486 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 25,379,527 - 25,398,710 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 26,164,546 - 26,181,006 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 25,088,287 - 25,104,747 (-) NCBI MGSCv36 mm8 Celera 7 19,994,853 - 20,011,313 (-) NCBI Celera Cytogenetic Map 7 A3 NCBI cM Map 7 13.78 NCBI
Lipe Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955555 514,410 - 530,759 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955555 511,085 - 531,165 (+) NCBI ChiLan1.0 ChiLan1.0
LIPE Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 48,506,457 - 48,534,733 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 50,375,028 - 50,400,941 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 39,289,162 - 39,315,067 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 47,881,292 - 47,907,066 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 47,881,292 - 47,907,066 (-) Ensembl panpan1.1 panPan2
LIPE Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 111,987,862 - 112,006,492 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 111,988,029 - 112,006,461 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 111,412,499 - 111,431,532 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 112,598,798 - 112,617,839 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 112,607,340 - 112,617,499 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 112,153,322 - 112,171,913 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 111,788,548 - 111,807,575 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 112,715,381 - 112,734,429 (+) NCBI UU_Cfam_GSD_1.0
Lipe
LIPE Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 49,540,708 - 49,560,125 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 49,543,671 - 49,560,126 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 45,443,742 - 45,454,621 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3 Pig Cytomap 6 q12 NCBI
LIPE Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 6 36,604,822 - 36,630,648 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 6 36,605,126 - 36,630,376 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666073 14,849,833 - 14,875,994 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Lipe
.
Predicted Target Of
Count of predictions: 61 Count of miRNA genes: 58 Interacting mature miRNAs: 60 Transcripts: ENSRNOT00000027910 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
2313059 Bss55 Bone structure and strength QTL 55 3.2 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 631688 Hcas2 Hepatocarcinoma susceptibility QTL 2 3 0.0001 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 5925874 115540829 Rat 1578649 Bmd8 Bone mineral density QTL 8 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 1 49393172 94393172 Rat 1582234 Gluco18 Glucose level QTL 18 3.4 0.0003 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 78479925 123479925 Rat 1358359 Sradr1 Stress Responsive Adrenal Weight QTL 1 4.74 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 30882023 123479925 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 4889929 Bss87 Bone structure and strength QTL 87 6.7 tibia area (VT:1000281) tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722) 1 53895117 82174945 Rat 2313062 Bmd73 Bone mineral density QTL 73 3.9 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 11481312 82174945 Rat 1578654 Bss10 Bone structure and strength QTL 10 4 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 1 49393172 159356837 Rat 1554320 Bmd1 Bone mineral density QTL 1 12.2 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 509108 86060548 Rat 2302059 Pia36 Pristane induced arthritis QTL 36 3.8 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 1 43333002 88333002 Rat 2313065 Bss67 Bone structure and strength QTL 67 3.1 0.0001 tibia area (VT:1000281) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 1300121 Hrtrt1 Heart rate QTL 1 3.7 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 65789093 115540829 Rat 7421628 Bp361 Blood pressure QTL 361 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 66023617 118608521 Rat 2313069 Bss68 Bone structure and strength QTL 68 2.9 0.0001 tibia size trait (VT:0100001) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 631495 Bp96 Blood pressure QTL 96 4.52 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 22340647 102268831 Rat 2313075 Bss66 Bone structure and strength QTL 66 3.4 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 11481312 82174945 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 631512 Scl6 Serum cholesterol level QTL 6 9.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 1 72197680 90508767 Rat 2298545 Neuinf8 Neuroinflammation QTL 8 4.6 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 1 57336763 151090257 Rat 2313072 Bss53 Bone structure and strength QTL 53 4.3 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 43284731 118944897 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 2313078 Bss54 Bone structure and strength QTL 54 3.5 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 2313077 Bss69 Bone structure and strength QTL 69 3.5 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 11481312 82174945 Rat 1549903 Bp267 Blood pressure QTL 267 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 77876254 106047988 Rat 2313402 Anxrr24 Anxiety related response QTL 24 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 1 48963584 144267916 Rat 4889494 Scort2 Serum corticosterone level QTL 2 4.2 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 80592172 125592172 Rat 61342 Bp27 Blood pressure QTL 27 3.4 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 56732668 98773277 Rat 1300172 Bp172 Blood pressure QTL 172 3.56 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 32737273 90665040 Rat 4889962 Bss94 Bone structure and strength QTL 94 3.8 tibia area (VT:1000281) tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722) 1 49361465 82174945 Rat 61344 Bp29 Blood pressure QTL 29 7.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 78350581 123350581 Rat 1358192 Ept13 Estrogen-induced pituitary tumorigenesis QTL 13 3.4 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 77494165 122494165 Rat 2313094 Bss58 Bone structure and strength QTL 58 3.7 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 43284731 118944897 Rat 6903308 Scl36 Serum cholesterol QTL 36 2 0.0125 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 53863041 90532583 Rat 2313092 Bmd72 Bone mineral density QTL 72 2.5 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 1 11481312 82174945 Rat 2300164 Bmd44 Bone mineral density QTL 44 5.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 1 56949932 101949932 Rat 2313099 Bss56 Bone structure and strength QTL 56 2.4 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 1 43284731 118944897 Rat 2313098 Bmd70 Bone mineral density QTL 70 3.6 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 43284731 118944897 Rat 2313097 Bss70 Bone structure and strength QTL 70 3.5 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 152025249 Scl82 Serum cholesterol level QTL 82 4.77 blood cholesterol amount (VT:0000180) 1 50343510 99980958 Rat 10054135 Gmadr2 Adrenal mass QTL 2 1.97 0.0129 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 77857876 122857876 Rat 7411712 Strs4 Sensitivity to stroke QTL 4 8.7 cerebrum integrity trait (VT:0010549) percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932) 1 78430536 123430536 Rat 4889919 Bss86 Bone structure and strength QTL 86 4.1 tibia area (VT:1000281) tibia midshaft total cross-sectional area (CMO:0001715) 1 53895117 82174945 Rat 2313051 Bss57 Bone structure and strength QTL 57 3.7 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 43284731 118944897 Rat 61433 Cia2 Collagen induced arthritis QTL 2 5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 1 78430754 91209302 Rat
D1Rat339
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 80,968,042 - 80,968,185 (+) MAPPER mRatBN7.2 Rnor_6.0 1 82,250,462 - 82,250,604 NCBI Rnor6.0 Rnor_5.0 1 83,513,935 - 83,514,077 UniSTS Rnor5.0 RGSC_v3.4 1 80,666,206 - 80,666,349 RGD RGSC3.4 RGSC_v3.4 1 80,666,207 - 80,666,349 UniSTS RGSC3.4 RGSC_v3.1 1 80,744,317 - 80,744,460 RGD Celera 1 75,409,662 - 75,409,804 UniSTS SHRSP x BN Map 1 42.2999 RGD SHRSP x BN Map 1 42.2999 UniSTS Cytogenetic Map 1 q21 UniSTS
D1Bda5
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 80,965,649 - 80,965,878 (+) MAPPER mRatBN7.2 Rnor_6.0 1 82,248,069 - 82,248,297 NCBI Rnor6.0 Rnor_5.0 1 83,511,542 - 83,511,770 UniSTS Rnor5.0 RGSC_v3.4 1 80,663,814 - 80,664,042 UniSTS RGSC3.4 Celera 1 75,407,269 - 75,407,497 UniSTS Cytogenetic Map 1 q21 UniSTS
RH131319
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 80,965,690 - 80,965,871 (+) MAPPER mRatBN7.2 Rnor_6.0 1 82,248,110 - 82,248,290 NCBI Rnor6.0 Rnor_5.0 1 83,511,583 - 83,511,763 UniSTS Rnor5.0 RGSC_v3.4 1 80,663,855 - 80,664,035 UniSTS RGSC3.4 Celera 1 75,407,310 - 75,407,490 UniSTS RH 3.4 Map 1 841.5 UniSTS Cytogenetic Map 1 q21 UniSTS
RH94620
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 80,965,645 - 80,965,801 (+) MAPPER mRatBN7.2 Rnor_6.0 1 82,248,065 - 82,248,220 NCBI Rnor6.0 Rnor_5.0 1 83,511,538 - 83,511,693 UniSTS Rnor5.0 RGSC_v3.4 1 80,663,810 - 80,663,965 UniSTS RGSC3.4 Celera 1 75,407,265 - 75,407,420 UniSTS Cytogenetic Map 1 q21 UniSTS
BG381659
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 80,985,084 - 80,985,325 (+) MAPPER mRatBN7.2 Rnor_6.0 1 82,267,502 - 82,267,742 NCBI Rnor6.0 Rnor_5.0 1 83,530,975 - 83,531,215 UniSTS Rnor5.0 RGSC_v3.4 1 80,683,255 - 80,683,495 UniSTS RGSC3.4 Celera 1 75,426,706 - 75,426,946 UniSTS RH 3.4 Map 1 824.5 UniSTS Cytogenetic Map 1 q21 UniSTS
This gene Lipe is modified in the following models/strains:
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000027910 ⟹ ENSRNOP00000027911
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 80,965,627 - 80,984,310 (-) Ensembl Rnor_6.0 Ensembl 1 82,248,046 - 82,266,727 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000099694 ⟹ ENSRNOP00000096661
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 80,965,627 - 80,981,553 (-) Ensembl
RefSeq Acc Id:
NM_012859 ⟹ NP_036991
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 90,093,433 - 90,112,117 (-) NCBI mRatBN7.2 1 80,965,627 - 80,984,310 (-) NCBI Rnor_6.0 1 82,248,046 - 82,266,727 (-) NCBI Rnor_5.0 1 83,511,504 - 83,530,200 (-) NCBI RGSC_v3.4 1 80,663,791 - 80,682,480 (-) RGD Celera 1 75,407,246 - 75,425,931 (-) RGD
Sequence:
TAGCCCTAACCCCTCTCCCAAAGTAAGAGGCACAGAGTGATCACTTGGCGAGGAGTGGGGACCAGCAGTGAAAAACCCGCGGACCAGCTCTAAAGAAAGACCAGGAATGCCAGGACAAAAGATTAGAG
hide sequence
RefSeq Acc Id:
XM_006228391 ⟹ XP_006228453
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 90,093,692 - 90,109,341 (-) NCBI mRatBN7.2 1 80,965,612 - 80,981,826 (-) NCBI Rnor_6.0 1 82,248,031 - 82,264,021 (-) NCBI Rnor_5.0 1 83,511,504 - 83,530,200 (-) NCBI
Sequence:
GGTTTAGGGGCCTGGCGGTGGTGTGTAACTAAGATTGACTCTAAGAGAGGGACTTGATCACTGGAACTGGGCCCCGCGCCGGGACTGGAAAGAATTGATGGAGCCGGCCGTGGAATCGGCGCCCGTGG
hide sequence
RefSeq Acc Id:
XM_006228393 ⟹ XP_006228455
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 90,093,692 - 90,102,989 (-) NCBI mRatBN7.2 1 80,965,612 - 80,975,296 (-) NCBI Rnor_6.0 1 82,248,031 - 82,257,619 (-) NCBI Rnor_5.0 1 83,511,504 - 83,530,200 (-) NCBI
Sequence:
AAGGGAACTGCTGAGCGTCCAGATTTCCCAGAACAAGAAGGACAAGTCCAAAGACAATAAACAA
hide sequence
RefSeq Acc Id:
XM_006228394 ⟹ XP_006228456
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 90,093,692 - 90,104,042 (-) NCBI mRatBN7.2 1 80,965,612 - 80,976,529 (-) NCBI Rnor_6.0 1 82,248,031 - 82,260,279 (-) NCBI Rnor_5.0 1 83,511,504 - 83,530,200 (-) NCBI
Sequence:
TATCCTGTGTGACAAGTGGGTGAAGCTAGGCTTAGAAAGTGGGAAATTACACCAGCCAGGAGTGGAACACACGGAGAAGGCCCTGAACTCGGACGGCCCAGACAATGTCATGGGGAGACAGAACAGAA
hide sequence
RefSeq Acc Id:
XM_039101579 ⟹ XP_038957507
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 90,098,793 - 90,111,924 (-) NCBI mRatBN7.2 1 80,970,991 - 80,984,313 (-) NCBI
RefSeq Acc Id:
XM_063281687 ⟹ XP_063137757
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 90,093,692 - 90,111,183 (-) NCBI
RefSeq Acc Id:
NP_036991 ⟸ NM_012859
- UniProtKB:
Q6LCQ2 (UniProtKB/Swiss-Prot), P15304 (UniProtKB/Swiss-Prot), A6J957 (UniProtKB/TrEMBL), G3V8R5 (UniProtKB/TrEMBL)
- Sequence:
MKPRRPISFTREITAMEPSSTSVSRPEWRPEAQQTLTDYPGSRELQEFGIPQKQSLPNEATAQQGAEFQQEQGVQQSTLLQKLLTPLAFPVPQQSFPSHKVHSDQQEATSQNGPGAGKVHTTQKELEH
hide sequence
RefSeq Acc Id:
XP_006228453 ⟸ XM_006228391
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6GLP7 (UniProtKB/TrEMBL)
- Sequence:
MEPAVESAPVVAQASKQAKEGSKNRSRRRWRKGKVKASAFSHSMDLRTMTQSLVALAEDNMAFF
hide sequence
RefSeq Acc Id:
XP_006228456 ⟸ XM_006228394
- Peptide Label:
isoform X4
- UniProtKB:
A6J958 (UniProtKB/TrEMBL), A0A8I6GLP7 (UniProtKB/TrEMBL)
- Sequence:
MDLRTMTQSLVALAEDNMAFFSSQGPGETARRLSNVFAGVREQALGLEPTLGQLLGVAHHFDLDTETPANGYRSLVHTARCCLAHLLHKSRYVASNRRSIFFRASHNLAELEAYLAALTQLRALAYYA
hide sequence
RefSeq Acc Id:
XP_006228455 ⟸ XM_006228393
- Peptide Label:
isoform X3
- UniProtKB:
A0A8I6GLP7 (UniProtKB/TrEMBL)
- Sequence:
MVLASAFSHSMDLRTMTQSLVALAEDNMAFFSSQGPGETARRLSNVFAGVREQALGLEPTLGQLLGVAHHFDLDTETPANGYRSLVHTARCCLAHLLHKSRYVASNRRSIFFRASHNLAELEAYLAAL
hide sequence
Ensembl Acc Id:
ENSRNOP00000027911 ⟸ ENSRNOT00000027910
RefSeq Acc Id:
XP_038957507 ⟸ XM_039101579
- Peptide Label:
isoform X5
- UniProtKB:
Q6AYV9 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000096661 ⟸ ENSRNOT00000099694
RefSeq Acc Id:
XP_063137757 ⟸ XM_063281687
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6GLP7 (UniProtKB/TrEMBL)
RGD ID: 13689815 Promoter ID: EPDNEW_R340 Type: multiple initiation site Name: Lipe_1 Description: lipase E, hormone sensitive type SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 82,266,726 - 82,266,786 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-02-17
Lipe
lipase E, hormone sensitive type
Lipe
lipase E, hormone sensitive
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2016-02-03
Lipe
lipase E, hormone sensitive
Lipe
lipase, hormone sensitive
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2001-07-23
Lipe
Hormone - sensitive lipase, testicular isoform
Name withdrawn
67952 WITHDRAWN
2001-07-23
Lipe
lipase, hormone sensitive
Name updated to reflect Human and Mouse nomenclature
67952 APPROVED
Note Type
Note
Reference
gene_expression
expressed in testis in the spermatids and spermatozoa
729199
