Symbol:
Ets1
Name:
ETS proto-oncogene 1, transcription factor
RGD ID:
2583
Description:
Enables histone acetyltransferase binding activity and sequence-specific DNA binding activity. Involved in several processes, including angiogenesis involved in wound healing; diencephalon development; and estrous cycle. Predicted to be located in nucleoplasm. Predicted to be part of transcription regulator complex. Predicted to be active in nucleus. Human ortholog(s) of this gene implicated in type 1 diabetes mellitus. Orthologous to human ETS1 (ETS proto-oncogene 1, transcription factor); PARTICIPATES IN altered p53 signaling pathway; hypoxia inducible factor pathway; interleukin-4 signaling pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Ets avian erythroblastosis virus E2 oncogene homolog 1 (tumor progression locus 1); Ets-1; Etsoncb; MGC124638; p54; protein C-ets-1; Tpl1; v-ets avian erythroblastosis virus E26 oncogene homolog 1; v-ets erythroblastosis virus E26 oncogene homolog 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ETS1 (ETS proto-oncogene 1, transcription factor) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB
Mus musculus (house mouse):
Ets1 (E26 avian leukemia oncogene 1, 5' domain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Ets1 (ETS proto-oncogene 1, transcription factor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ETS1 (ETS proto-oncogene 1, transcription factor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ETS1 (ETS proto-oncogene 1, transcription factor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ets1 (ETS proto-oncogene 1, transcription factor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ETS1 (ETS proto-oncogene 1, transcription factor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ETS1 (ETS proto-oncogene 1, transcription factor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Ets1 (ETS proto-oncogene 1, transcription factor) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Ets1 (E26 avian leukemia oncogene 1, 5' domain)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
ETS1 (ETS proto-oncogene 1, transcription factor)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ets1 (v-ets avian erythroblastosis virus E26 oncogene homolog 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
pnt
Alliance
DIOPT (InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
ets-9
Alliance
DIOPT (Ensembl Compara|InParanoid)
Caenorhabditis elegans (roundworm):
C52B9.19
Alliance
DIOPT (Ensembl Compara|InParanoid)
Xenopus tropicalis (tropical clawed frog):
ets1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Allele / Splice:
Ets1em1Mcwi
Genetic Models:
SS-Ets1em1Mcwi-/+
SS-Ets1em1Mcwi
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 39,303,936 - 39,426,022 (+) NCBI GRCr8 mRatBN7.2 8 31,045,909 - 31,168,010 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 31,045,945 - 31,168,010 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 35,176,570 - 35,239,049 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 33,471,056 - 33,533,529 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 31,333,929 - 31,396,429 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 33,756,634 - 33,879,625 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 33,816,386 - 33,879,625 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 33,798,598 - 33,921,593 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 32,481,694 - 32,545,237 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 32,490,458 - 32,553,970 (+) NCBI Celera 8 32,555,513 - 32,617,691 (+) NCBI Celera RH 3.4 Map 8 268.3 RGD Cytogenetic Map 8 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ets1 Rat 1,2-dichloroethane decreases expression ISO Ets1 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of ETS1 mRNA CTD PMID:28960355 Ets1 Rat 1,2-dimethylhydrazine multiple interactions ISO Ets1 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to 1 and 2-Dimethylhydrazine] which results in increased expression of ETS1 mRNA CTD PMID:26388957 Ets1 Rat 1,2-dimethylhydrazine increases expression ISO Ets1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of ETS1 mRNA CTD PMID:22206623 Ets1 Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of ETS1 mRNA CTD PMID:12832660 Ets1 Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of ETS1 mRNA CTD PMID:17557909 Ets1 Rat 17beta-estradiol decreases expression ISO Ets1 (Mus musculus) 6480464 Estradiol results in decreased expression of ETS1 mRNA CTD PMID:25210133 Ets1 Rat 17beta-estradiol multiple interactions ISO ETS1 (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in increased expression of ETS1 mRNA CTD PMID:30165855 Ets1 Rat 17beta-estradiol decreases expression ISO ETS1 (Homo sapiens) 6480464 Estradiol results in decreased expression of ETS1 mRNA CTD PMID:23094148 Ets1 Rat 17beta-estradiol multiple interactions ISO Ets1 (Mus musculus) 6480464 ESR1 protein promotes the reaction [Estradiol results in decreased expression of ETS1 mRNA] CTD PMID:25210133 Ets1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Ets1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of ETS1 mRNA CTD PMID:19770486 and PMID:24058054 Ets1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of ETS1 mRNA CTD PMID:33387578 Ets1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of ETS1 mRNA CTD PMID:34747641 Ets1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Ets1 (Mus musculus) 6480464 [TIPARP gene mutant form results in increased susceptibility to Tetrachlorodibenzodioxin] which results in decreased expression of ETS1 mRNA CTD PMID:25975270 Ets1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Ets1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of ETS1 mRNA CTD PMID:21570461 Ets1 Rat 2-butoxyethanol decreases expression ISO Ets1 (Mus musculus) 6480464 n-butoxyethanol results in decreased expression of ETS1 mRNA CTD PMID:19812364 Ets1 Rat 2-hydroxypropanoic acid increases expression ISO ETS1 (Homo sapiens) 6480464 Lactic Acid results in increased expression of ETS1 mRNA CTD PMID:30851411 Ets1 Rat 2-methylcholine affects expression ISO ETS1 (Homo sapiens) 6480464 beta-methylcholine affects the expression of ETS1 mRNA CTD PMID:21179406 Ets1 Rat 3,3',4,4',5-pentachlorobiphenyl increases expression EXP 6480464 3 more ... CTD PMID:23196670 Ets1 Rat 3H-1,2-dithiole-3-thione decreases expression EXP 6480464 1 and 2-dithiol-3-thione results in decreased expression of ETS1 mRNA CTD PMID:19162173 Ets1 Rat 4,4'-sulfonyldiphenol increases expression ISO Ets1 (Mus musculus) 6480464 bisphenol S results in increased expression of ETS1 mRNA CTD PMID:30951980 Ets1 Rat 4,4'-sulfonyldiphenol increases methylation ISO ETS1 (Homo sapiens) 6480464 bisphenol S results in increased methylation of ETS1 gene CTD PMID:31601247 Ets1 Rat 4-hydroxynon-2-enal decreases expression ISO ETS1 (Homo sapiens) 6480464 4-hydroxy-2-nonenal results in decreased expression of ETS1 mRNA CTD PMID:12419474 Ets1 Rat 4-hydroxyphenyl retinamide increases expression ISO Ets1 (Mus musculus) 6480464 Fenretinide results in increased expression of ETS1 mRNA CTD PMID:28973697 Ets1 Rat 5-aza-2'-deoxycytidine increases expression ISO ETS1 (Homo sapiens) 6480464 Decitabine results in increased expression of ETS1 mRNA and Decitabine results in increased expression of ETS1 protein CTD PMID:19027835 Ets1 Rat 5-azacytidine multiple interactions ISO ETS1 (Homo sapiens) 6480464 Azacitidine promotes the reaction [ETS1 protein binds to KIR2DL2 promoter] and Azacitidine promotes the reaction [ETS1 protein binds to KIR2DL4 promoter] CTD PMID:18945643 Ets1 Rat 5-fluorouracil multiple interactions ISO ETS1 (Homo sapiens) 6480464 TP53 protein affects the reaction [Fluorouracil results in decreased expression of ETS1 mRNA] CTD PMID:15016801 Ets1 Rat 5-fluorouracil increases expression ISO ETS1 (Homo sapiens) 6480464 Fluorouracil results in increased expression of ETS1 protein CTD PMID:30177839 Ets1 Rat 8'-apo-beta,psi-caroten-8'-al decreases expression ISO ETS1 (Homo sapiens) 6480464 apocarotenal results in decreased expression of ETS1 mRNA CTD PMID:17034753 Ets1 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of ETS1 mRNA CTD PMID:31881176 Ets1 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of ETS1 mRNA CTD PMID:28959563 Ets1 Rat aflatoxin B1 increases expression ISO ETS1 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of ETS1 mRNA CTD PMID:22100608 and PMID:27153756 Ets1 Rat aflatoxin B1 decreases methylation ISO ETS1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of ETS1 gene CTD PMID:27153756 Ets1 Rat aflatoxin M1 decreases expression ISO ETS1 (Homo sapiens) 6480464 Aflatoxin M1 results in decreased expression of ETS1 mRNA CTD PMID:30928695 Ets1 Rat all-trans-retinoic acid increases expression ISO Ets1 (Mus musculus) 6480464 Tretinoin results in increased expression of ETS1 mRNA CTD PMID:16211290 Ets1 Rat all-trans-retinoic acid increases expression ISO ETS1 (Homo sapiens) 6480464 Tretinoin results in increased expression of ETS1 mRNA CTD PMID:33167477 Ets1 Rat all-trans-retinoic acid multiple interactions ISO Ets1 (Mus musculus) 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of ETS1 mRNA CTD PMID:30951980 Ets1 Rat alpha-Zearalanol increases expression EXP 6480464 Zeranol results in increased expression of ETS1 mRNA CTD PMID:35163327 Ets1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of ETS1 mRNA CTD PMID:16483693 Ets1 Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of ETS1 mRNA CTD PMID:30779732 Ets1 Rat antimycin A increases expression ISO ETS1 (Homo sapiens) 6480464 Antimycin A results in increased expression of ETS1 mRNA CTD PMID:33512557 Ets1 Rat aripiprazole multiple interactions ISO ETS1 (Homo sapiens) 6480464 [Aripiprazole co-treated with Ozone] results in increased expression of ETS1 mRNA CTD PMID:31476115 Ets1 Rat aristolochic acid A decreases expression ISO ETS1 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of ETS1 mRNA CTD PMID:33212167 Ets1 Rat arsane multiple interactions ISO ETS1 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in increased expression of ETS1 mRNA CTD PMID:32525701 Ets1 Rat arsenic atom multiple interactions ISO ETS1 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in increased expression of ETS1 mRNA CTD PMID:32525701 Ets1 Rat arsenite(3-) multiple interactions ISO ETS1 (Homo sapiens) 6480464 arsenite promotes the reaction [ETS1 protein binds to IKBKB promoter] more ... CTD PMID:30177839 Ets1 Rat arsenite(3-) increases expression ISO ETS1 (Homo sapiens) 6480464 arsenite results in increased expression of ETS1 mRNA and arsenite results in increased expression of ETS1 protein CTD PMID:30177839 Ets1 Rat arsenous acid decreases expression ISO ETS1 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of ETS1 mRNA CTD PMID:20458559 Ets1 Rat belinostat increases expression ISO ETS1 (Homo sapiens) 6480464 belinostat results in increased expression of ETS1 mRNA CTD PMID:26272509 Ets1 Rat belinostat multiple interactions ISO ETS1 (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ETS1 mRNA CTD PMID:27188386 Ets1 Rat benzo[a]pyrene decreases expression ISO Ets1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of ETS1 mRNA CTD PMID:19770486 and PMID:21569818 Ets1 Rat benzo[a]pyrene increases expression ISO ETS1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of ETS1 mRNA CTD PMID:32234424 Ets1 Rat benzo[a]pyrene increases methylation ISO ETS1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of ETS1 promoter CTD PMID:27901495 Ets1 Rat benzo[a]pyrene affects methylation ISO ETS1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of ETS1 5' UTR and Benzo(a)pyrene affects the methylation of ETS1 intron CTD PMID:27901495 and PMID:30157460 Ets1 Rat Benzo[k]fluoranthene increases expression ISO ETS1 (Homo sapiens) 6480464 benzo(k)fluoranthene results in increased expression of ETS1 mRNA CTD PMID:21635667 Ets1 Rat Benzo[k]fluoranthene multiple interactions ISO ETS1 (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [benzo(k)fluoranthene results in increased expression of ETS1 mRNA] and SB 203580 inhibits the reaction [benzo(k)fluoranthene results in increased expression of ETS1 mRNA] CTD PMID:21635667 Ets1 Rat benzophenanthridine decreases expression ISO ETS1 (Homo sapiens) 6480464 Benzophenanthridines analog results in decreased expression of ETS1 mRNA CTD PMID:23117580 Ets1 Rat beta-lapachone increases expression ISO ETS1 (Homo sapiens) 6480464 beta-lapachone results in increased expression of ETS1 mRNA CTD PMID:38218311 Ets1 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Ets1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of ETS1 mRNA CTD PMID:34319233 Ets1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ETS1 mRNA CTD PMID:18180321 Ets1 Rat bisphenol A decreases methylation ISO ETS1 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of ETS1 gene CTD PMID:31601247 Ets1 Rat bisphenol A decreases expression ISO ETS1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of ETS1 mRNA CTD PMID:29275510 Ets1 Rat bisphenol A increases expression ISO Ets1 (Mus musculus) 6480464 bisphenol A results in increased expression of ETS1 mRNA CTD PMID:30951980 Ets1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of ETS1 mRNA CTD PMID:25181051 Ets1 Rat bisphenol F multiple interactions ISO Ets1 (Mus musculus) 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of ETS1 mRNA CTD PMID:30951980 Ets1 Rat bisphenol F increases expression ISO Ets1 (Mus musculus) 6480464 bisphenol F results in increased expression of ETS1 mRNA CTD PMID:30951980 Ets1 Rat bleomycin A2 decreases expression ISO Ets1 (Mus musculus) 6480464 Bleomycin results in decreased expression of ETS1 mRNA CTD PMID:28726637 Ets1 Rat butan-1-ol multiple interactions ISO ETS1 (Homo sapiens) 6480464 [[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in increased expression of ETS1 mRNA CTD PMID:29432896 Ets1 Rat Butylbenzyl phthalate multiple interactions ISO ETS1 (Homo sapiens) 6480464 butylbenzyl phthalate promotes the reaction [ETS1 protein binds to MMP3 promoter] more ... CTD PMID:33965509 Ets1 Rat cadmium atom multiple interactions ISO ETS1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of ETS1 mRNA CTD PMID:35301059 Ets1 Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of ETS1 mRNA CTD PMID:33453195 Ets1 Rat cadmium dichloride multiple interactions ISO ETS1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of ETS1 mRNA CTD PMID:35301059 Ets1 Rat cadmium dichloride increases expression ISO ETS1 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of ETS1 mRNA CTD PMID:32512071 Ets1 Rat carbon nanotube decreases expression ISO Ets1 (Mus musculus) 6480464 Nanotubes and Carbon analog results in decreased expression of ETS1 mRNA CTD PMID:25554681 Ets1 Rat CGP 52608 multiple interactions ISO ETS1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to ETS1 gene] CTD PMID:28238834 Ets1 Rat chlordecone multiple interactions ISO ETS1 (Homo sapiens) 6480464 Chlordecone inhibits the reaction [ESR1 protein binds to ETS1 promoter] CTD PMID:33837044 Ets1 Rat chloroprene decreases expression ISO Ets1 (Mus musculus) 6480464 Chloroprene results in decreased expression of ETS1 mRNA CTD PMID:23125180 Ets1 Rat chlorpyrifos increases expression ISO Ets1 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of ETS1 mRNA CTD PMID:37019170 Ets1 Rat cisplatin multiple interactions ISO ETS1 (Homo sapiens) 6480464 Cisplatin promotes the reaction [jinfukang results in decreased expression of ETS1 mRNA] and jinfukang promotes the reaction [Cisplatin results in decreased expression of ETS1 mRNA] CTD PMID:27392435 Ets1 Rat cisplatin decreases expression ISO ETS1 (Homo sapiens) 6480464 Cisplatin results in decreased expression of ETS1 mRNA CTD PMID:27392435 Ets1 Rat copper atom multiple interactions ISO ETS1 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which affects the expression of ETS1 mRNA more ... CTD PMID:20971185 more ... Ets1 Rat copper atom increases expression EXP 6480464 Copper results in increased expression of ETS1 mRNA CTD PMID:30556269 Ets1 Rat copper(0) multiple interactions ISO ETS1 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which affects the expression of ETS1 mRNA more ... CTD PMID:20971185 more ... Ets1 Rat copper(0) increases expression EXP 6480464 Copper results in increased expression of ETS1 mRNA CTD PMID:30556269 Ets1 Rat corn oil decreases expression EXP 6480464 Corn Oil results in decreased expression of ETS1 mRNA CTD PMID:22760963 Ets1 Rat crocidolite asbestos increases expression ISO ETS1 (Homo sapiens) 6480464 Asbestos and Crocidolite results in increased expression of ETS1 mRNA CTD PMID:18687144 Ets1 Rat cumene decreases expression ISO Ets1 (Mus musculus) 6480464 cumene results in decreased expression of ETS1 mRNA CTD PMID:18648096 Ets1 Rat cumene increases expression ISO Ets1 (Mus musculus) 6480464 cumene results in increased expression of ETS1 mRNA CTD PMID:18648096 Ets1 Rat cyclosporin A increases expression ISO ETS1 (Homo sapiens) 6480464 Cyclosporine results in increased expression of ETS1 mRNA CTD PMID:20106945 and PMID:27989131 Ets1 Rat cyclosporin A decreases expression ISO ETS1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of ETS1 mRNA CTD PMID:33631201 Ets1 Rat DDE decreases expression ISO ETS1 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of ETS1 mRNA CTD PMID:38568856 Ets1 Rat deguelin increases expression ISO ETS1 (Homo sapiens) 6480464 deguelin results in increased expression of ETS1 mRNA CTD PMID:33512557 Ets1 Rat dexamethasone decreases expression EXP 6480464 Dexamethasone results in decreased expression of ETS1 mRNA CTD PMID:14618091 Ets1 Rat diarsenic trioxide decreases expression ISO ETS1 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of ETS1 mRNA CTD PMID:20458559 Ets1 Rat diazinon affects expression EXP 6480464 Diazinon affects the expression of ETS1 mRNA CTD PMID:22546817 Ets1 Rat Dibutyl phosphate affects expression ISO ETS1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of ETS1 mRNA CTD PMID:37042841 Ets1 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of ETS1 mRNA CTD PMID:21266533 Ets1 Rat dibutyl phthalate increases expression ISO Ets1 (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of ETS1 mRNA CTD PMID:21266533 Ets1 Rat diethylstilbestrol decreases expression EXP 6480464 Diethylstilbestrol results in decreased expression of ETS1 mRNA CTD PMID:37077353 Ets1 Rat dimethylarsinic acid multiple interactions ISO Ets1 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of ETS1 mRNA CTD PMID:34876320 Ets1 Rat dioxygen increases expression ISO ETS1 (Homo sapiens) 6480464 Oxygen deficiency results in increased expression of ETS1 mRNA CTD PMID:20042640 Ets1 Rat diquat decreases expression ISO Ets1 (Mus musculus) 6480464 Diquat results in decreased expression of ETS1 mRNA CTD PMID:36851058 Ets1 Rat disulfiram multiple interactions ISO ETS1 (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in increased expression of ETS1 mRNA CTD PMID:24690739 Ets1 Rat diuron increases expression EXP 6480464 Diuron results in increased expression of ETS1 mRNA CTD PMID:21551480 Ets1 Rat diuron decreases expression ISO ETS1 (Homo sapiens) 6480464 Diuron results in decreased expression of ETS1 mRNA CTD PMID:35967413 Ets1 Rat dorsomorphin multiple interactions ISO ETS1 (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Ets1 Rat doxorubicin decreases expression ISO ETS1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of ETS1 mRNA CTD PMID:29803840 Ets1 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of ETS1 mRNA CTD PMID:29391264 Ets1 Rat ethanol multiple interactions ISO ETS1 (Homo sapiens) 6480464 [[Gasoline co-treated with Ethanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in increased expression of ETS1 mRNA CTD PMID:29432896 Ets1 Rat ethanol increases expression ISO Ets1 (Mus musculus) 6480464 Ethanol results in increased expression of ETS1 mRNA CTD PMID:30319688 Ets1 Rat etoposide multiple interactions ISO ETS1 (Homo sapiens) 6480464 DAPK1 protein promotes the reaction [Etoposide results in increased expression of ETS1 protein] more ... CTD PMID:30177839 Ets1 Rat etoposide increases expression ISO ETS1 (Homo sapiens) 6480464 Etoposide results in increased expression of ETS1 protein CTD PMID:30177839 Ets1 Rat fenamidone increases expression ISO Ets1 (Mus musculus) 6480464 fenamidone results in increased expression of ETS1 mRNA CTD PMID:27029645 Ets1 Rat flavonoids increases expression ISO ETS1 (Homo sapiens) 6480464 Flavonoids results in increased expression of ETS1 mRNA CTD PMID:15465739 Ets1 Rat geldanamycin increases expression ISO ETS1 (Homo sapiens) 6480464 geldanamycin results in increased expression of ETS1 mRNA CTD PMID:26705709 Ets1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of ETS1 mRNA CTD PMID:22061828 Ets1 Rat GW 7647 decreases expression EXP 6480464 GW 7647 results in decreased expression of ETS1 mRNA CTD PMID:31628012 Ets1 Rat hydrogen peroxide affects expression ISO ETS1 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of ETS1 mRNA CTD PMID:21179406 Ets1 Rat hydrogen peroxide decreases expression ISO ETS1 (Homo sapiens) 6480464 Hydrogen Peroxide results in decreased expression of ETS1 protein CTD PMID:24107596 Ets1 Rat hydrogen peroxide multiple interactions ISO ETS1 (Homo sapiens) 6480464 ETS1 protein promotes the reaction [resveratrol inhibits the reaction [Hydrogen Peroxide results in decreased expression of MIR126 mRNA]] and resveratrol inhibits the reaction [Hydrogen Peroxide results in decreased expression of ETS1 protein] CTD PMID:24107596 Ets1 Rat Indeno[1,2,3-cd]pyrene multiple interactions ISO ETS1 (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [indeno(1 more ... CTD PMID:21635667 Ets1 Rat Indeno[1,2,3-cd]pyrene increases expression ISO ETS1 (Homo sapiens) 6480464 indeno(1 more ... CTD PMID:21635667 Ets1 Rat ketoconazole decreases expression EXP 6480464 Ketoconazole results in decreased expression of ETS1 mRNA CTD PMID:37077353 Ets1 Rat leflunomide increases expression ISO ETS1 (Homo sapiens) 6480464 leflunomide results in increased expression of ETS1 mRNA CTD PMID:28988120 Ets1 Rat mercury dibromide increases expression ISO ETS1 (Homo sapiens) 6480464 mercuric bromide results in increased expression of ETS1 mRNA CTD PMID:26272509 Ets1 Rat mercury dibromide multiple interactions ISO ETS1 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ETS1 mRNA CTD PMID:27188386 Ets1 Rat methidathion decreases expression ISO Ets1 (Mus musculus) 6480464 methidathion results in decreased expression of ETS1 mRNA CTD PMID:34813904 Ets1 Rat methyl methanesulfonate decreases expression ISO ETS1 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of ETS1 mRNA CTD PMID:23649840 Ets1 Rat methylarsonic acid multiple interactions ISO Ets1 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of ETS1 mRNA CTD PMID:34876320 Ets1 Rat methylmercury chloride increases expression ISO ETS1 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of ETS1 mRNA CTD PMID:26272509 and PMID:28001369 Ets1 Rat mibolerone multiple interactions ISO ETS1 (Homo sapiens) 6480464 [mibolerone binds to and results in increased activity of AR protein] inhibits the reaction [ETS1 protein results in increased expression of MMP1 mRNA] CTD PMID:8798622 Ets1 Rat N-acetyl-L-cysteine multiple interactions ISO ETS1 (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [benz(a)anthracene results in increased expression of ETS1 mRNA] more ... CTD PMID:21635667 Ets1 Rat N-methyl-N'-nitro-N-nitrosoguanidine increases expression ISO ETS1 (Homo sapiens) 6480464 Methylnitronitrosoguanidine results in increased expression of ETS1 mRNA CTD PMID:12634122 Ets1 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in decreased expression of ETS1 mRNA CTD PMID:20360939 Ets1 Rat nickel atom increases expression ISO ETS1 (Homo sapiens) 6480464 Nickel results in increased expression of ETS1 mRNA CTD PMID:25583101 Ets1 Rat nickel atom multiple interactions EXP 6480464 [nickel sulfate results in increased abundance of Nickel] which results in increased expression of ETS1 mRNA CTD PMID:31734292 Ets1 Rat nickel sulfate multiple interactions EXP 6480464 [nickel sulfate results in increased abundance of Nickel] which results in increased expression of ETS1 mRNA CTD PMID:31734292 Ets1 Rat ouabain decreases expression ISO ETS1 (Homo sapiens) 6480464 Ouabain results in decreased expression of ETS1 mRNA CTD PMID:28795476 Ets1 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of ETS1 mRNA CTD PMID:25729387 Ets1 Rat ozone multiple interactions ISO ETS1 (Homo sapiens) 6480464 [Aripiprazole co-treated with Ozone] results in increased expression of ETS1 mRNA CTD PMID:31476115 Ets1 Rat ozone multiple interactions ISO Ets1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of ETS1 mRNA CTD PMID:34911549 Ets1 Rat ozone increases expression ISO ETS1 (Homo sapiens) 6480464 Ozone results in increased expression of ETS1 mRNA CTD PMID:31476115 Ets1 Rat p-toluidine decreases expression EXP 6480464 4-toluidine results in decreased expression of ETS1 mRNA CTD PMID:27638505 Ets1 Rat panobinostat increases expression ISO ETS1 (Homo sapiens) 6480464 panobinostat results in increased expression of ETS1 mRNA CTD PMID:26272509 Ets1 Rat panobinostat multiple interactions ISO ETS1 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ETS1 mRNA CTD PMID:27188386 Ets1 Rat paracetamol affects expression ISO Ets1 (Mus musculus) 6480464 Acetaminophen affects the expression of ETS1 mRNA CTD PMID:17562736 Ets1 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of ETS1 mRNA CTD PMID:33387578 Ets1 Rat paracetamol increases expression ISO ETS1 (Homo sapiens) 6480464 Acetaminophen results in increased expression of ETS1 mRNA CTD PMID:29067470 Ets1 Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of ETS1 mRNA CTD PMID:18198484 Ets1 Rat PD 0325901 multiple interactions ISO ETS1 (Homo sapiens) 6480464 [mirdametinib co-treated with (+)-JQ1 compound] results in decreased expression of ETS1 mRNA CTD PMID:25119042 Ets1 Rat phenethyl caffeate multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in decreased expression of ETS1 mRNA CTD PMID:20360939 Ets1 Rat phenylmercury acetate increases expression ISO ETS1 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of ETS1 mRNA CTD PMID:26272509 Ets1 Rat phenylmercury acetate multiple interactions ISO ETS1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ETS1 mRNA CTD PMID:27188386 Ets1 Rat potassium dichromate increases expression ISO Ets1 (Mus musculus) 6480464 Potassium Dichromate results in increased expression of ETS1 mRNA CTD PMID:23608068 Ets1 Rat rac-lactic acid increases expression ISO ETS1 (Homo sapiens) 6480464 Lactic Acid results in increased expression of ETS1 mRNA CTD PMID:30851411 Ets1 Rat Rebamipide increases expression EXP 6480464 rebamipide results in increased expression of ETS1 mRNA CTD PMID:15104358 Ets1 Rat resveratrol multiple interactions ISO ETS1 (Homo sapiens) 6480464 ETS1 protein promotes the reaction [resveratrol inhibits the reaction [Hydrogen Peroxide results in decreased expression of MIR126 mRNA]] and resveratrol inhibits the reaction [Hydrogen Peroxide results in decreased expression of ETS1 protein] CTD PMID:24107596 Ets1 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of ETS1 mRNA CTD PMID:27900601 Ets1 Rat SB 203580 multiple interactions ISO ETS1 (Homo sapiens) 6480464 SB 203580 inhibits the reaction [benz(a)anthracene results in increased expression of ETS1 mRNA] more ... CTD PMID:21635667 Ets1 Rat SB 431542 multiple interactions ISO ETS1 (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Ets1 Rat silicon dioxide increases expression ISO ETS1 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of ETS1 mRNA CTD PMID:23806026 and PMID:25895662 Ets1 Rat silver atom increases expression ISO ETS1 (Homo sapiens) 6480464 Silver results in increased expression of ETS1 mRNA CTD PMID:28959546 Ets1 Rat silver(0) increases expression ISO ETS1 (Homo sapiens) 6480464 Silver results in increased expression of ETS1 mRNA CTD PMID:28959546 Ets1 Rat sodium arsenate multiple interactions ISO ETS1 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in increased expression of ETS1 mRNA CTD PMID:32525701 Ets1 Rat sodium arsenate multiple interactions ISO Ets1 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of ETS1 mRNA CTD PMID:34876320 Ets1 Rat sodium arsenate increases expression ISO Ets1 (Mus musculus) 6480464 sodium arsenate results in increased expression of ETS1 mRNA CTD PMID:21795629 Ets1 Rat sodium arsenite increases expression ISO ETS1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of ETS1 mRNA CTD PMID:12760830 Ets1 Rat sodium arsenite multiple interactions ISO Ets1 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of ETS1 mRNA CTD PMID:34876320 Ets1 Rat sodium arsenite decreases expression ISO Ets1 (Mus musculus) 6480464 sodium arsenite results in decreased expression of ETS1 mRNA CTD PMID:16322246 Ets1 Rat Soman increases expression EXP 6480464 Soman results in increased expression of ETS1 mRNA CTD PMID:19281266 Ets1 Rat spironolactone increases expression EXP 6480464 Spironolactone results in increased expression of ETS1 protein CTD PMID:20228418 Ets1 Rat streptozocin multiple interactions ISO ETS1 (Homo sapiens) 6480464 SOD1 protein inhibits the reaction [Streptozocin results in decreased expression of ETS1 mRNA] CTD PMID:27629361 Ets1 Rat streptozocin decreases expression ISO Ets1 (Mus musculus) 6480464 Streptozocin results in decreased expression of ETS1 mRNA CTD PMID:27629361 Ets1 Rat sulindac increases expression ISO ETS1 (Homo sapiens) 6480464 Sulindac results in increased expression of ETS1 mRNA CTD PMID:11906190 Ets1 Rat tebufenpyrad increases expression ISO ETS1 (Homo sapiens) 6480464 4-chloro-N-((4-(1 and 1-dimethylethyl)phenyl)methyl)-3-ethyl-1-methyl-1H-pyrazole-5-carboxamide results in increased expression of ETS1 mRNA CTD PMID:33512557 Ets1 Rat tert-butyl hydroperoxide decreases expression ISO ETS1 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of ETS1 mRNA CTD PMID:12419474 Ets1 Rat tetrachloromethane decreases expression ISO Ets1 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of ETS1 mRNA CTD PMID:17484886 Ets1 Rat tetraphene multiple interactions ISO ETS1 (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [benz(a)anthracene results in increased expression of ETS1 mRNA] and SB 203580 inhibits the reaction [benz(a)anthracene results in increased expression of ETS1 mRNA] CTD PMID:21635667 Ets1 Rat tetraphene increases expression ISO ETS1 (Homo sapiens) 6480464 benz(a)anthracene results in increased expression of ETS1 mRNA CTD PMID:21635667 Ets1 Rat thifluzamide increases expression ISO ETS1 (Homo sapiens) 6480464 thifluzamide results in increased expression of ETS1 mRNA CTD PMID:33512557 Ets1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of ETS1 mRNA CTD PMID:34492290 Ets1 Rat thiram increases expression ISO ETS1 (Homo sapiens) 6480464 Thiram results in increased expression of ETS1 mRNA CTD PMID:38568856 Ets1 Rat titanium dioxide decreases expression ISO Ets1 (Mus musculus) 6480464 titanium dioxide results in decreased expression of ETS1 mRNA CTD PMID:27760801 Ets1 Rat toluene increases expression EXP 6480464 Toluene results in increased expression of ETS1 mRNA CTD PMID:22967744 Ets1 Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of ETS1 mRNA CTD PMID:25729387 Ets1 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of ETS1 mRNA CTD PMID:25729387 Ets1 Rat Tributyltin oxide decreases expression EXP 6480464 bis(tri-n-butyltin)oxide results in decreased expression of ETS1 mRNA CTD PMID:17553608 Ets1 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of ETS1 mRNA CTD PMID:33387578 Ets1 Rat trichostatin A increases expression ISO ETS1 (Homo sapiens) 6480464 trichostatin A results in increased expression of ETS1 mRNA CTD PMID:24935251 and PMID:26272509 Ets1 Rat trichostatin A multiple interactions ISO ETS1 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ETS1 mRNA CTD PMID:27188386 Ets1 Rat triphenyl phosphate affects expression ISO ETS1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of ETS1 mRNA CTD PMID:37042841 Ets1 Rat tungsten decreases expression ISO Ets1 (Mus musculus) 6480464 Tungsten results in decreased expression of ETS1 mRNA CTD PMID:30912803 Ets1 Rat valproic acid decreases methylation ISO ETS1 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of ETS1 gene CTD PMID:29154799 Ets1 Rat valproic acid multiple interactions ISO ETS1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ETS1 mRNA CTD PMID:27188386 Ets1 Rat valproic acid increases expression ISO ETS1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of ETS1 mRNA CTD PMID:19101580 more ... Ets1 Rat valproic acid affects expression ISO ETS1 (Homo sapiens) 6480464 Valproic Acid affects the expression of ETS1 mRNA CTD PMID:25979313 Ets1 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of ETS1 mRNA CTD PMID:19015723 Ets1 Rat vorinostat increases expression ISO ETS1 (Homo sapiens) 6480464 vorinostat results in increased expression of ETS1 mRNA CTD PMID:26272509 Ets1 Rat vorinostat multiple interactions ISO ETS1 (Homo sapiens) 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ETS1 mRNA CTD PMID:27188386 Ets1 Rat zinc atom multiple interactions ISO ETS1 (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of ETS1 mRNA CTD PMID:18593933 Ets1 Rat zinc(0) multiple interactions ISO ETS1 (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of ETS1 mRNA CTD PMID:18593933 Ets1 Rat zoledronic acid increases expression ISO ETS1 (Homo sapiens) 6480464 zoledronic acid results in increased expression of ETS1 mRNA CTD PMID:24714768
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (EXP) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-butoxyethanol (ISO) 2-hydroxypropanoic acid (ISO) 2-methylcholine (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3H-1,2-dithiole-3-thione (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxynon-2-enal (ISO) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (ISO) 5-azacytidine (ISO) 5-fluorouracil (ISO) 8'-apo-beta,psi-caroten-8'-al (ISO) acetamide (EXP) acrylamide (EXP) aflatoxin B1 (ISO) aflatoxin M1 (ISO) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) ammonium chloride (EXP) amphetamine (EXP) antimycin A (ISO) aripiprazole (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) belinostat (ISO) benzo[a]pyrene (ISO) Benzo[k]fluoranthene (ISO) benzophenanthridine (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) bleomycin A2 (ISO) butan-1-ol (ISO) Butylbenzyl phthalate (ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) carbon nanotube (ISO) CGP 52608 (ISO) chlordecone (ISO) chloroprene (ISO) chlorpyrifos (ISO) cisplatin (ISO) copper atom (EXP,ISO) copper(0) (EXP,ISO) corn oil (EXP) crocidolite asbestos (ISO) cumene (ISO) cyclosporin A (ISO) DDE (ISO) deguelin (ISO) dexamethasone (EXP) diarsenic trioxide (ISO) diazinon (EXP) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) diethylstilbestrol (EXP) dimethylarsinic acid (ISO) dioxygen (ISO) diquat (ISO) disulfiram (ISO) diuron (EXP,ISO) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (EXP) ethanol (ISO) etoposide (ISO) fenamidone (ISO) flavonoids (ISO) geldanamycin (ISO) gentamycin (EXP) GW 7647 (EXP) hydrogen peroxide (ISO) Indeno[1,2,3-cd]pyrene (ISO) ketoconazole (EXP) leflunomide (ISO) mercury dibromide (ISO) methidathion (ISO) methyl methanesulfonate (ISO) methylarsonic acid (ISO) methylmercury chloride (ISO) mibolerone (ISO) N-acetyl-L-cysteine (ISO) N-methyl-N'-nitro-N-nitrosoguanidine (ISO) N-nitrosodiethylamine (EXP) nickel atom (EXP,ISO) nickel sulfate (EXP) ouabain (ISO) oxaliplatin (EXP) ozone (ISO) p-toluidine (EXP) panobinostat (ISO) paracetamol (EXP,ISO) paraquat (EXP) PD 0325901 (ISO) phenethyl caffeate (EXP) phenylmercury acetate (ISO) potassium dichromate (ISO) rac-lactic acid (ISO) Rebamipide (EXP) resveratrol (ISO) rotenone (EXP) SB 203580 (ISO) SB 431542 (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenate (ISO) sodium arsenite (ISO) Soman (EXP) spironolactone (EXP) streptozocin (ISO) sulindac (ISO) tebufenpyrad (ISO) tert-butyl hydroperoxide (ISO) tetrachloromethane (ISO) tetraphene (ISO) thifluzamide (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) toluene (EXP) topotecan (EXP) Tributyltin oxide (EXP) trichloroethene (EXP) trichostatin A (ISO) triphenyl phosphate (ISO) tungsten (ISO) valproic acid (ISO) vinclozolin (EXP) vorinostat (ISO) zinc atom (ISO) zinc(0) (ISO) zoledronic acid (ISO)
Biological Process
angiogenesis involved in wound healing (IEP) cell differentiation (IBA) cell motility (IEA,ISO) cellular response to hydrogen peroxide (IEP) estrous cycle (IEP) female pregnancy (IEP) hypothalamus development (IEP) immune system process (IEA) negative regulation of cell cycle (ISO) negative regulation of inflammatory response (ISO) pituitary gland development (IEP) PML body organization (IEA,ISO) positive regulation of angiogenesis (IEA,IMP,ISO) positive regulation of blood vessel endothelial cell migration (IEA,ISO) positive regulation of cell migration (IMP) positive regulation of cell population proliferation (IMP) positive regulation of DNA-templated transcription (IEA,ISO,ISS) positive regulation of endothelial cell migration (IEA,ISO,ISS) positive regulation of erythrocyte differentiation (IEA,ISO,ISS) positive regulation of gene expression (IEA,ISO) positive regulation of inflammatory response (IEA,ISO) positive regulation of leukocyte adhesion to vascular endothelial cell (IEA,ISO) positive regulation of miRNA transcription (IEA,ISO) positive regulation of transcription by RNA polymerase II (IEA,ISO) regulation of angiogenesis (IEA,ISO,ISS) regulation of apoptotic process (ISO) regulation of DNA-templated transcription (IEA) regulation of extracellular matrix disassembly (IMP) regulation of transcription by RNA polymerase II (IBA,IEA,ISO) response to antibiotic (ISO) response to estradiol (IEP) response to hypoxia (IEP) response to interleukin-1 (IEP) response to laminar fluid shear stress (IEP) response to mechanical stimulus (IEP) response to salt (IEP) transcription by RNA polymerase II (ISO)
Molecular Function
DNA binding (IEA,ISO,ISS) DNA-binding transcription activator activity, RNA polymerase II-specific (IEA,ISO) DNA-binding transcription factor activity (IEA,ISO,ISS) DNA-binding transcription factor activity, RNA polymerase II-specific (IBA,IEA,ISO) DNA-binding transcription factor binding (ISO) histone acetyltransferase binding (IPI) identical protein binding (IEA,ISO) nucleic acid binding (ISO) protein binding (IPI,ISO) RNA polymerase II cis-regulatory region sequence-specific DNA binding (IEA,ISO) RNA polymerase II-specific DNA-binding transcription factor binding (IEA,ISO) sequence-specific DNA binding (IDA,IEA,ISO) sequence-specific double-stranded DNA binding (ISO) transcription cis-regulatory region binding (IEA,ISO) transcription corepressor binding (IEA,ISO)
1.
Cellular basis of diabetic nephropathy: V. Endoglin expression levels and diabetic nephropathy risk in patients with Type 1 diabetes.
Alvarez-Munoz P, etal., J Diabetes Complications. 2009 Apr 21.
2.
HLA and non-HLA genetic factors in Japanese IDDM.
Aparicio JM Hokkaido Igaku Zasshi. 1991 Nov;66(6):780-93.
3.
Non-HLA genetic factors and insulin dependent diabetes mellitus in the Japanese: TCRA, TCRB and TCRG, INS, THY1, CD3D and ETS1.
Aparicio JM, etal., Dis Markers. 1990 Sep-Oct;8(5):283-94.
4.
Effects of provirus integration in the Tpl-1/Ets-1 locus in Moloney murine leukemia virus-induced rat T-cell lymphomas: levels of expression, polyadenylation, transcriptional initiation, and differential splicing of the Ets-1 mRNA.
Bellacosa A, etal., J Virol 1994 Apr;68(4):2320-30.
5.
Peroxide-inducible Ets-1 mediates platelet-derived growth factor receptor-alpha gene transcription in vascular smooth muscle cells.
Bonello MR, etal., Am J Pathol. 2005 Oct;167(4):1149-59.
6.
Coordinated expression of Ets-1, pERK1/2, and VEGF in retina of streptozotocin-induced diabetic rats.
Du ZJ, etal., Ophthalmic Res. 2007;39(4):224-31. Epub 2007 Jun 29.
7.
Glucocorticoid-mediated suppression of cytokine-induced matrix metalloproteinase-9 expression in rat mesangial cells: involvement of nuclear factor-kappaB and Ets transcription factors.
Eberhardt W, etal., Mol Endocrinol. 2002 Aug;16(8):1752-66.
8.
Avian erythroblastosis virus E26 oncogene homolog-1 (ETS-1) plays a role in renal microvascular pathophysiology in the Dahl salt-sensitive rat.
Feng W, etal., Kidney Int. 2020 Mar;97(3):528-537. doi: 10.1016/j.kint.2019.09.025. Epub 2019 Oct 22.
9.
Mutant p53: one name, many proteins.
Freed-Pastor WA and Prives C, Genes Dev. 2012 Jun 15;26(12):1268-86. doi: 10.1101/gad.190678.112.
10.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
11.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
12.
The transcription factor ETS-1 regulates angiotensin II-stimulated fibronectin production in mesangial cells.
Hua P, etal., Am J Physiol Renal Physiol. 2012 Jun 1;302(11):F1418-29. doi: 10.1152/ajprenal.00477.2011. Epub 2012 Feb 22.
13.
Regulated expression of the ets-1 transcription factor in vascular smooth muscle cells in vivo and in vitro.
Hultgardh-Nilsson A, etal., Circ Res. 1996 Apr;78(4):589-95.
14.
Expression of Ets-1 transcription factor in relation to angiogenesis in the healing process of gastric ulcer.
Ito M, etal., Biochem Biophys Res Commun. 1998 May 8;246(1):123-7.
15.
High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.
Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
16.
Expression of the c-ets1 gene in the hypothalamus and pituitary during rat development.
Laurent-Huck FM, etal., Brain Res Dev Brain Res. 1996 Nov 22;97(1):107-17.
17.
Estrogen-induced Ets-1 promotes capillary formation in an in vitro tumor angiogenesis model.
Lincoln DW 2nd, etal., Breast Cancer Res Treat. 2003 Mar;78(2):167-78.
18.
Shear stress-induced Ets-1 modulates protease inhibitor expression in microvascular endothelial cells.
Milkiewicz M, etal., J Cell Physiol. 2008 Nov;217(2):502-10.
19.
Transcription factor Ets-1 is essential for mesangial matrix remodeling.
Mizui M, etal., Kidney Int. 2006 Jul;70(2):298-305. Epub 2006 May 31.
20.
Expression of matrix metalloproteinase-9 associated with ets-1 proto-oncogene in rat tubulointerstitial cells.
Naito T, etal., Nephrol Dial Transplant. 2005 Nov;20(11):2333-48. Epub 2005 Jul 26.
21.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
22.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
23.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
24.
Mechanical strain induces osteogenic differentiation: Cbfa1 and Ets-1 expression in stretched rat mesenchymal stem cells.
Qi MC, etal., Int J Oral Maxillofac Surg. 2008 May;37(5):453-8. Epub 2008 Feb 12.
25.
GOA pipeline
RGD automated data pipeline
26.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
27.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
28.
Inactivation of Ets 1 transcription factor by a specific decoy strategy reduces rat C6 glioma cell proliferation and mmp-9 expression.
Sahin A, etal., Int J Mol Med. 2005 May;15(5):771-6.
29.
Dominant-negative inhibition of Ets 1 suppresses tumor growth, invasion and migration in rat C6 glioma cells and reveals differentially expressed Ets 1 target genes.
Sahin A, etal., Int J Oncol. 2009 Feb;34(2):377-89.
30.
Ets-1 stimulates platelet-derived growth factor A-chain gene transcription and vascular smooth muscle cell growth via cooperative interactions with Sp1.
Santiago FS and Khachigian LM, Circ Res. 2004 Sep 3;95(5):479-87. Epub 2004 Aug 5.
31.
Downregulation of ETS rescues diabetes-induced reduction of endothelial progenitor cells.
Seeger FH, etal., PLoS One. 2009;4(2):e4529. Epub 2009 Feb 19.
32.
Expression and function of Ets-1 during experimental acute renal failure in rats.
Tanaka H, etal., J Am Soc Nephrol. 2004 Dec;15(12):3083-92.
33.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
34.
Selective repression of rat prolactin gene by stable expression of dominant-negative Ets in GH4 pituitary cells.
Tentler JJ, etal., Endocrine 2003 Feb-Mar;20(1-2):3-12.
35.
Diabetes increases both N-ras and ets-1 expression during rat oral oncogenesis resulting in enhanced cell proliferation and metastatic potential.
Vairaktaris E, etal., In Vivo. 2007 Jul-Aug;21(4):615-21.
36.
Thrombin potentiates D-aspartate efflux from cultured astrocytes under conditions of K homeostasis disruption.
Vazquez-Juarez E, etal., J Neurochem. 2009 Oct 3.
37.
Expression and localization of transcription factor Ets-1 in the rat ovary during the estrous cycle and pregnancy.
Xiao X, etal., Fertil Steril. 2009 May;91(5 Suppl):1998-2005. Epub 2008 Apr 25.
38.
Ets-1 protects vascular smooth muscle cells from undergoing apoptosis by activating p21WAF1/Cip1: ETS-1 regulates basal and and inducible p21WAF1/Cip: ETS-1 regulates basal and inducible p21WAF1/Cip1 transcription via distinct cis-acting elements in the p21WAF/Cip1 promoter.
Zhang C, etal., J Biol Chem 2003 Jul 25;278(30):27903-9. Epub 2003 May 9.
Ets1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 39,303,936 - 39,426,022 (+) NCBI GRCr8 mRatBN7.2 8 31,045,909 - 31,168,010 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 31,045,945 - 31,168,010 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 35,176,570 - 35,239,049 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 33,471,056 - 33,533,529 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 31,333,929 - 31,396,429 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 33,756,634 - 33,879,625 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 33,816,386 - 33,879,625 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 33,798,598 - 33,921,593 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 32,481,694 - 32,545,237 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 32,490,458 - 32,553,970 (+) NCBI Celera 8 32,555,513 - 32,617,691 (+) NCBI Celera RH 3.4 Map 8 268.3 RGD Cytogenetic Map 8 q21 NCBI
ETS1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 128,458,765 - 128,587,558 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 128,458,761 - 128,587,558 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 128,328,660 - 128,457,453 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 127,833,870 - 127,897,371 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 11 127,833,871 - 127,897,371 NCBI Celera 11 125,494,962 - 125,623,626 (-) NCBI Celera Cytogenetic Map 11 q24.3 NCBI HuRef 11 124,277,062 - 124,405,816 (-) NCBI HuRef CHM1_1 11 128,214,474 - 128,343,214 (-) NCBI CHM1_1 T2T-CHM13v2.0 11 128,492,108 - 128,620,806 (-) NCBI T2T-CHM13v2.0
Ets1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 32,547,501 - 32,669,116 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 32,547,517 - 32,669,116 (+) Ensembl GRCm39 Ensembl GRCm38 9 32,636,241 - 32,757,820 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 32,636,221 - 32,757,820 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 32,503,627 - 32,565,405 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 32,445,607 - 32,507,385 (+) NCBI MGSCv36 mm8 Celera 9 29,958,312 - 30,019,948 (+) NCBI Celera Cytogenetic Map 9 A4 NCBI cM Map 9 17.97 NCBI
Ets1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955412 29,432,482 - 29,545,580 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955412 29,433,730 - 29,602,389 (-) NCBI ChiLan1.0 ChiLan1.0
ETS1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 129,141,430 - 129,286,926 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 130,248,944 - 130,394,405 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 123,272,111 - 123,400,413 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 127,174,721 - 127,302,834 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 127,174,721 - 127,288,673 (-) Ensembl panpan1.1 panPan2
ETS1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 6,059,023 - 6,189,516 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 6,058,935 - 6,186,232 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 6,115,844 - 6,246,105 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 6,012,469 - 6,143,424 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 6,012,519 - 6,143,417 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 6,071,677 - 6,202,786 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 6,053,510 - 6,184,305 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 6,084,005 - 6,215,159 (+) NCBI UU_Cfam_GSD_1.0
Ets1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 110,654,883 - 110,785,267 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936572 3,730,327 - 3,795,625 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936572 3,728,971 - 3,795,612 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ETS1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 9 55,377,266 - 55,512,115 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 9 55,377,264 - 55,512,180 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 9 61,508,893 - 61,540,092 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ETS1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 1 119,588,476 - 119,736,623 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 1 119,588,448 - 119,652,299 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666043 6,367,577 - 6,503,784 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ets1
.
Predicted Target Of
Count of predictions: 1406 Count of miRNA genes: 334 Interacting mature miRNAs: 430 Transcripts: ENSRNOT00000011925, ENSRNOT00000064687 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
1298065 Scl16 Serum cholesterol level QTL 16 3.8 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30856404 75856404 Rat 1578769 Uae31 Urinary albumin excretion QTL 31 3.3 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 30848154 101699754 Rat 11556286 Cm81 Cardiac mass QTL 81 0.01 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 30848154 61290444 Rat 1578765 Klgr1 Kidney lesion grade QTL 1 3.3 0.0001 kidney morphology trait (VT:0002135) organ lesion measurement (CMO:0000677) 8 30848154 101699754 Rat 1354627 Despr14 Despair related QTL 14 0.0056 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 8 7688955 52688955 Rat 61337 Bp22 Blood pressure QTL 22 5.1 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 30848154 42692818 Rat 1578755 Pur5 Proteinuria QTL 5 3.3 0.0001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 8 30848154 101699754 Rat 1300146 Rf17 Renal function QTL 17 2.9 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 8 28242912 73242912 Rat 8662823 Vetf5 Vascular elastic tissue fragility QTL 5 1.9 artery integrity trait (VT:0010639) patent ductus arteriosus score (CMO:0002566) 8 28242912 99525068 Rat 2313088 Bss75 Bone structure and strength QTL 75 3.1 0.0001 body length (VT:0001256) body length, nose to rump (CMO:0000079) 8 30848154 82460899 Rat 1358896 Bp262 Blood pressure QTL 262 2.89 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 27205715 99103503 Rat 731182 Uae24 Urinary albumin excretion QTL 24 6.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 19331152 93965294 Rat 724514 Uae15 Urinary albumin excretion QTL 15 2.9 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 29502665 70386295 Rat 61353 Bp35 Blood pressure QTL 35 0.001 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 8 30848154 61290444 Rat 631842 Inf1 Infertility severity QTL 1 4.1 0.001 seminal gland mass (VT:0010524) seminal vesicle wet weight (CMO:0001603) 8 22662330 67662330 Rat 1359033 Bp273 Blood pressure QTL 273 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 30848154 61290444 Rat 1358907 Cm40 Cardiac mass QTL 40 1.89 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 27205715 99103503 Rat 1331744 Bp217 Blood pressure QTL 217 3.398 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 30848154 58482492 Rat 2316950 Scl66 Serum cholesterol level QTL 66 4.1 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30848259 105647037 Rat 1358892 Kidm26 Kidney mass QTL 26 3.69 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 27205715 99103503 Rat 1359021 Bp271 Blood pressure QTL 271 1.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 26644912 46711092 Rat 2302367 Slep5 Serum leptin concentration QTL 5 3.43 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 8 9712463 41866876 Rat 61373 Mcs4 Mammary carcinoma susceptibility QTL 4 1.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 8 16290444 61290444 Rat 70206 Alc20 Alcohol consumption QTL 20 2 drinking behavior trait (VT:0001422) ethanol intake volume to total fluid intake volume ratio (CMO:0001591) 8 30848154 40713225 Rat 1357398 Slep3 Serum leptin concentration QTL 3 3.43 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 8 9712463 41866876 Rat 2313057 Bss76 Bone structure and strength QTL 76 3 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 8 30848154 82460899 Rat 1549908 Neudeg1 Neurodegradation QTL 1 5.5 0 nervous system integrity trait (VT:0010566) logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986) 8 30188867 94457446 Rat 2317030 Wbc5 White blood cell count QTL 5 3.21 0.005 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 8 8736635 53736635 Rat 1331804 Cm30 Cardiac mass QTL 30 3.77443 heart mass (VT:0007028) heart wet weight (CMO:0000069) 8 28242912 53961020 Rat 2313067 Bss77 Bone structure and strength QTL 77 3.1 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 8 30848154 82460899 Rat 2317032 Ginf2 Gastrointestinal inflammation QTL 2 3.21 0.005 liver integrity trait (VT:0010547) liver granuloma severity score (CMO:0002157) 8 4705810 49705810 Rat 2301416 Bp315 Blood pressure QTL 315 0.008 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 7670578 52670578 Rat 2317036 Livw3 Liver weight QTL 3 2.43 0.01 liver mass (VT:0003402) liver weight to body weight ratio (CMO:0000633) 8 4705810 49705810 Rat 12880023 Bw184 Body weight QTL 184 0.001 body mass (VT:0001259) body weight (CMO:0000012) 8 2097640 47097640 Rat 12880028 Cm103 Cardiac mass QTL 103 0.02 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 8 2097640 47097640 Rat 2317051 Aia18 Adjuvant induced arthritis QTL 18 2.42 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 8 8736635 53736635 Rat 2317048 Ginf1 Gastrointestinal inflammation QTL 1 3.52 0.005 cecum mucosa thickness (VT:0010234) enterocolitis severity score (CMO:0002138) 8 4705810 49705810 Rat 12880025 Cm102 Cardiac mass QTL 102 0.044 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 8 2097640 47097640 Rat 1558646 Swd5 Spike wave discharge measurement QTL 5 3.45 0.00036 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge frequency (CMO:0001742) 8 14906751 59906751 Rat 2302278 Gluco36 Glucose level QTL 36 4.2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 8 29502665 50095447 Rat 12880044 Am9 Aortic mass QTL 9 0.007 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 8 2097640 47097640 Rat 631648 Stl5 Serum triglyceride level QTL 5 4 0.0003 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 27205715 54998217 Rat 631650 Stl6 Serum triglyceride level QTL 6 4 0.0019 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 10378157 112202585 Rat 1581557 Eae16 Experimental allergic encephalomyelitis QTL 16 3.8 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 8 8462195 110921472 Rat 631271 Lecl1 Lens clarity QTL 1 0.001 lens clarity trait (VT:0001304) age of onset/diagnosis of cataract (CMO:0001584) 8 18984168 84531599 Rat 2303564 Gluco43 Glucose level QTL 43 3 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 8 26130187 71130187 Rat 1598824 Memor4 Memory QTL 4 2.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 8 9712220 53356647 Rat 2313046 Bss78 Bone structure and strength QTL 78 3.5 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 8 30848154 82460899 Rat 1354595 Despr4 Despair related QTL 4 2.16 0.0036 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 8 7688955 52688955 Rat 2303572 Insul13 Insulin level QTL 13 2 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 8 26130187 71130187 Rat
D8Wox17
Rat Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 8 q21 UniSTS
D8Rat221
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 8 39,424,593 - 39,424,735 (+) Marker Load Pipeline mRatBN7.2 8 31,166,581 - 31,166,723 (+) MAPPER mRatBN7.2 Rnor_6.0 8 33,878,197 - 33,878,338 NCBI Rnor6.0 Rnor_5.0 8 33,920,165 - 33,920,306 UniSTS Rnor5.0 RGSC_v3.4 8 32,543,808 - 32,543,950 RGD RGSC3.4 RGSC_v3.4 8 32,543,809 - 32,543,950 UniSTS RGSC3.4 RGSC_v3.1 8 32,552,574 - 32,552,716 RGD Celera 8 32,616,262 - 32,616,403 UniSTS SHRSP x BN Map 8 23.06 UniSTS SHRSP x BN Map 8 23.06 RGD FHH x ACI Map 8 24.3 RGD Cytogenetic Map 8 q21 UniSTS
D8Wox27
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 8 39,424,638 - 39,424,787 (+) Marker Load Pipeline mRatBN7.2 8 31,166,626 - 31,166,775 (+) MAPPER mRatBN7.2 Rnor_6.0 8 33,878,242 - 33,878,390 NCBI Rnor6.0 Rnor_5.0 8 33,920,210 - 33,920,358 UniSTS Rnor5.0 RGSC_v3.4 8 32,543,854 - 32,544,002 UniSTS RGSC3.4 Celera 8 32,616,307 - 32,616,455 UniSTS Cytogenetic Map 8 q21 UniSTS
RH94701
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 31,105,420 - 31,105,591 (+) MAPPER mRatBN7.2 Rnor_6.0 8 33,816,394 - 33,816,564 NCBI Rnor6.0 Rnor_5.0 8 33,858,355 - 33,858,525 UniSTS Rnor5.0 RGSC_v3.4 8 32,481,702 - 32,481,872 UniSTS RGSC3.4 Celera 8 32,555,521 - 32,555,691 UniSTS Cytogenetic Map 8 q21 UniSTS
AI196000
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 31,167,733 - 31,167,884 (+) MAPPER mRatBN7.2 Rnor_6.0 8 33,879,349 - 33,879,499 NCBI Rnor6.0 Rnor_5.0 8 33,921,317 - 33,921,467 UniSTS Rnor5.0 RGSC_v3.4 8 32,544,961 - 32,545,111 UniSTS RGSC3.4 Celera 8 32,617,414 - 32,617,565 UniSTS Cytogenetic Map 8 q21 UniSTS
RH138700
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 31,162,935 - 31,164,432 (+) MAPPER mRatBN7.2 Rnor_6.0 8 33,874,551 - 33,876,047 NCBI Rnor6.0 Rnor_5.0 8 33,916,519 - 33,918,015 UniSTS Rnor5.0 RGSC_v3.4 8 32,540,163 - 32,541,659 UniSTS RGSC3.4 Celera 8 32,612,613 - 32,614,112 UniSTS RH 3.4 Map 8 255.7 UniSTS Cytogenetic Map 8 q21 UniSTS
ETS1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 31,167,800 - 31,167,913 (+) MAPPER mRatBN7.2 Rnor_6.0 8 33,879,416 - 33,879,528 NCBI Rnor6.0 Rnor_5.0 8 33,921,384 - 33,921,496 UniSTS Rnor5.0 RGSC_v3.4 8 32,545,028 - 32,545,140 UniSTS RGSC3.4 Celera 8 32,617,481 - 32,617,594 UniSTS Cytogenetic Map 8 q21 UniSTS
RH94700
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 31,166,136 - 31,166,327 (+) MAPPER mRatBN7.2 Rnor_6.0 8 33,877,752 - 33,877,942 NCBI Rnor6.0 Rnor_5.0 8 33,919,720 - 33,919,910 UniSTS Rnor5.0 RGSC_v3.4 8 32,543,364 - 32,543,554 UniSTS RGSC3.4 Celera 8 32,615,817 - 32,616,007 UniSTS RH 3.4 Map 8 268.3 UniSTS Cytogenetic Map 8 q21 UniSTS
RH142868
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 31,141,949 - 31,142,099 (+) MAPPER mRatBN7.2 Rnor_6.0 8 33,853,566 - 33,853,715 NCBI Rnor6.0 Rnor_5.0 8 33,895,534 - 33,895,683 UniSTS Rnor5.0 RGSC_v3.4 8 32,519,177 - 32,519,326 UniSTS RGSC3.4 Celera 8 32,591,776 - 32,591,925 UniSTS RH 3.4 Map 8 257.6 UniSTS Cytogenetic Map 8 q21 UniSTS
RH94408
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 31,164,988 - 31,165,085 (+) MAPPER mRatBN7.2 Rnor_6.0 8 33,876,604 - 33,876,700 NCBI Rnor6.0 Rnor_5.0 8 33,918,572 - 33,918,668 UniSTS Rnor5.0 RGSC_v3.4 8 32,542,216 - 32,542,312 UniSTS RGSC3.4 Celera 8 32,614,669 - 32,614,765 UniSTS Cytogenetic Map 8 q21 UniSTS
RH139077
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 8 39,399,957 - 39,400,106 (+) Marker Load Pipeline mRatBN7.2 8 31,141,944 - 31,142,094 (+) MAPPER mRatBN7.2 Rnor_6.0 8 33,853,561 - 33,853,710 NCBI Rnor6.0 Rnor_5.0 8 33,895,529 - 33,895,678 UniSTS Rnor5.0 RGSC_v3.4 8 32,519,172 - 32,519,321 UniSTS RGSC3.4 Celera 8 32,591,771 - 32,591,920 UniSTS Cytogenetic Map 8 q21 UniSTS
WS29
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 8 39,425,802 - 39,425,934 (+) Marker Load Pipeline mRatBN7.2 8 31,167,790 - 31,167,922 (+) MAPPER mRatBN7.2 Rnor_6.0 8 33,879,406 - 33,879,537 NCBI Rnor6.0 Rnor_5.0 8 33,921,374 - 33,921,505 UniSTS Rnor5.0 RGSC_v3.4 8 32,545,018 - 32,545,149 UniSTS RGSC3.4 Celera 8 32,617,471 - 32,617,603 UniSTS Cytogenetic Map 8 q21 UniSTS
This gene Ets1 is modified in the following models/strains:
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000011925 ⟹ ENSRNOP00000011925
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 31,105,413 - 31,168,010 (+) Ensembl Rnor_6.0 Ensembl 8 33,816,386 - 33,879,625 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000099064 ⟹ ENSRNOP00000090638
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 31,105,375 - 31,164,406 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000099961 ⟹ ENSRNOP00000090577
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 31,105,505 - 31,168,010 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000102138 ⟹ ENSRNOP00000079875
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 31,105,692 - 31,168,010 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000111888 ⟹ ENSRNOP00000083232
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 31,045,945 - 31,168,010 (+) Ensembl
RefSeq Acc Id:
NM_012555 ⟹ NP_036687
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 39,363,427 - 39,426,022 (+) NCBI mRatBN7.2 8 31,105,413 - 31,168,010 (+) NCBI Rnor_6.0 8 33,816,386 - 33,879,625 (+) NCBI Rnor_5.0 8 33,798,598 - 33,921,593 (+) NCBI RGSC_v3.4 8 32,481,694 - 32,545,237 (+) RGD Celera 8 32,555,513 - 32,617,691 (+) RGD
Sequence:
CGCCGGCCAGCCGAGAGAGTGAGCGAGCGCCCGGGACAGAGGAGCGAGCGGGCGAGGCGCGGGCGAGGCTGGGACCCAAGCGCGCTCTCTGCTCCGCCAAGTGCCAACTTCGCGCCGACTGGCTGGGC
hide sequence
RefSeq Acc Id:
XM_006242752 ⟹ XP_006242814
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 39,363,359 - 39,426,022 (+) NCBI mRatBN7.2 8 31,105,344 - 31,168,010 (+) NCBI Rnor_6.0 8 33,816,338 - 33,879,625 (+) NCBI Rnor_5.0 8 33,798,598 - 33,921,593 (+) NCBI
Sequence:
GGCTCGGTGAGGAACGCCCTAAAGCGGAGGCGAGCCTCACTGCGCCAGCGCCGGCCAGCCGAGA
hide sequence
RefSeq Acc Id:
XM_017595451 ⟹ XP_017450940
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 39,303,936 - 39,426,022 (+) NCBI mRatBN7.2 8 31,045,909 - 31,168,010 (+) NCBI Rnor_6.0 8 33,756,634 - 33,879,625 (+) NCBI
Sequence:
TTATGGTCTCTGCATCCTCTTTAGCCGGGGAGCCCAGGATTCCCGCAGGTAGTAGCTGGAAAGA
hide sequence
RefSeq Acc Id:
XM_039080790 ⟹ XP_038936718
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 39,303,936 - 39,426,022 (+) NCBI mRatBN7.2 8 31,045,909 - 31,168,010 (+) NCBI
RefSeq Acc Id:
NP_036687 ⟸ NM_012555
- UniProtKB:
Q3T1H1 (UniProtKB/Swiss-Prot), P41156 (UniProtKB/Swiss-Prot), A6JYI8 (UniProtKB/TrEMBL), A0A8I5ZWK1 (UniProtKB/TrEMBL)
- Sequence:
MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKECFLELAPDFVGDILWEH
hide sequence
RefSeq Acc Id:
XP_006242814 ⟸ XM_006242752
- Peptide Label:
isoform X3
- UniProtKB:
A0A8I6AEK6 (UniProtKB/TrEMBL)
- Sequence:
MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLG
hide sequence
RefSeq Acc Id:
XP_017450940 ⟸ XM_017595451
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I5ZWK1 (UniProtKB/TrEMBL)
- Sequence:
MVSASSLAGEPRIPAGSSWKEPQTFSEAHSIPHRSLQKISVVNRMSYYMDPTVGGSSPYSASHP
hide sequence
Ensembl Acc Id:
ENSRNOP00000011925 ⟸ ENSRNOT00000011925
RefSeq Acc Id:
XP_038936718 ⟸ XM_039080790
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I5ZWK1 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000090577 ⟸ ENSRNOT00000099961
Ensembl Acc Id:
ENSRNOP00000079875 ⟸ ENSRNOT00000102138
Ensembl Acc Id:
ENSRNOP00000083232 ⟸ ENSRNOT00000111888
Ensembl Acc Id:
ENSRNOP00000090638 ⟸ ENSRNOT00000099064
RGD ID: 13695833 Promoter ID: EPDNEW_R6357 Type: initiation region Name: Ets1_1 Description: ETS proto-oncogene 1, transcription factor SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 8 33,816,400 - 33,816,460 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-11-06
Ets1
v-ets erythroblastosis virus E26 oncogene homolog 1 (avian)
Ets avian erythroblastosis virus E2 oncogene homolog 1 (tumor progression locus 1)
Name updated
625702 APPROVED
2002-06-10
Ets1
Ets avian erythroblastosis virus E2 oncogene homolog 1 (tumor progression locus 1)
Symbol and Name status set to approved
70586 APPROVED
