Symbol:
Adrb3
Name:
adrenoceptor beta 3
RGD ID:
2061
Description:
Enables epinephrine binding activity and norepinephrine binding activity. Involved in adenylate cyclase-activating G protein-coupled receptor signaling pathway and eating behavior. Predicted to be located in membrane. Predicted to be part of receptor complex. Predicted to be active in plasma membrane. Biomarker of colitis; congestive heart failure; and polycystic ovary syndrome. Human ortholog(s) of this gene implicated in several diseases, including artery disease (multiple); arthritis (multiple); dilated cardiomyopathy 1H; metabolic dysfunction-associated steatotic liver disease; and type 2 diabetes mellitus. Orthologous to human ADRB3 (adrenoceptor beta 3); PARTICIPATES IN G protein mediated signaling pathway via Galphas family; calcium/calcium-mediated signaling pathway; endocytosis pathway; INTERACTS WITH (R)-adrenaline; (R)-noradrenaline; (R)-octopamine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
ADRB; adrenergic receptor, beta 3; adrenergic, beta-3-, receptor; beta-3 adrenergic receptor; beta-3 adrenoceptor; beta-3 adrenoreceptor
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ADRB3 (adrenoceptor beta 3) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Adrb3 (adrenergic receptor, beta 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Adrb3 (adrenoceptor beta 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ADRB3 (adrenoceptor beta 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ADRB3 (adrenoceptor beta 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Adrb3 (adrenoceptor beta 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ADRB3 (adrenoceptor beta 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ADRB3 (adrenoceptor beta 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Adrb3 (adrenoceptor beta 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
ACOX3 (acyl-CoA oxidase 3, pristanoyl) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Adrb3 (adrenergic receptor, beta 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
ADRB3 (adrenoceptor beta 3)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
adrb3b (adrenoceptor beta 3b)
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
adrb3a (adrenoceptor beta 3a)
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
Octbeta2R
Alliance
DIOPT (OrthoFinder|PANTHER|SonicParanoid)
Candidate Gene For:
Arunc1
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 71,544,603 - 71,547,410 (+) NCBI GRCr8 mRatBN7.2 16 64,839,820 - 64,844,552 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 64,841,788 - 64,844,552 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 70,125,571 - 70,128,335 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 73,531,913 - 73,534,677 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 68,777,172 - 68,779,936 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 69,003,541 - 69,006,632 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 69,003,868 - 69,006,632 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 68,673,983 - 68,676,747 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 69,163,620 - 69,166,384 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 16 69,163,825 - 69,166,590 (+) NCBI Celera 16 62,763,279 - 62,766,043 (+) NCBI Celera RH 3.4 Map 16 573.12 RGD Cytogenetic Map 16 q12.3 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Adrb3 Rat (R)-adrenaline multiple interactions EXP 6480464 Epinephrine binds to and results in increased activity of ADRB3 protein CTD PMID:7815362 Adrb3 Rat (R)-adrenaline multiple interactions ISO ADRB3 (Homo sapiens) 6480464 [Epinephrine binds to and results in increased activity of ADRB3 protein] which results in increased abundance of Cyclic AMP more ... CTD PMID:14730417 and PMID:1682311 Adrb3 Rat (R)-noradrenaline multiple interactions ISO ADRB3 (Homo sapiens) 6480464 [Norepinephrine binds to and results in increased activity of ADRB3 protein] which results in increased abundance of Cyclic AMP more ... CTD PMID:10344530 more ... Adrb3 Rat (R)-noradrenaline increases activity EXP 6480464 Norepinephrine results in increased activity of ADRB3 protein CTD PMID:17622774 and PMID:8569714 Adrb3 Rat (R)-noradrenaline multiple interactions EXP 6480464 3-(2-ethylphenoxy)-1-(1 more ... CTD PMID:17622774 more ... Adrb3 Rat (R)-octopamine increases activity EXP 6480464 Octopamine results in increased activity of ADRB3 protein CTD PMID:10344530 Adrb3 Rat (R)-octopamine multiple interactions ISO ADRB3 (Homo sapiens) 6480464 Octopamine inhibits the reaction [Norepinephrine binds to ADRB3 protein] CTD PMID:10344530 Adrb3 Rat 1-(propan-2-ylamino)-3-(2-prop-2-enoxyphenoxy)-2-propanol multiple interactions ISO ADRB3 (Homo sapiens) 6480464 Oxprenolol binds to and results in increased activity of ADRB3 protein CTD PMID:1682311 Adrb3 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of ADRB3 mRNA CTD PMID:15212814 Adrb3 Rat 17beta-estradiol increases expression ISO Adrb3 (Mus musculus) 6480464 Estradiol results in increased expression of ADRB3 mRNA CTD PMID:15713686 Adrb3 Rat 17beta-estradiol decreases expression ISO Adrb3 (Mus musculus) 6480464 Estradiol results in decreased expression of ADRB3 mRNA CTD PMID:39298647 Adrb3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Adrb3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of ADRB3 mRNA CTD PMID:26377647 Adrb3 Rat 2-hydroxypropanoic acid multiple interactions ISO Adrb3 (Mus musculus) 6480464 [BRL 37344 binds to and results in increased activity of ADRB3 protein] which results in increased abundance of Lactic Acid CTD PMID:20930473 Adrb3 Rat 3',5'-cyclic AMP multiple interactions ISO ADRB3 (Homo sapiens) 6480464 3-(2-ethylphenoxy)-1-(1 more ... CTD PMID:10952688 and PMID:14730417 Adrb3 Rat 3',5'-cyclic AMP affects abundance ISO ADRB3 (Homo sapiens) 6480464 ADRB3 protein affects the abundance of Cyclic AMP CTD PMID:14730417 Adrb3 Rat 3,3',5-triiodo-L-thyronine multiple interactions EXP 6480464 Amiodarone inhibits the reaction [Triiodothyronine results in decreased expression of ADRB3 protein] CTD PMID:10217540 Adrb3 Rat 3,3',5-triiodo-L-thyronine increases expression EXP 6480464 Triiodothyronine results in increased expression of ADRB3 protein CTD PMID:8836703 Adrb3 Rat 3,3',5-triiodo-L-thyronine decreases expression EXP 6480464 Triiodothyronine results in decreased expression of ADRB3 mRNA and Triiodothyronine results in decreased expression of ADRB3 protein CTD PMID:10217540 Adrb3 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO Adrb3 (Mus musculus) 6480464 [licarin A affects the susceptibility to [INS protein co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone]] which results in increased expression of ADRB3 mRNA more ... CTD PMID:29288687 and PMID:32417366 Adrb3 Rat 4,4'-sulfonyldiphenol decreases expression ISO Adrb3 (Mus musculus) 6480464 bisphenol S results in decreased expression of ADRB3 mRNA CTD PMID:39298647 Adrb3 Rat 4-hydroxyphenyl retinamide decreases expression ISO Adrb3 (Mus musculus) 6480464 Fenretinide results in decreased expression of ADRB3 mRNA CTD PMID:28973697 Adrb3 Rat 6-propyl-2-thiouracil multiple interactions ISO Adrb3 (Mus musculus) 6480464 [Propylthiouracil co-treated with Iodine deficiency] results in decreased expression of ADRB3 mRNA CTD PMID:36706583 Adrb3 Rat albuterol multiple interactions ISO ADRB3 (Homo sapiens) 6480464 [Albuterol binds to and results in increased activity of ADRB3 protein] which results in increased abundance of Cyclic AMP more ... CTD PMID:14730417 Adrb3 Rat aldehydo-D-glucose multiple interactions ISO Adrb3 (Mus musculus) 6480464 [BRL 37344 binds to and results in increased activity of ADRB3 protein] which results in decreased abundance of Glucose more ... CTD PMID:20930473 and PMID:37567420 Adrb3 Rat alprenolol multiple interactions ISO ADRB3 (Homo sapiens) 6480464 [Alprenolol binds to and results in increased activity of ADRB3 protein] which results in increased abundance of Cyclic AMP more ... CTD PMID:14730417 Adrb3 Rat Amibegron multiple interactions EXP 6480464 3-(2-ethylphenoxy)-1-(1 more ... CTD PMID:12208771 more ... Adrb3 Rat Amibegron increases activity EXP 6480464 amibegron results in increased activity of ADRB3 protein CTD PMID:8569714 Adrb3 Rat Amibegron multiple interactions ISO ADRB3 (Homo sapiens) 6480464 amibegron binds to and results in increased activity of ADRB3 protein and amibegron inhibits the reaction [ADRB3 protein results in increased susceptibility to Phenylephrine] CTD PMID:16022967 Adrb3 Rat amiodarone multiple interactions EXP 6480464 Amiodarone inhibits the reaction [Triiodothyronine results in decreased expression of ADRB3 protein] CTD PMID:10217540 Adrb3 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of ADRB3 mRNA CTD PMID:16483693 Adrb3 Rat arsenite(3-) decreases expression ISO Adrb3 (Mus musculus) 6480464 arsenite results in decreased expression of ADRB3 mRNA CTD PMID:18191166 Adrb3 Rat arsenite(3-) increases methylation ISO ADRB3 (Homo sapiens) 6480464 arsenite results in increased methylation of ADRB3 promoter CTD PMID:23974009 Adrb3 Rat atenolol multiple interactions ISO ADRB3 (Homo sapiens) 6480464 Atenolol inhibits the reaction [cyanopindolol binds to ADRB3 protein] CTD PMID:14730417 Adrb3 Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of ADRB3 gene CTD PMID:35440735 Adrb3 Rat benzo[a]pyrene multiple interactions ISO Adrb3 (Mus musculus) 6480464 AHR protein affects the reaction [Benzo(a)pyrene affects the expression of ADRB3 mRNA] CTD PMID:22228805 Adrb3 Rat benzo[a]pyrene affects methylation ISO ADRB3 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of ADRB3 exon and Benzo(a)pyrene affects the methylation of ADRB3 promoter CTD PMID:27901495 Adrb3 Rat benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of ADRB3 mRNA CTD PMID:22374506 Adrb3 Rat benzo[a]pyrene decreases expression ISO Adrb3 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of ADRB3 mRNA CTD PMID:22228805 Adrb3 Rat benzo[b]fluoranthene increases expression ISO Adrb3 (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of ADRB3 mRNA CTD PMID:26377693 Adrb3 Rat Benzo[ghi]perylene increases expression ISO Adrb3 (Mus musculus) 6480464 1 and 12-benzoperylene results in increased expression of ADRB3 mRNA CTD PMID:26377693 Adrb3 Rat beta-naphthoflavone multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in decreased expression of ADRB3 mRNA CTD PMID:18164116 Adrb3 Rat bis(2-ethylhexyl) phthalate increases expression ISO Adrb3 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of ADRB3 mRNA CTD PMID:32522588 Adrb3 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Adrb3 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of ADRB3 mRNA CTD PMID:31706747 Adrb3 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Adrb3 (Mus musculus) 6480464 [diethyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with Diethylhexyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisononyl phthalate] results in decreased expression of ADRB3 mRNA and Diethylhexyl Phthalate promotes the reaction [Dietary Fats results in decreased expression of ADRB3 mRNA] CTD PMID:34303773 and PMID:37021957 Adrb3 Rat bis(2-ethylhexyl) phthalate decreases expression ISO ADRB3 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in decreased expression of ADRB3 mRNA CTD PMID:31163220 Adrb3 Rat bisoprolol multiple interactions ISO ADRB3 (Homo sapiens) 6480464 Bisoprolol inhibits the reaction [cyanopindolol binds to ADRB3 protein] CTD PMID:14730417 Adrb3 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ADRB3 mRNA CTD PMID:25181051 more ... Adrb3 Rat bisphenol A increases expression ISO Adrb3 (Mus musculus) 6480464 bisphenol A results in increased expression of ADRB3 mRNA CTD PMID:32156529 and PMID:38701888 Adrb3 Rat bisphenol A multiple interactions ISO ADRB3 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of ADRB3 gene CTD PMID:31601247 Adrb3 Rat bisphenol F decreases expression ISO Adrb3 (Mus musculus) 6480464 bisphenol F results in decreased expression of ADRB3 mRNA CTD PMID:38685157 Adrb3 Rat Butylbenzyl phthalate multiple interactions ISO Adrb3 (Mus musculus) 6480464 [diethyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with Diethylhexyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisononyl phthalate] results in decreased expression of ADRB3 mRNA CTD PMID:37021957 Adrb3 Rat carbon nanotube decreases expression ISO Adrb3 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Adrb3 Rat carvedilol multiple interactions ISO ADRB3 (Homo sapiens) 6480464 carvedilol inhibits the reaction [cyanopindolol binds to ADRB3 protein] CTD PMID:14730417 Adrb3 Rat carvedilol decreases expression EXP 6480464 carvedilol results in decreased expression of ADRB3 mRNA CTD PMID:17440824 Adrb3 Rat carvedilol affects response to substance ISO Adrb3 (Mus musculus) 6480464 ADRB3 affects the susceptibility to carvedilol CTD PMID:11159692 Adrb3 Rat CGP 12177 multiple interactions EXP 6480464 3-(2-ethylphenoxy)-1-(1 more ... CTD PMID:7815362 and PMID:8569714 Adrb3 Rat CGP 12177 affects binding ISO ADRB3 (Homo sapiens) 6480464 CGP 12177 binds to ADRB3 protein CTD PMID:21870877 Adrb3 Rat CGP 12177 affects binding EXP 6480464 CGP 12177 binds to ADRB3 protein CTD PMID:10217540 Adrb3 Rat CGP 12177 affects response to substance ISO Adrb3 (Mus musculus) 6480464 ADRB3 affects the susceptibility to CGP 12177 CTD PMID:11159692 Adrb3 Rat CGP 12177 multiple interactions ISO ADRB3 (Homo sapiens) 6480464 [CGP 12177 binds to and results in increased activity of ADRB3 protein] which results in increased abundance of Cyclic AMP more ... CTD PMID:10952688 more ... Adrb3 Rat CGP 12177 increases activity EXP 6480464 CGP 12177 results in increased activity of ADRB3 protein CTD PMID:8569714 Adrb3 Rat chloroprene decreases expression ISO Adrb3 (Mus musculus) 6480464 Chloroprene results in decreased expression of ADRB3 mRNA CTD PMID:23125180 Adrb3 Rat chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of ADRB3 mRNA CTD PMID:17452286 Adrb3 Rat chlorpyrifos decreases expression ISO Adrb3 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of ADRB3 mRNA CTD PMID:37019170 Adrb3 Rat chlorpyrifos affects expression EXP 6480464 Chlorpyrifos affects the expression of ADRB3 mRNA CTD PMID:18812211 Adrb3 Rat choline multiple interactions ISO Adrb3 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of ADRB3 gene CTD PMID:20938992 Adrb3 Rat CL316243 multiple interactions ISO Adrb3 (Mus musculus) 6480464 [3-(2-ethylphenoxy)-1-(1 more ... CTD PMID:10725275 more ... Adrb3 Rat CL316243 increases expression EXP 6480464 disodium (R more ... CTD PMID:20184727 Adrb3 Rat CL316243 multiple interactions EXP 6480464 disodium (R more ... CTD PMID:11275008 more ... Adrb3 Rat CL316243 decreases expression ISO Adrb3 (Mus musculus) 6480464 disodium (R more ... CTD PMID:29910772 Adrb3 Rat clenbuterol multiple interactions EXP 6480464 Clenbuterol binds to and results in increased activity of ADRB3 protein CTD PMID:7815362 Adrb3 Rat clofibrate multiple interactions ISO Adrb3 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of ADRB3 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of ADRB3 mRNA] CTD PMID:17585979 Adrb3 Rat colforsin daropate hydrochloride decreases expression ISO Adrb3 (Mus musculus) 6480464 Colforsin results in decreased expression of ADRB3 mRNA CTD PMID:10725275 Adrb3 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of ADRB3 mRNA CTD PMID:27523638 Adrb3 Rat D-glucose multiple interactions ISO Adrb3 (Mus musculus) 6480464 [BRL 37344 binds to and results in increased activity of ADRB3 protein] which results in decreased abundance of Glucose more ... CTD PMID:20930473 and PMID:37567420 Adrb3 Rat dehydroepiandrosterone increases expression EXP 6480464 Dehydroepiandrosterone results in increased expression of ADRB3 mRNA CTD PMID:12659879 Adrb3 Rat dexamethasone decreases expression ISO Adrb3 (Mus musculus) 6480464 Dexamethasone results in decreased expression of ADRB3 mRNA CTD PMID:10725275 Adrb3 Rat dexamethasone multiple interactions ISO Adrb3 (Mus musculus) 6480464 [licarin A affects the susceptibility to [INS protein co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone]] which results in increased expression of ADRB3 mRNA more ... CTD PMID:29288687 and PMID:32417366 Adrb3 Rat diazinon affects expression EXP 6480464 Diazinon affects the expression of ADRB3 mRNA CTD PMID:18812211 Adrb3 Rat diazinon decreases expression EXP 6480464 Diazinon results in decreased expression of ADRB3 mRNA CTD PMID:17452286 Adrb3 Rat dibutyl phthalate multiple interactions ISO Adrb3 (Mus musculus) 6480464 [diethyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with Diethylhexyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisononyl phthalate] results in decreased expression of ADRB3 mRNA CTD PMID:37021957 Adrb3 Rat diethyl phthalate multiple interactions ISO Adrb3 (Mus musculus) 6480464 [diethyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with Diethylhexyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisononyl phthalate] results in decreased expression of ADRB3 mRNA CTD PMID:37021957 Adrb3 Rat diethylstilbestrol increases expression EXP 6480464 Diethylstilbestrol results in increased expression of ADRB3 mRNA CTD PMID:21658437 Adrb3 Rat diiodine multiple interactions ISO Adrb3 (Mus musculus) 6480464 [Propylthiouracil co-treated with Iodine deficiency] results in decreased expression of ADRB3 mRNA CTD PMID:36706583 Adrb3 Rat diisobutyl phthalate multiple interactions ISO Adrb3 (Mus musculus) 6480464 [diethyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with Diethylhexyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisononyl phthalate] results in decreased expression of ADRB3 mRNA CTD PMID:37021957 Adrb3 Rat diisononyl phthalate multiple interactions ISO Adrb3 (Mus musculus) 6480464 [diethyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with Diethylhexyl Phthalate co-treated with butylbenzyl phthalate co-treated with diisononyl phthalate] results in decreased expression of ADRB3 mRNA CTD PMID:37021957 Adrb3 Rat dioxygen increases expression ISO Adrb3 (Mus musculus) 6480464 Oxygen deficiency results in increased expression of ADRB3 mRNA CTD PMID:23539316 Adrb3 Rat dioxygen multiple interactions ISO Adrb3 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of ADRB3 mRNA CTD PMID:30529165 Adrb3 Rat dobutamine multiple interactions EXP 6480464 [Dobutamine co-treated with ICI 118551] results in increased expression of ADRB3 mRNA and [Dobutamine co-treated with ICI 118551] results in increased expression of ADRB3 protein CTD PMID:19719783 Adrb3 Rat ethanol multiple interactions ISO Adrb3 (Mus musculus) 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in decreased expression of ADRB3 mRNA CTD PMID:30517762 Adrb3 Rat fenoterol multiple interactions ISO ADRB3 (Homo sapiens) 6480464 [Fenoterol binds to and results in increased activity of ADRB3 protein] which results in increased abundance of Cyclic AMP more ... CTD PMID:14730417 Adrb3 Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of ADRB3 mRNA CTD PMID:30307764 Adrb3 Rat flavonoids increases expression EXP 6480464 Flavonoids results in increased expression of ADRB3 mRNA CTD PMID:18035473 Adrb3 Rat folic acid multiple interactions ISO Adrb3 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of ADRB3 gene CTD PMID:20938992 Adrb3 Rat folic acid increases expression ISO Adrb3 (Mus musculus) 6480464 Folic Acid results in increased expression of ADRB3 mRNA CTD PMID:25629700 Adrb3 Rat formoterol fumarate multiple interactions ISO ADRB3 (Homo sapiens) 6480464 [Formoterol Fumarate binds to and results in increased activity of ADRB3 protein] which results in increased abundance of Cyclic AMP more ... CTD PMID:14730417 Adrb3 Rat fructose multiple interactions ISO Adrb3 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in increased expression of ADRB3 mRNA CTD PMID:37567420 Adrb3 Rat fulvestrant multiple interactions ISO ADRB3 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of ADRB3 gene CTD PMID:31601247 Adrb3 Rat furan decreases expression ISO Adrb3 (Mus musculus) 6480464 furan results in decreased expression of ADRB3 mRNA CTD PMID:24183702 Adrb3 Rat glucose multiple interactions ISO Adrb3 (Mus musculus) 6480464 [BRL 37344 binds to and results in increased activity of ADRB3 protein] which results in decreased abundance of Glucose more ... CTD PMID:20930473 and PMID:37567420 Adrb3 Rat griseofulvin decreases expression ISO Adrb3 (Mus musculus) 6480464 Griseofulvin results in decreased expression of ADRB3 mRNA CTD PMID:12735108 Adrb3 Rat hydroquinone O-beta-D-glucopyranoside decreases expression ISO ADRB3 (Homo sapiens) 6480464 Arbutin results in decreased expression of ADRB3 mRNA CTD PMID:17103032 Adrb3 Rat ICI 118551 multiple interactions ISO ADRB3 (Homo sapiens) 6480464 [ICI 118551 binds to and results in decreased activity of ADRB3 protein] which results in decreased abundance of Cyclic AMP more ... CTD PMID:14730417 and PMID:1682311 Adrb3 Rat ICI 118551 multiple interactions EXP 6480464 [Dobutamine co-treated with ICI 118551] results in increased expression of ADRB3 mRNA and [Dobutamine co-treated with ICI 118551] results in increased expression of ADRB3 protein CTD PMID:19719783 Adrb3 Rat isoprenaline multiple interactions ISO ADRB3 (Homo sapiens) 6480464 [Isoproterenol binds to and results in increased activity of ADRB3 protein] which results in increased abundance of Cyclic AMP more ... CTD PMID:14730417 more ... Adrb3 Rat isoprenaline increases activity ISO ADRB3 (Homo sapiens) 6480464 Isoproterenol results in increased activity of ADRB3 protein CTD PMID:18553954 and PMID:18820136 Adrb3 Rat isoprenaline increases expression EXP 6480464 Isoproterenol results in increased expression of ADRB3 mRNA and Isoproterenol results in increased expression of ADRB3 protein CTD PMID:15009959 and PMID:20654104 Adrb3 Rat isoprenaline multiple interactions ISO Adrb3 (Mus musculus) 6480464 [ADRB3 affects the expression of ADRB1 mRNA] which affects the susceptibility to Isoproterenol CTD PMID:11159692 Adrb3 Rat isoprenaline increases activity EXP 6480464 Isoproterenol results in increased activity of ADRB3 protein CTD PMID:17622774 Adrb3 Rat isoprenaline multiple interactions EXP 6480464 3-(2-ethylphenoxy)-1-(1 more ... CTD PMID:15009959 more ... Adrb3 Rat kojic acid decreases expression ISO ADRB3 (Homo sapiens) 6480464 kojic acid results in decreased expression of ADRB3 mRNA CTD PMID:16595896 Adrb3 Rat L-methionine multiple interactions ISO Adrb3 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of ADRB3 gene CTD PMID:20938992 Adrb3 Rat Licarin A multiple interactions ISO Adrb3 (Mus musculus) 6480464 [licarin A affects the susceptibility to [INS protein co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone]] which results in increased expression of ADRB3 mRNA CTD PMID:29288687 Adrb3 Rat mangiferin multiple interactions ISO Adrb3 (Mus musculus) 6480464 [mangiferin co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS1 protein] results in increased expression of ADRB3 protein CTD PMID:32417366 Adrb3 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of ADRB3 mRNA CTD PMID:30047161 Adrb3 Rat metoprolol multiple interactions EXP 6480464 Metoprolol promotes the reaction [Streptozocin results in increased expression of ADRB3 protein] CTD PMID:18703049 Adrb3 Rat metoprolol multiple interactions ISO ADRB3 (Homo sapiens) 6480464 Metoprolol inhibits the reaction [cyanopindolol binds to ADRB3 protein] CTD PMID:14730417 Adrb3 Rat metoprolol increases expression EXP 6480464 Metoprolol results in increased expression of ADRB3 protein CTD PMID:18703049 Adrb3 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in decreased expression of ADRB3 mRNA CTD PMID:18164116 Adrb3 Rat octopamine increases activity EXP 6480464 Octopamine results in increased activity of ADRB3 protein CTD PMID:10344530 Adrb3 Rat octopamine multiple interactions ISO ADRB3 (Homo sapiens) 6480464 Octopamine inhibits the reaction [Norepinephrine binds to ADRB3 protein] CTD PMID:10344530 Adrb3 Rat ozone decreases expression ISO Adrb3 (Mus musculus) 6480464 Ozone results in decreased expression of ADRB3 mRNA CTD PMID:12763052 and PMID:17460151 Adrb3 Rat ozone multiple interactions ISO Adrb3 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of ADRB3 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of ADRB3 mRNA CTD PMID:34911549 Adrb3 Rat paracetamol multiple interactions ISO Adrb3 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of ADRB3 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of ADRB3 mRNA] CTD PMID:17585979 Adrb3 Rat paracetamol decreases expression ISO ADRB3 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of ADRB3 mRNA CTD PMID:26690555 Adrb3 Rat paracetamol affects expression ISO Adrb3 (Mus musculus) 6480464 Acetaminophen affects the expression of ADRB3 mRNA CTD PMID:17562736 Adrb3 Rat paracetamol decreases expression ISO Adrb3 (Mus musculus) 6480464 Acetaminophen results in decreased expression of ADRB3 mRNA CTD PMID:17585979 Adrb3 Rat perfluorooctanoic acid increases expression EXP 6480464 perfluorooctanoic acid results in increased expression of ADRB3 mRNA CTD PMID:35163327 Adrb3 Rat phenobarbital decreases expression ISO Adrb3 (Mus musculus) 6480464 Phenobarbital results in decreased expression of ADRB3 mRNA CTD PMID:25270620 Adrb3 Rat phenylephrine multiple interactions ISO ADRB3 (Homo sapiens) 6480464 amibegron inhibits the reaction [ADRB3 protein results in increased susceptibility to Phenylephrine] CTD PMID:16022967 Adrb3 Rat phenylephrine increases response to substance ISO ADRB3 (Homo sapiens) 6480464 ADRB3 protein results in increased susceptibility to Phenylephrine CTD PMID:16022967 Adrb3 Rat phenytoin decreases expression EXP 6480464 Phenytoin results in decreased expression of ADRB3 mRNA CTD PMID:20345932 Adrb3 Rat pindolol multiple interactions EXP 6480464 Pindolol binds to and results in increased activity of ADRB3 protein CTD PMID:7815362 Adrb3 Rat pindolol multiple interactions ISO ADRB3 (Homo sapiens) 6480464 [Pindolol binds to and results in increased activity of ADRB3 protein] which results in increased abundance of Cyclic AMP more ... CTD PMID:14730417 and PMID:1682311 Adrb3 Rat pirinixic acid decreases expression ISO Adrb3 (Mus musculus) 6480464 pirinixic acid results in decreased expression of ADRB3 mRNA CTD PMID:17950772 Adrb3 Rat pirinixic acid multiple interactions ISO Adrb3 (Mus musculus) 6480464 PPARA protein promotes the reaction [pirinixic acid results in decreased expression of ADRB3 mRNA] CTD PMID:17950772 Adrb3 Rat pirinixic acid increases expression ISO Adrb3 (Mus musculus) 6480464 pirinixic acid results in increased expression of ADRB3 mRNA CTD PMID:16306350 Adrb3 Rat pregnenolone 16alpha-carbonitrile decreases expression ISO Adrb3 (Mus musculus) 6480464 Pregnenolone Carbonitrile results in decreased expression of ADRB3 mRNA CTD PMID:28903501 Adrb3 Rat progesterone increases expression ISO Adrb3 (Mus musculus) 6480464 Progesterone results in increased expression of ADRB3 mRNA CTD PMID:15713686 Adrb3 Rat propranolol multiple interactions ISO ADRB3 (Homo sapiens) 6480464 Propranolol inhibits the reaction [cyanopindolol binds to ADRB3 protein] CTD PMID:14730417 Adrb3 Rat propranolol affects response to substance ISO Adrb3 (Mus musculus) 6480464 ADRB3 affects the susceptibility to Propranolol CTD PMID:11159692 Adrb3 Rat pyruvic acid multiple interactions ISO Adrb3 (Mus musculus) 6480464 [BRL 37344 binds to and results in increased activity of ADRB3 protein] which results in increased abundance of Pyruvic Acid CTD PMID:20930473 Adrb3 Rat rac-lactic acid multiple interactions ISO Adrb3 (Mus musculus) 6480464 [BRL 37344 binds to and results in increased activity of ADRB3 protein] which results in increased abundance of Lactic Acid CTD PMID:20930473 Adrb3 Rat Salmeterol xinafoate multiple interactions ISO ADRB3 (Homo sapiens) 6480464 [Salmeterol Xinafoate binds to and results in decreased activity of ADRB3 protein] which results in decreased abundance of Cyclic AMP more ... CTD PMID:14730417 Adrb3 Rat sodium arsenite increases expression ISO Adrb3 (Mus musculus) 6480464 sodium arsenite results in increased expression of ADRB3 mRNA CTD PMID:37682722 Adrb3 Rat solabegron multiple interactions ISO ADRB3 (Homo sapiens) 6480464 solabegron binds to and results in increased activity of ADRB3 protein CTD PMID:18651730 Adrb3 Rat streptozocin multiple interactions EXP 6480464 Metoprolol promotes the reaction [Streptozocin results in increased expression of ADRB3 protein] CTD PMID:18703049 Adrb3 Rat streptozocin increases expression EXP 6480464 Streptozocin results in increased expression of ADRB3 protein CTD PMID:18703049 Adrb3 Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of ADRB3 mRNA CTD PMID:30047161 Adrb3 Rat tamoxifen increases expression ISO Adrb3 (Mus musculus) 6480464 Tamoxifen results in increased expression of ADRB3 mRNA CTD PMID:25123088 Adrb3 Rat terbutaline multiple interactions ISO ADRB3 (Homo sapiens) 6480464 [Terbutaline binds to and results in increased activity of ADRB3 protein] which results in increased abundance of Cyclic AMP more ... CTD PMID:14730417 and PMID:16648137 Adrb3 Rat terbutaline multiple interactions EXP 6480464 Terbutaline binds to and results in increased activity of ADRB3 protein CTD PMID:7815362 Adrb3 Rat tetrachloromethane multiple interactions ISO Adrb3 (Mus musculus) 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in decreased expression of ADRB3 mRNA CTD PMID:30517762 Adrb3 Rat tetraphene affects expression ISO Adrb3 (Mus musculus) 6480464 benz(a)anthracene affects the expression of ADRB3 mRNA CTD PMID:26377693 Adrb3 Rat titanium dioxide decreases methylation ISO Adrb3 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of ADRB3 gene CTD PMID:35295148 Adrb3 Rat valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of ADRB3 mRNA CTD PMID:35594946 Adrb3 Rat zinc oxide decreases expression ISO ADRB3 (Homo sapiens) 6480464 Zinc Oxide analog results in decreased expression of ADRB3 mRNA CTD PMID:27185063
Imported Annotations - KEGG (archival)
(R)-adrenaline (EXP,ISO) (R)-noradrenaline (EXP,ISO) (R)-octopamine (EXP,ISO) 1-(propan-2-ylamino)-3-(2-prop-2-enoxyphenoxy)-2-propanol (ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2-hydroxypropanoic acid (ISO) 3',5'-cyclic AMP (ISO) 3,3',5-triiodo-L-thyronine (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (ISO) albuterol (ISO) aldehydo-D-glucose (ISO) alprenolol (ISO) Amibegron (EXP,ISO) amiodarone (EXP) ammonium chloride (EXP) arsenite(3-) (ISO) atenolol (ISO) atrazine (EXP) benzo[a]pyrene (EXP,ISO) benzo[b]fluoranthene (ISO) Benzo[ghi]perylene (ISO) beta-naphthoflavone (EXP) bis(2-ethylhexyl) phthalate (ISO) bisoprolol (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) Butylbenzyl phthalate (ISO) carbon nanotube (ISO) carvedilol (EXP,ISO) CGP 12177 (EXP,ISO) chloroprene (ISO) chlorpyrifos (EXP,ISO) choline (ISO) CL316243 (EXP,ISO) clenbuterol (EXP) clofibrate (ISO) colforsin daropate hydrochloride (ISO) Cuprizon (EXP) D-glucose (ISO) dehydroepiandrosterone (EXP) dexamethasone (ISO) diazinon (EXP) dibutyl phthalate (ISO) diethyl phthalate (ISO) diethylstilbestrol (EXP) diiodine (ISO) diisobutyl phthalate (ISO) diisononyl phthalate (ISO) dioxygen (ISO) dobutamine (EXP) ethanol (ISO) fenoterol (ISO) fenvalerate (EXP) flavonoids (EXP) folic acid (ISO) formoterol fumarate (ISO) fructose (ISO) fulvestrant (ISO) furan (ISO) glucose (ISO) griseofulvin (ISO) hydroquinone O-beta-D-glucopyranoside (ISO) ICI 118551 (EXP,ISO) isoprenaline (EXP,ISO) kojic acid (ISO) L-methionine (ISO) Licarin A (ISO) mangiferin (ISO) methimazole (EXP) metoprolol (EXP,ISO) N-nitrosodiethylamine (EXP) octopamine (EXP,ISO) ozone (ISO) paracetamol (ISO) perfluorooctanoic acid (EXP) phenobarbital (ISO) phenylephrine (ISO) phenytoin (EXP) pindolol (EXP,ISO) pirinixic acid (ISO) pregnenolone 16alpha-carbonitrile (ISO) progesterone (ISO) propranolol (ISO) pyruvic acid (ISO) rac-lactic acid (ISO) Salmeterol xinafoate (ISO) sodium arsenite (ISO) solabegron (ISO) streptozocin (EXP) sulfadimethoxine (EXP) tamoxifen (ISO) terbutaline (EXP,ISO) tetrachloromethane (ISO) tetraphene (ISO) titanium dioxide (ISO) valproic acid (EXP) zinc oxide (ISO)
Biological Process
adenylate cyclase-activating adrenergic receptor signaling pathway (IBA,IEA,ISO,ISS) adenylate cyclase-activating G protein-coupled receptor signaling pathway (IDA,IEA,ISO) brown fat cell differentiation (IEA,ISO) diet induced thermogenesis (IEA,ISO) eating behavior (IDA) G protein-coupled receptor signaling pathway (IEA) heat generation (IEA,ISO) negative regulation of G protein-coupled receptor signaling pathway (ISO) negative regulation of multicellular organism growth (IEA,ISO) norepinephrine-epinephrine-mediated vasodilation involved in regulation of systemic arterial blood pressure (IBA,IEA,ISO) positive regulation of cold-induced thermogenesis (IEA,ISO,ISS) positive regulation of MAPK cascade (IBA,IEA,ISO,ISS) receptor-mediated endocytosis (ISO) response to cold (IEA,ISO) signal transduction (IEA)
Molecular Function
adrenergic receptor activity (IEA) beta-3 adrenergic receptor binding (IEA,ISO) beta-adrenergic receptor activity (IEA,ISO,ISS) beta3-adrenergic receptor activity (IBA,IEA,ISO,ISS) epinephrine binding (IBA,IDA) G protein-coupled receptor activity (IEA) norepinephrine binding (IDA,IEA,ISO,ISS) protein binding (ISO) protein homodimerization activity (IEA,ISO,ISS)
1.
An association between the Trp64Arg polymorphism in the beta3-adrenergic receptor gene and endometrial cancer and obesity.
Babol K, etal., J Exp Clin Cancer Res. 2004 Dec;23(4):669-74.
2.
betaAR signaling required for diet-induced thermogenesis and obesity resistance.
Bachman ES, etal., Science 2002 Aug 2;297(5582):843-5.
3.
Mepartricin long-term administration regulates steroid hormone and adrenergic receptor concentrations in the prostate of aged rats.
Barbero R, etal., J Vet Pharmacol Ther. 2006 Aug;29(4):289-97.
4.
The genetic association database.
Becker KG, etal., Nat Genet. 2004 May;36(5):431-2.
5.
The rat beta 3-adrenergic receptor gene contains an intron.
Bensaid M, etal., FEBS Lett 1993 Mar 8;318(3):223-6.
6.
Functional beta-adrenergic receptor signalling on nuclear membranes in adult rat and mouse ventricular cardiomyocytes.
Boivin B, etal., Cardiovasc Res. 2006 Jul 1;71(1):69-78. Epub 2006 Mar 24.
7.
beta1, beta2, and beta3 adrenoceptors and Na+/H+ exchanger regulatory factor 1 expression in human bronchi and their modifications in cystic fibrosis.
Bossard F, etal., Am J Respir Cell Mol Biol. 2011 Jan;44(1):91-8. Epub 2010 Mar 4.
8.
Metabolic syndrome and ADRB3 gene polymorphism in severely obese patients from South Italy.
Bracale R, etal., Eur J Clin Nutr. 2007 Oct;61(10):1213-9. Epub 2007 Feb 14.
9.
Genetic variation in the beta 3-adrenergic receptor and an increased capacity to gain weight in patients with morbid obesity.
Clement K, etal., N Engl J Med 1995 Aug 10;333(6):352-4.
10.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
11.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
12.
Molecular cloning and expression of the rat beta 3-adrenergic receptor.
Granneman JG, etal., Mol Pharmacol 1991 Dec;40(6):895-9.
13.
Candidate gene association study of insulin signaling genes and Alzheimer's disease: evidence for SOS2, PCK1, and PPARgamma as susceptibility loci.
Hamilton G, etal., Am J Med Genet B Neuropsychiatr Genet. 2007 Jun 5;144B(4):508-16.
14.
Association of a genetic variation in the beta 3-adrenergic receptor gene with coronary heart disease among Japanese.
Higashi K, etal., Biochem Biophys Res Commun. 1997 Mar 27;232(3):728-30.
15.
Polymorphism of the human beta3-adrenoceptor gene forms a well-conserved haplotype that is associated with moderate obesity and altered receptor function.
Hoffstedt J, etal., Diabetes. 1999 Jan;48(1):203-5.
16.
Beta(1)/beta(2)/beta(3)-adrenoceptor knockout mice are obese and cold-sensitive but have normal lipolytic responses to fasting.
Jimenez M, etal., FEBS Lett. 2002 Oct 23;530(1-3):37-40.
17.
Association of beta3-adrenergic receptor gene polymorphism with insulin resistance in Japanese-American men.
Kawamura T, etal., Metabolism. 1999 Nov;48(11):1367-70.
18.
Studies on the expression and function of beta-3-adrenoceptors in the colon of rats with acetic acid-induced colitis.
Khan I, etal., Pharmacology. 2002 Feb;64(2):98-105.
19.
Beta3-adrenergic regulation of leptin, food intake, and adiposity is impaired with age.
Kumar MV, etal., Pflugers Arch. 1999 Oct;438(5):681-8.
20.
High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.
Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
21.
Intense exercise training induces adaptation in expression and responsiveness of cardiac beta-adrenoceptors in diabetic rats.
Lahaye Sle D, etal., Cardiovasc Diabetol. 2010 Nov 5;9:72.
22.
A novel missense mutation in ADRB3 increases risk for type 2 diabetes in a Mexican American family.
Lehman DM, etal., Diabetes Metab Res Rev. 2006 Jul-Aug;22(4):331-6.
23.
[Dynamic changes of alpha-AR, beta1-AR and beta2-AR expression during hepatic fibrogenesis].
Liu N, etal., Zhonghua Gan Zang Bing Za Zhi. 2009 Sep;17(9):653-6.
24.
Gender effects on adrenergic receptor expression and lipolysis in white adipose tissue of rats.
Llado I, etal., Obes Res 2002 Apr;10(4):296-305.
25.
The complex of human Gs protein with the beta 3 adrenergic receptor: a computer-aided molecular modeling study.
Mahmoudian M J Mol Graph. 1994 Mar;12(1):22-8, 34.
26.
Acupuncture and exercise restore adipose tissue expression of sympathetic markers and improve ovarian morphology in rats with dihydrotestosterone-induced PCOS.
Manneras L, etal., Am J Physiol Regul Integr Comp Physiol. 2009 Apr;296(4):R1124-31. Epub 2009 Jan 21.
27.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
28.
Upregulation of beta(3)-adrenoceptors and altered contractile response to inotropic amines in human failing myocardium.
Moniotte S, etal., Circulation. 2001 Mar 27;103(12):1649-55.
29.
Sepsis is associated with an upregulation of functional beta3 adrenoceptors in the myocardium.
Moniotte S, etal., Eur J Heart Fail. 2007 Dec;9(12):1163-71. Epub 2007 Nov 19.
30.
Effect of the combination of the variants -75G/A APOA1 and Trp64Arg ADRB3 on the risk of type 2 diabetes (DM2).
Morcillo S, etal., Clin Endocrinol (Oxf). 2008 Jan;68(1):102-7. Epub 2007 Aug 28.
31.
Polymorphism of the beta3-adrenergic receptor and lipid profile in patients with rheumatoid arthritis and systemic lupus erythematosus treated with chloroquine.
Munoz-Valle JF, etal., Rheumatol Int. 2003 May;23(3):99-103. Epub 2003 Mar 12.
32.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
33.
Polymorphisms of interleukin-1 beta and beta 3-adrenergic receptor in Japanese patients with nonalcoholic steatohepatitis.
Nozaki Y, etal., Alcohol Clin Exp Res. 2004 Aug;28(8 Suppl Proceedings):106S-110S.
34.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
35.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
36.
The codon 64 polymorphism of the beta3-adrenergic receptor gene is not associated with coronary heart disease or insulin resistance in nondiabetic subjects and non-insulin-dependent diabetic patients.
Pulkkinen A, etal., Metabolism. 1999 Jul;48(7):853-6.
37.
GOA pipeline
RGD automated data pipeline
38.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
39.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
40.
Comprehensive gene review and curation
RGD comprehensive gene curation
41.
The Trp64Arg polymorphism of the beta3-adrenergic receptor gene is associated with hypertension in men with type 2 diabetes mellitus.
Ringel J, etal., Am J Hypertens. 2000 Sep;13(9):1027-31.
42.
Role of the adrenergic system in a mouse model of oxygen-induced retinopathy: antiangiogenic effects of beta-adrenoreceptor blockade.
Ristori C, etal., Invest Ophthalmol Vis Sci. 2011 Jan 5;52(1):155-70. Print 2011 Jan.
43.
Beta 3-adrenoreceptor gene polymorphism: a newly identified risk factor for proliferative retinopathy in NIDDM patients.
Sakane N, etal., Diabetes. 1997 Oct;46(10):1633-6.
44.
Trp64Arg mutation of beta3-adrenoceptor gene is associated with diabetic nephropathy in Type II diabetes mellitus.
Sakane N, etal., Diabetologia. 1998 Dec;41(12):1533-4.
45.
No evidence for an association between genetic polymorphisms of beta(2)- and beta(3)-adrenergic receptor genes with body mass index in Aymara natives from Chile.
Santos JL, etal., Nutrition. 2002 Mar;18(3):255-8.
46.
Differential down-regulation of beta3-adrenergic receptor mRNA and signal transduction by cold exposure in brown adipose tissue of young and senescent rats.
Scarpace PJ, etal., Pflugers Arch. 1999 Feb;437(3):479-83.
47.
Diet-induced obese mice are leptin insufficient after weight reduction.
Shi H, etal., Obesity (Silver Spring). 2009 Sep;17(9):1702-9. Epub 2009 Apr 16.
48.
The beta3-adrenergic receptor Trp64Arg mutation is not associated with coronary artery disease.
Stangl K, etal., Metabolism. 2001 Feb;50(2):184-8.
49.
Testosterone modulation of cardiac beta-adrenergic signals in a rat model of heart failure.
Sun J, etal., Gen Comp Endocrinol. 2011 Jul 1;172(3):518-25. Epub 2011 Apr 28.
50.
Diazoxide restores beta3-adrenergic receptor function in diet-induced obesity and diabetes.
Surwit RS, etal., Endocrinology. 2000 Oct;141(10):3630-7.
51.
Targeted disruption of the beta 3-adrenergic receptor gene.
Susulic VS, etal., J Biol Chem. 1995 Dec 8;270(49):29483-92.
52.
The beta3-adrenoceptor agonist SR58611A ameliorates experimental colitis in rats.
Vasina V, etal., Neurogastroenterol Motil. 2008 Sep;20(9):1030-41. Epub 2008 May 15.
53.
Beta3-adrenergic receptor polymorphism and the antiretroviral therapy-related lipodystrophy syndrome.
Vonkeman HE, etal., AIDS. 2000 Jul 7;14(10):1463-4.
54.
Positive correlation between Beta-3-Adrenergic Receptor (ADRB3) gene and gout in a Chinese male population.
Wang B, etal., J Rheumatol. 2011 Apr;38(4):738-40. Epub 2011 Feb 1.
55.
Polymorphisms of beta-adrenoceptor and natriuretic peptide receptor genes influence the susceptibility to and the severity of idiopathic dilated cardiomyopathy in a Chinese cohort.
Wang L, etal., J Card Fail. 2010 Jan;16(1):36-44. Epub 2009 Sep 25.
56.
Independent predictive roles of eotaxin Ala23Thr, paraoxonase 2 Ser311Cys and beta-adrenergic receptor Trp64Arg polymorphisms on cardiac disease in Type 2 Diabetes--an 8-year prospective cohort analysis of 1297 patients.
Wang Y, etal., Diabet Med. 2010 Apr;27(4):376-83.
57.
Deletion of Nhlh2 results in a defective torpor response and reduced Beta adrenergic receptor expression in adipose tissue.
Wankhade UD, etal., PLoS One. 2010 Aug 23;5(8):e12324.
58.
Effects of UCP2 -866 G/A and ADRB3 Trp64Arg on rosiglitazone response in Chinese patients with Type 2 diabetes.
Yang M, etal., Br J Clin Pharmacol. 2009 Jul;68(1):14-22.
Adrb3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 71,544,603 - 71,547,410 (+) NCBI GRCr8 mRatBN7.2 16 64,839,820 - 64,844,552 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 64,841,788 - 64,844,552 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 70,125,571 - 70,128,335 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 73,531,913 - 73,534,677 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 68,777,172 - 68,779,936 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 69,003,541 - 69,006,632 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 69,003,868 - 69,006,632 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 68,673,983 - 68,676,747 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 69,163,620 - 69,166,384 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 16 69,163,825 - 69,166,590 (+) NCBI Celera 16 62,763,279 - 62,766,043 (+) NCBI Celera RH 3.4 Map 16 573.12 RGD Cytogenetic Map 16 q12.3 NCBI
ADRB3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 8 37,962,990 - 37,966,599 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 8 37,962,990 - 37,966,599 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 8 37,820,508 - 37,824,117 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 8 37,939,673 - 37,943,341 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 8 37,939,672 - 37,943,341 NCBI Celera 8 36,772,222 - 36,775,893 (-) NCBI Celera Cytogenetic Map 8 p11.23 NCBI HuRef 8 36,354,913 - 36,358,584 (-) NCBI HuRef CHM1_1 8 38,021,981 - 38,025,652 (-) NCBI CHM1_1 T2T-CHM13v2.0 8 38,239,389 - 38,242,998 (-) NCBI T2T-CHM13v2.0
Adrb3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 27,715,804 - 27,720,833 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 27,715,804 - 27,740,644 (-) Ensembl GRCm39 Ensembl GRCm38 8 27,225,776 - 27,230,845 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 27,225,776 - 27,250,616 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 28,336,248 - 28,340,060 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 28,691,712 - 28,695,524 (-) NCBI MGSCv36 mm8 Celera 8 28,716,093 - 28,719,905 (-) NCBI Celera Cytogenetic Map 8 A2 NCBI cM Map 8 15.94 NCBI
Adrb3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955463 13,663,064 - 13,665,553 (-) NCBI ChiLan1.0 ChiLan1.0
ADRB3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 7 56,524,236 - 56,529,230 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 8 32,241,318 - 32,246,461 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 8 37,263,730 - 37,267,475 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 8 34,440,099 - 34,444,043 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 8 34,441,311 - 34,443,949 (-) Ensembl panpan1.1 panPan2
ADRB3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 16 27,445,601 - 27,446,796 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 16 27,445,601 - 27,447,521 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 16 27,962,835 - 27,964,030 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 16 29,344,866 - 29,346,061 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 16 29,344,866 - 29,346,786 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 16 27,566,781 - 27,567,975 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 16 28,144,259 - 28,145,454 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 16 28,183,588 - 28,184,783 (+) NCBI UU_Cfam_GSD_1.0
Adrb3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404943 50,047,746 - 50,068,949 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936710 1,411,446 - 1,413,098 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936710 1,410,589 - 1,413,279 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ADRB3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 15 48,475,144 - 48,479,562 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 15 48,468,803 - 48,478,370 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 15 55,481,787 - 55,489,921 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ADRB3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 8 35,993,553 - 35,998,200 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 8 35,994,775 - 35,997,060 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666052 6,000,510 - 6,004,793 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Adrb3
.
Predicted Target Of
Count of predictions: 307 Count of miRNA genes: 171 Interacting mature miRNAs: 197 Transcripts: ENSRNOT00000016907 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2300163 Bmd64 Bone mineral density QTL 64 5.3 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 16 37752156 82752156 Rat 1600378 Arunc4 Aerobic running capacity QTL 4 0.03 exercise endurance trait (VT:0002332) maximum distance run on treadmill (CMO:0001406) 16 380245 80345693 Rat 70215 Niddm29 Non-insulin dependent diabetes mellitus QTL 29 3.54 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 16 19004435 75226532 Rat 1578768 Stresp22 Stress response QTL 22 2.8 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 16 35288870 80288870 Rat 2302057 Pia29 Pristane induced arthritis QTL 29 3.6 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111) 16 21735975 66735975 Rat 7205510 Activ5 Activity QTL 5 3.78 0.00028 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 16 42396345 84729064 Rat 631525 Pia14 Pristane induced arthritis QTL 14 4.4 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 16 55711087 83402471 Rat 8694453 Bw172 Body weight QTL 172 8.33 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 16 24325513 69325513 Rat 7411648 Foco22 Food consumption QTL 22 15 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 16 52726464 84729064 Rat 6903294 Stl30 Serum triglyceride level QTL 30 2.6 0.0013 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 16 25152793 70152793 Rat 2293690 Bss45 Bone structure and strength QTL 45 5.13 0.0001 lumbar vertebra morphology trait (VT:0010494) lumbar vertebra cortical cross-sectional area (CMO:0001690) 16 37752156 82752156 Rat 8694364 Abfw7 Abdominal fat weight QTL 7 12.22 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 16 52726464 84729064 Rat 8694429 Bw164 Body weight QTL 164 5 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 16 52726464 84729064 Rat 70205 Gcr3 Gastric cancer resistance QTL 3 2.3 stomach morphology trait (VT:0000470) stomach tumor diameter (CMO:0001889) 16 17696791 82635055 Rat
RH94766
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 16 64,843,935 - 64,844,184 (+) MAPPER mRatBN7.2 Rnor_6.0 16 69,006,016 - 69,006,264 NCBI Rnor6.0 Rnor_5.0 16 68,676,131 - 68,676,379 UniSTS Rnor5.0 RGSC_v3.4 16 69,165,768 - 69,166,016 UniSTS RGSC3.4 Celera 16 62,765,427 - 62,765,675 UniSTS RH 3.4 Map 16 573.12 UniSTS Cytogenetic Map 16 q12.3 UniSTS
PMC164531P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 16 64,842,153 - 64,842,231 (+) MAPPER mRatBN7.2 Rnor_6.0 16 69,004,234 - 69,004,311 NCBI Rnor6.0 Rnor_5.0 16 68,674,349 - 68,674,426 UniSTS Rnor5.0 RGSC_v3.4 16 69,163,986 - 69,164,063 UniSTS RGSC3.4 Celera 16 62,763,645 - 62,763,722 UniSTS Cytogenetic Map 16 q12.3 UniSTS
UniSTS:471071
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 16 64,843,067 - 64,843,579 (+) MAPPER mRatBN7.2 Rnor_6.0 16 69,005,148 - 69,005,659 NCBI Rnor6.0 Rnor_5.0 16 68,675,263 - 68,675,774 UniSTS Rnor5.0 RGSC_v3.4 16 69,164,900 - 69,165,411 UniSTS RGSC3.4 Celera 16 62,764,559 - 62,765,070 UniSTS Cytogenetic Map 16 q12.3 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
6
26
76
40
37
8
18
8
6
110
63
56
24
46
29
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000016907 ⟹ ENSRNOP00000016907
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 64,841,788 - 64,844,552 (+) Ensembl Rnor_6.0 Ensembl 16 69,003,868 - 69,006,632 (+) Ensembl
RefSeq Acc Id:
NM_013108 ⟹ NP_037240
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 71,544,646 - 71,547,410 (+) NCBI mRatBN7.2 16 64,841,788 - 64,844,552 (+) NCBI Rnor_6.0 16 69,003,868 - 69,006,632 (+) NCBI Rnor_5.0 16 68,673,983 - 68,676,747 (+) NCBI RGSC_v3.4 16 69,163,620 - 69,166,384 (+) RGD Celera 16 62,763,279 - 62,766,043 (+) RGD
Sequence:
CCTCTCTTGTGACTATTGGACGCTGCTCCTTTAAAAGCAGCCACTCCTCCTGGCTTCTAGGGTGTGGGGGTGGGGGCTGAGATGGAGGGAAGCTGACAGAATTACCTCAACAATTAGGGAAGATGGAC
hide sequence
RefSeq Acc Id:
XM_008771315 ⟹ XP_008769537
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 71,544,603 - 71,547,410 (+) NCBI mRatBN7.2 16 64,839,820 - 64,844,552 (+) NCBI Rnor_6.0 16 69,003,541 - 69,006,632 (+) NCBI
Sequence:
TCTGCGGGGGCTGAAGCAGAAGGATCTGGAGGTCCGGACCATTCTGATCAACATATAGAAAGAC
hide sequence
RefSeq Acc Id:
NP_037240 ⟸ NM_013108
- UniProtKB:
P26255 (UniProtKB/Swiss-Prot), A6IVX3 (UniProtKB/TrEMBL)
- Sequence:
MAPWPHKNGSLAFWSDAPTLDPSAANTSGLPGVPWAAALAGALLALATVGGNLLVITAIARTPRLQTITNVFVTSLATADLVVGLLVMPPGATLALTGHWPLGATGCELWTSVDVLCVTASIETLCAL
hide sequence
RefSeq Acc Id:
XP_008769537 ⟸ XM_008771315
- Peptide Label:
isoform X1
- UniProtKB:
A6IVX2 (UniProtKB/TrEMBL), A6IVX3 (UniProtKB/TrEMBL)
- Sequence:
MSPSLSQRVWGENFPSQTRHEMAPWPHKNGSLAFWSDAPTLDPSAANTSGLPGVPWAAALAGAL
hide sequence
Ensembl Acc Id:
ENSRNOP00000016907 ⟸ ENSRNOT00000016907
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2012-07-13
Adrb3
adrenoceptor beta 3
Adrb3
adrenergic, beta-3-, receptor
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-09-25
Adrb3
adrenergic, beta-3-, receptor
Adrb3
adrenergic receptor, beta 3
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-11-06
Adrb3
adrenergic receptor, beta 3
Adrenergic receptor, beta 3
Name updated
625702 APPROVED
2002-06-10
Adrb3
Adrenergic receptor, beta 3
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_expression
expressed in colon
632161
gene_expression
expressed in adipose tissue
632162
gene_function
binds to BRL 37344 with high affinity and to norepinephrine with lower affinity
632162
gene_process
may be involved in an adrenergic signaling pathway
632162
