Symbol:
S1pr3
Name:
sphingosine-1-phosphate receptor 3
RGD ID:
1583843
Description:
Predicted to enable G protein-coupled receptor activity and integrin binding activity. Predicted to be involved in adenylate cyclase-activating G protein-coupled receptor signaling pathway; negative regulation of establishment of endothelial barrier; and regulation of metabolic process. Predicted to act upstream of or within several processes, including Notch signaling pathway; adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway; and regulation of interleukin-1 beta production. Predicted to be active in cytoplasm; plasma membrane; and presynapse. Orthologous to human S1PR3 (sphingosine-1-phosphate receptor 3); PARTICIPATES IN sphingosine 1-phosphate signaling pathway; INTERACTS WITH acetamide; aldehydo-D-glucose; ammonium chloride.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
cardiac sphingosine-1-phosphate specific receptor; Edg3; Edg3l; endothelial differentiation, sphingolipid G-protein-coupled receptor, 3; LOC306792; lpb3; similar to Sphingosine 1-phosphate receptor Edg-3 (S1P receptor Edg-3) (Endothelial differentiation G-protein coupled receptor 3) (Sphingosine 1-phosphate receptor 3) (S1P3) (Lysophospholipid receptor B3); sphingosine 1-phosphate receptor 3
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 17 13,932,773 - 13,946,213 (-) NCBI GRCr8 mRatBN7.2 17 13,781,050 - 13,794,408 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 17 13,781,050 - 13,794,505 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 17 13,704,546 - 13,717,841 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 17 15,315,258 - 15,328,555 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 17 13,631,365 - 13,644,660 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 17 13,799,383 - 13,812,877 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 17 13,799,383 - 13,812,704 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 17 15,871,251 - 15,884,751 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 17 19,657,822 - 19,661,106 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 17 13,529,246 - 13,542,351 (-) NCBI Celera Cytogenetic Map 17 p14 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
S1pr3 Rat (1->4)-beta-D-glucan multiple interactions ISO S1pr3 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of S1PR3 mRNA CTD PMID:36331819 S1pr3 Rat 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane increases expression ISO S1PR3 (Homo sapiens) 6480464 o and p'-DDT results in increased expression of S1PR3 mRNA CTD PMID:19371625 S1pr3 Rat 1,2-dimethylhydrazine decreases expression ISO S1pr3 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of S1PR3 mRNA CTD PMID:22206623 S1pr3 Rat 1,2-dimethylhydrazine multiple interactions ISO S1pr3 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in decreased expression of S1PR3 mRNA] CTD PMID:22206623 S1pr3 Rat 17beta-estradiol multiple interactions ISO S1PR3 (Homo sapiens) 6480464 [Estradiol binds to ESR2 protein] which results in increased expression of S1PR3 mRNA CTD PMID:20404318 S1pr3 Rat 17beta-estradiol decreases expression ISO S1PR3 (Homo sapiens) 6480464 Estradiol results in decreased expression of S1PR3 mRNA CTD PMID:19167446 and PMID:28711546 S1pr3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO S1pr3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of S1PR3 mRNA CTD PMID:20702594 S1pr3 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO S1pr3 (Mus musculus) 6480464 [TIPARP gene mutant form results in increased susceptibility to Tetrachlorodibenzodioxin] which results in increased expression of S1PR3 mRNA CTD PMID:25975270 S1pr3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO S1pr3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of S1PR3 mRNA CTD PMID:21889950 S1pr3 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO S1pr3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of S1PR3 mRNA CTD PMID:19933214 S1pr3 Rat 2,3,7,8-Tetrachlorodibenzofuran affects expression ISO S1pr3 (Mus musculus) 6480464 2 more ... CTD PMID:20702594 S1pr3 Rat 4,4'-sulfonyldiphenol increases expression ISO S1pr3 (Mus musculus) 6480464 bisphenol S results in increased expression of S1PR3 mRNA CTD PMID:30951980 S1pr3 Rat 5-aza-2'-deoxycytidine multiple interactions ISO S1PR3 (Homo sapiens) 6480464 [Decitabine co-treated with trichostatin A] affects the expression of S1PR3 mRNA CTD PMID:17189669 S1pr3 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of S1PR3 mRNA CTD PMID:31881176 S1pr3 Rat aflatoxin B1 increases expression ISO S1PR3 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of S1PR3 mRNA CTD PMID:22100608 S1pr3 Rat Aflatoxin B2 alpha decreases methylation ISO S1PR3 (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of S1PR3 3' UTR CTD PMID:30157460 S1pr3 Rat aldehydo-D-glucose decreases expression EXP 6480464 Glucose results in decreased expression of S1PR3 mRNA CTD PMID:22406263 S1pr3 Rat all-trans-retinoic acid decreases expression ISO S1PR3 (Homo sapiens) 6480464 Tretinoin results in decreased expression of S1PR3 mRNA CTD PMID:21934132 S1pr3 Rat all-trans-retinoic acid multiple interactions ISO S1pr3 (Mus musculus) 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of S1PR3 mRNA CTD PMID:30951980 S1pr3 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of S1PR3 mRNA CTD PMID:16483693 S1pr3 Rat antirheumatic drug decreases expression ISO S1PR3 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of S1PR3 mRNA CTD PMID:24449571 S1pr3 Rat apigenin multiple interactions EXP 6480464 Apigenin inhibits the reaction [Lipopolysaccharides results in increased expression of S1PR3 protein] CTD PMID:25557508 S1pr3 Rat aristolochic acid A increases expression ISO S1PR3 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of S1PR3 mRNA CTD PMID:33212167 S1pr3 Rat belinostat decreases expression ISO S1PR3 (Homo sapiens) 6480464 belinostat results in decreased expression of S1PR3 mRNA CTD PMID:26272509 S1pr3 Rat belinostat multiple interactions ISO S1PR3 (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of S1PR3 mRNA CTD PMID:27188386 S1pr3 Rat benzo[a]pyrene increases expression ISO S1PR3 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of S1PR3 mRNA CTD PMID:20106945 and PMID:32234424 S1pr3 Rat benzo[a]pyrene increases methylation ISO S1PR3 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of S1PR3 3' UTR CTD PMID:27901495 S1pr3 Rat benzo[a]pyrene affects methylation ISO S1PR3 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of S1PR3 3' UTR CTD PMID:30157460 S1pr3 Rat bisphenol A increases expression ISO S1PR3 (Homo sapiens) 6480464 bisphenol A results in increased expression of S1PR3 mRNA CTD PMID:19371625 S1pr3 Rat bisphenol A multiple interactions ISO S1PR3 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of S1PR3 gene CTD PMID:31601247 S1pr3 Rat bisphenol A increases expression ISO S1pr3 (Mus musculus) 6480464 bisphenol A results in increased expression of S1PR3 mRNA CTD PMID:30951980 S1pr3 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of S1PR3 gene CTD PMID:28505145 S1pr3 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of S1PR3 mRNA CTD PMID:25181051 S1pr3 Rat bisphenol F increases expression ISO S1pr3 (Mus musculus) 6480464 bisphenol F results in increased expression of S1PR3 mRNA CTD PMID:30951980 S1pr3 Rat bisphenol F multiple interactions ISO S1pr3 (Mus musculus) 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of S1PR3 mRNA CTD PMID:30951980 S1pr3 Rat bleomycin A2 multiple interactions ISO S1pr3 (Mus musculus) 6480464 S1PR5 protein affects the reaction [Bleomycin results in increased expression of S1PR3 mRNA] CTD PMID:29033951 S1pr3 Rat bleomycin A2 increases expression ISO S1pr3 (Mus musculus) 6480464 Bleomycin results in increased expression of S1PR3 mRNA CTD PMID:29033951 S1pr3 Rat buta-1,3-diene decreases expression ISO S1pr3 (Mus musculus) 6480464 1 and 3-butadiene results in decreased expression of S1PR3 mRNA CTD PMID:29038090 S1pr3 Rat cadmium dichloride decreases expression ISO S1PR3 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of S1PR3 mRNA CTD PMID:26472689 and PMID:38568856 S1pr3 Rat carbon nanotube increases expression ISO S1pr3 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 S1pr3 Rat carmustine affects response to substance ISO S1PR3 (Homo sapiens) 6480464 S1PR3 mRNA affects the susceptibility to Carmustine CTD PMID:16365179 S1pr3 Rat chloroprene decreases expression ISO S1pr3 (Mus musculus) 6480464 Chloroprene results in decreased expression of S1PR3 mRNA CTD PMID:23125180 S1pr3 Rat chlorpyrifos increases expression ISO S1pr3 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of S1PR3 mRNA CTD PMID:37019170 S1pr3 Rat choline multiple interactions ISO S1pr3 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of S1PR3 gene CTD PMID:20938992 S1pr3 Rat cisplatin increases expression ISO S1PR3 (Homo sapiens) 6480464 Cisplatin results in increased expression of S1PR3 mRNA CTD PMID:27392435 S1pr3 Rat copper(II) chloride increases expression ISO S1PR3 (Homo sapiens) 6480464 cupric chloride results in increased expression of S1PR3 mRNA CTD PMID:38568856 S1pr3 Rat coumestrol multiple interactions ISO S1PR3 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 more ... CTD PMID:19167446 S1pr3 Rat coumestrol decreases expression ISO S1PR3 (Homo sapiens) 6480464 Coumestrol results in decreased expression of S1PR3 mRNA CTD PMID:19167446 S1pr3 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of S1PR3 mRNA CTD PMID:27523638 S1pr3 Rat cyclosporin A decreases expression ISO S1PR3 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of S1PR3 mRNA CTD PMID:20106945 and PMID:27989131 S1pr3 Rat D-glucose decreases expression EXP 6480464 Glucose results in decreased expression of S1PR3 mRNA CTD PMID:22406263 S1pr3 Rat daidzein multiple interactions ISO S1PR3 (Homo sapiens) 6480464 [daidzein co-treated with daidzin co-treated with genistin co-treated with Genistein co-treated with glycitin co-treated with glycitein] results in decreased expression of S1PR3 mRNA CTD PMID:27424125 S1pr3 Rat daidzein 7-O-beta-D-glucoside multiple interactions ISO S1PR3 (Homo sapiens) 6480464 [daidzein co-treated with daidzin co-treated with genistin co-treated with Genistein co-treated with glycitin co-treated with glycitein] results in decreased expression of S1PR3 mRNA CTD PMID:27424125 S1pr3 Rat DDE decreases expression ISO S1PR3 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of S1PR3 mRNA CTD PMID:38568856 S1pr3 Rat dexamethasone increases expression ISO S1PR3 (Homo sapiens) 6480464 Dexamethasone results in increased expression of S1PR3 mRNA CTD PMID:25047013 S1pr3 Rat Dibutyl phosphate affects expression ISO S1PR3 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of S1PR3 mRNA CTD PMID:37042841 S1pr3 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of S1PR3 mRNA CTD PMID:21266533 S1pr3 Rat dibutyl phthalate increases expression ISO S1pr3 (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of S1PR3 mRNA CTD PMID:17361019 and PMID:21266533 S1pr3 Rat diethylstilbestrol increases expression ISO S1PR3 (Homo sapiens) 6480464 Diethylstilbestrol results in increased expression of S1PR3 mRNA CTD PMID:19371625 S1pr3 Rat dioxygen decreases expression ISO S1PR3 (Homo sapiens) 6480464 Oxygen deficiency results in decreased expression of S1PR3 mRNA CTD PMID:26516004 S1pr3 Rat dorsomorphin multiple interactions ISO S1PR3 (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 S1pr3 Rat doxorubicin decreases expression ISO S1PR3 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of S1PR3 mRNA CTD PMID:29803840 S1pr3 Rat doxorubicin decreases expression EXP 6480464 Doxorubicin results in decreased expression of S1PR3 mRNA CTD PMID:32289291 S1pr3 Rat Enterolactone multiple interactions ISO S1PR3 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of S1PR3 mRNA CTD PMID:19167446 S1pr3 Rat entinostat decreases expression ISO S1PR3 (Homo sapiens) 6480464 entinostat results in decreased expression of S1PR3 mRNA CTD PMID:26272509 S1pr3 Rat entinostat multiple interactions ISO S1PR3 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of S1PR3 mRNA CTD PMID:27188386 S1pr3 Rat enzalutamide affects expression ISO S1PR3 (Homo sapiens) 6480464 enzalutamide affects the expression of S1PR3 mRNA CTD PMID:30940724 S1pr3 Rat ethanol increases expression ISO S1pr3 (Mus musculus) 6480464 Ethanol results in increased expression of S1PR3 mRNA CTD PMID:30319688 S1pr3 Rat ethanol affects expression ISO S1pr3 (Mus musculus) 6480464 Ethanol affects the expression of S1PR3 mRNA CTD PMID:30319688 S1pr3 Rat fingolimod hydrochloride multiple interactions ISO S1PR3 (Homo sapiens) 6480464 Fingolimod Hydrochloride inhibits the reaction [sphingosine 1-phosphate results in increased expression of S1PR3 protein] CTD PMID:25980589 S1pr3 Rat folic acid multiple interactions ISO S1pr3 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of S1PR3 gene more ... CTD PMID:20938992 and PMID:22206623 S1pr3 Rat fulvestrant multiple interactions ISO S1PR3 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of S1PR3 gene CTD PMID:31601247 S1pr3 Rat genistein increases expression ISO S1PR3 (Homo sapiens) 6480464 Genistein results in increased expression of S1PR3 mRNA CTD PMID:19371625 S1pr3 Rat genistein multiple interactions ISO S1PR3 (Homo sapiens) 6480464 [daidzein co-treated with daidzin co-treated with genistin co-treated with Genistein co-treated with glycitin co-treated with glycitein] results in decreased expression of S1PR3 mRNA CTD PMID:27424125 S1pr3 Rat genistein 7-O-beta-D-glucoside multiple interactions ISO S1PR3 (Homo sapiens) 6480464 [daidzein co-treated with daidzin co-treated with genistin co-treated with Genistein co-treated with glycitin co-treated with glycitein] results in decreased expression of S1PR3 mRNA CTD PMID:27424125 S1pr3 Rat glucose decreases expression EXP 6480464 Glucose results in decreased expression of S1PR3 mRNA CTD PMID:22406263 S1pr3 Rat glycitein multiple interactions ISO S1PR3 (Homo sapiens) 6480464 [daidzein co-treated with daidzin co-treated with genistin co-treated with Genistein co-treated with glycitin co-treated with glycitein] results in decreased expression of S1PR3 mRNA CTD PMID:27424125 S1pr3 Rat glycitin multiple interactions ISO S1PR3 (Homo sapiens) 6480464 [daidzein co-treated with daidzin co-treated with genistin co-treated with Genistein co-treated with glycitin co-treated with glycitein] results in decreased expression of S1PR3 mRNA CTD PMID:27424125 S1pr3 Rat L-methionine multiple interactions ISO S1pr3 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of S1PR3 gene CTD PMID:20938992 S1pr3 Rat lipopolysaccharide multiple interactions EXP 6480464 Apigenin inhibits the reaction [Lipopolysaccharides results in increased expression of S1PR3 protein] CTD PMID:25557508 S1pr3 Rat lipopolysaccharide multiple interactions ISO S1PR3 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of S1PR3 mRNA CTD PMID:35811015 S1pr3 Rat lipopolysaccharide increases expression ISO S1PR3 (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of S1PR3 mRNA CTD PMID:35811015 S1pr3 Rat lipopolysaccharide increases expression EXP 6480464 Lipopolysaccharides results in increased expression of S1PR3 protein CTD PMID:25557508 S1pr3 Rat methylisothiazolinone increases expression ISO S1PR3 (Homo sapiens) 6480464 2-methyl-4-isothiazolin-3-one results in increased expression of S1PR3 mRNA CTD PMID:31629900 S1pr3 Rat methylmercury chloride increases expression ISO S1PR3 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of S1PR3 mRNA CTD PMID:28001369 S1pr3 Rat N-methyl-4-phenylpyridinium decreases expression ISO S1PR3 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of S1PR3 mRNA CTD PMID:24399507 S1pr3 Rat N-methyl-4-phenylpyridinium increases expression ISO S1PR3 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of S1PR3 mRNA CTD PMID:24810058 S1pr3 Rat N-nitrosodiethylamine increases expression ISO S1pr3 (Mus musculus) 6480464 Diethylnitrosamine results in increased expression of S1PR3 mRNA CTD PMID:24535843 S1pr3 Rat N-Nitrosopyrrolidine increases expression ISO S1PR3 (Homo sapiens) 6480464 N-Nitrosopyrrolidine results in increased expression of S1PR3 mRNA CTD PMID:32234424 S1pr3 Rat nickel atom increases expression ISO S1PR3 (Homo sapiens) 6480464 Nickel results in increased expression of S1PR3 mRNA CTD PMID:24768652 and PMID:25583101 S1pr3 Rat nickel sulfate increases expression ISO S1PR3 (Homo sapiens) 6480464 nickel sulfate results in increased expression of S1PR3 mRNA CTD PMID:22714537 S1pr3 Rat nitrofen decreases expression EXP 6480464 nitrofen results in decreased expression of S1PR3 mRNA and nitrofen results in decreased expression of S1PR3 protein CTD PMID:26543024 S1pr3 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of S1PR3 mRNA CTD PMID:25729387 S1pr3 Rat ozone multiple interactions ISO S1pr3 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of S1PR3 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of S1PR3 mRNA CTD PMID:34911549 S1pr3 Rat panobinostat multiple interactions ISO S1PR3 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of S1PR3 mRNA CTD PMID:27188386 S1pr3 Rat panobinostat decreases expression ISO S1PR3 (Homo sapiens) 6480464 panobinostat results in decreased expression of S1PR3 mRNA CTD PMID:26272509 S1pr3 Rat paracetamol affects expression ISO S1PR3 (Homo sapiens) 6480464 Acetaminophen affects the expression of S1PR3 mRNA CTD PMID:25458485 S1pr3 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO S1pr3 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of S1PR3 mRNA CTD PMID:36331819 S1pr3 Rat phenobarbital affects expression ISO S1pr3 (Mus musculus) 6480464 Phenobarbital affects the expression of S1PR3 mRNA CTD PMID:23091169 S1pr3 Rat pirinixic acid multiple interactions ISO S1pr3 (Mus musculus) 6480464 NCF1 protein promotes the reaction [pirinixic acid results in decreased expression of S1PR3 mRNA] CTD PMID:17950772 S1pr3 Rat pirinixic acid decreases expression ISO S1pr3 (Mus musculus) 6480464 pirinixic acid results in decreased expression of S1PR3 mRNA CTD PMID:17950772 S1pr3 Rat potassium chromate decreases expression ISO S1PR3 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of S1PR3 mRNA CTD PMID:22714537 S1pr3 Rat potassium dichromate increases expression ISO S1pr3 (Mus musculus) 6480464 Potassium Dichromate results in increased expression of S1PR3 mRNA CTD PMID:23608068 S1pr3 Rat propionic acid increases expression ISO S1PR3 (Homo sapiens) 6480464 propionic acid results in increased expression of S1PR3 mRNA CTD PMID:31526819 S1pr3 Rat resveratrol increases expression ISO S1PR3 (Homo sapiens) 6480464 resveratrol results in increased expression of S1PR3 mRNA CTD PMID:19371625 S1pr3 Rat resveratrol multiple interactions ISO S1PR3 (Homo sapiens) 6480464 [Coumestrol co-treated with resveratrol] results in decreased expression of S1PR3 mRNA CTD PMID:19167446 S1pr3 Rat rotenone decreases expression ISO S1pr3 (Mus musculus) 6480464 Rotenone results in decreased expression of S1PR3 mRNA CTD PMID:35919817 S1pr3 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO S1PR3 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of S1PR3 mRNA CTD PMID:35811015 S1pr3 Rat SB 431542 multiple interactions ISO S1PR3 (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 S1pr3 Rat silicon dioxide increases expression ISO S1pr3 (Mus musculus) 6480464 Silicon Dioxide results in increased expression of S1PR3 mRNA CTD PMID:23221170 S1pr3 Rat simvastatin increases expression ISO S1PR3 (Homo sapiens) 6480464 Simvastatin results in increased expression of S1PR3 mRNA CTD PMID:18612546 S1pr3 Rat simvastatin decreases expression ISO S1PR3 (Homo sapiens) 6480464 Simvastatin results in decreased expression of S1PR3 mRNA CTD PMID:18981156 S1pr3 Rat sodium arsenite decreases expression ISO S1PR3 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of S1PR3 mRNA CTD PMID:38568856 S1pr3 Rat Soman increases expression EXP 6480464 Soman results in increased expression of S1PR3 mRNA CTD PMID:19281266 S1pr3 Rat sphingosine 1-phosphate multiple interactions ISO S1PR3 (Homo sapiens) 6480464 Fingolimod Hydrochloride inhibits the reaction [sphingosine 1-phosphate results in increased expression of S1PR3 protein] more ... CTD PMID:18612546 and PMID:25980589 S1pr3 Rat sphingosine 1-phosphate increases expression ISO S1PR3 (Homo sapiens) 6480464 sphingosine 1-phosphate results in increased expression of S1PR3 protein CTD PMID:25980589 S1pr3 Rat temozolomide affects response to substance ISO S1PR3 (Homo sapiens) 6480464 S1PR3 mRNA affects the susceptibility to Temozolomide CTD PMID:16365179 S1pr3 Rat tetrachloromethane increases expression ISO S1pr3 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of S1PR3 mRNA CTD PMID:17341687 S1pr3 Rat tetrachloromethane decreases expression ISO S1pr3 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of S1PR3 mRNA CTD PMID:17484886 S1pr3 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of S1PR3 mRNA CTD PMID:34492290 S1pr3 Rat titanium dioxide increases methylation ISO S1pr3 (Mus musculus) 6480464 titanium dioxide results in increased methylation of S1PR3 promoter CTD PMID:35295148 S1pr3 Rat titanium dioxide decreases methylation ISO S1pr3 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of S1PR3 gene CTD PMID:35295148 S1pr3 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of S1PR3 mRNA CTD PMID:25729387 S1pr3 Rat torcetrapib increases expression ISO S1PR3 (Homo sapiens) 6480464 torcetrapib results in increased expression of S1PR3 mRNA CTD PMID:23228038 S1pr3 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of S1PR3 mRNA CTD PMID:33387578 S1pr3 Rat trichostatin A multiple interactions ISO S1PR3 (Homo sapiens) 6480464 [Decitabine co-treated with trichostatin A] affects the expression of S1PR3 mRNA more ... CTD PMID:17189669 and PMID:27188386 S1pr3 Rat trichostatin A decreases expression ISO S1PR3 (Homo sapiens) 6480464 trichostatin A results in decreased expression of S1PR3 mRNA CTD PMID:24935251 and PMID:26272509 S1pr3 Rat trichostatin A increases expression ISO S1PR3 (Homo sapiens) 6480464 trichostatin A results in increased expression of S1PR3 mRNA CTD PMID:24935251 S1pr3 Rat troglitazone decreases expression ISO S1pr3 (Mus musculus) 6480464 troglitazone results in decreased expression of S1PR3 mRNA CTD PMID:28973697 S1pr3 Rat troglitazone increases expression ISO S1PR3 (Homo sapiens) 6480464 troglitazone results in increased expression of S1PR3 mRNA CTD PMID:19140230 S1pr3 Rat urethane increases expression ISO S1PR3 (Homo sapiens) 6480464 Urethane results in increased expression of S1PR3 mRNA CTD PMID:28818685 S1pr3 Rat valproic acid affects expression ISO S1pr3 (Mus musculus) 6480464 Valproic Acid affects the expression of S1PR3 mRNA CTD PMID:17292431 S1pr3 Rat valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of S1PR3 mRNA CTD PMID:29427782 S1pr3 Rat valproic acid increases expression ISO S1pr3 (Mus musculus) 6480464 Valproic Acid results in increased expression of S1PR3 mRNA CTD PMID:24896083 S1pr3 Rat valproic acid increases methylation ISO S1PR3 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of S1PR3 gene CTD PMID:29154799 S1pr3 Rat valproic acid increases expression ISO S1PR3 (Homo sapiens) 6480464 Valproic Acid results in increased expression of S1PR3 mRNA CTD PMID:24935251 S1pr3 Rat valproic acid decreases expression ISO S1PR3 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of S1PR3 mRNA CTD PMID:24935251 and PMID:28001369 S1pr3 Rat vanadyl sulfate increases expression ISO S1PR3 (Homo sapiens) 6480464 vanadyl sulfate results in increased expression of S1PR3 mRNA CTD PMID:16330358 S1pr3 Rat WIN 55212-2 increases expression ISO S1pr3 (Mus musculus) 6480464 (3R)-((2 more ... CTD PMID:12237329 S1pr3 Rat zearalenone increases expression ISO S1PR3 (Homo sapiens) 6480464 Zearalenone results in increased expression of S1PR3 mRNA CTD PMID:19371625
Imported Annotations - PID (archival)
(1->4)-beta-D-glucan (ISO) 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,3,7,8-Tetrachlorodibenzofuran (ISO) 4,4'-sulfonyldiphenol (ISO) 5-aza-2'-deoxycytidine (ISO) acetamide (EXP) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) aldehydo-D-glucose (EXP) all-trans-retinoic acid (ISO) ammonium chloride (EXP) antirheumatic drug (ISO) apigenin (EXP) aristolochic acid A (ISO) belinostat (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) bleomycin A2 (ISO) buta-1,3-diene (ISO) cadmium dichloride (ISO) carbon nanotube (ISO) carmustine (ISO) chloroprene (ISO) chlorpyrifos (ISO) choline (ISO) cisplatin (ISO) copper(II) chloride (ISO) coumestrol (ISO) Cuprizon (EXP) cyclosporin A (ISO) D-glucose (EXP) daidzein (ISO) daidzein 7-O-beta-D-glucoside (ISO) DDE (ISO) dexamethasone (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) diethylstilbestrol (ISO) dioxygen (ISO) dorsomorphin (ISO) doxorubicin (EXP,ISO) Enterolactone (ISO) entinostat (ISO) enzalutamide (ISO) ethanol (ISO) fingolimod hydrochloride (ISO) folic acid (ISO) fulvestrant (ISO) genistein (ISO) genistein 7-O-beta-D-glucoside (ISO) glucose (EXP) glycitein (ISO) glycitin (ISO) L-methionine (ISO) lipopolysaccharide (EXP,ISO) methylisothiazolinone (ISO) methylmercury chloride (ISO) N-methyl-4-phenylpyridinium (ISO) N-nitrosodiethylamine (ISO) N-Nitrosopyrrolidine (ISO) nickel atom (ISO) nickel sulfate (ISO) nitrofen (EXP) oxaliplatin (EXP) ozone (ISO) panobinostat (ISO) paracetamol (ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) pirinixic acid (ISO) potassium chromate (ISO) potassium dichromate (ISO) propionic acid (ISO) resveratrol (ISO) rotenone (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) silicon dioxide (ISO) simvastatin (ISO) sodium arsenite (ISO) Soman (EXP) sphingosine 1-phosphate (ISO) temozolomide (ISO) tetrachloromethane (ISO) thioacetamide (EXP) titanium dioxide (ISO) topotecan (EXP) torcetrapib (ISO) trichloroethene (EXP) trichostatin A (ISO) troglitazone (ISO) urethane (ISO) valproic acid (EXP,ISO) vanadyl sulfate (ISO) WIN 55212-2 (ISO) zearalenone (ISO)
S1pr3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 17 13,932,773 - 13,946,213 (-) NCBI GRCr8 mRatBN7.2 17 13,781,050 - 13,794,408 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 17 13,781,050 - 13,794,505 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 17 13,704,546 - 13,717,841 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 17 15,315,258 - 15,328,555 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 17 13,631,365 - 13,644,660 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 17 13,799,383 - 13,812,877 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 17 13,799,383 - 13,812,704 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 17 15,871,251 - 15,884,751 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 17 19,657,822 - 19,661,106 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 17 13,529,246 - 13,542,351 (-) NCBI Celera Cytogenetic Map 17 p14 NCBI
S1PR3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 9 88,990,863 - 89,005,155 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 9 88,990,863 - 89,005,155 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 9 91,605,778 - 91,620,070 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 9 90,796,182 - 90,809,745 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 9 88,835,915 - 88,849,478 NCBI Celera 9 62,189,011 - 62,202,574 (+) NCBI Celera Cytogenetic Map 9 q22.1 NCBI HuRef 9 61,438,768 - 61,452,511 (+) NCBI HuRef CHM1_1 9 91,754,483 - 91,768,224 (+) NCBI CHM1_1 T2T-CHM13v2.0 9 101,153,351 - 101,167,644 (+) NCBI T2T-CHM13v2.0
S1pr3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 13 51,562,654 - 51,576,833 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 13 51,562,675 - 51,576,833 (+) Ensembl GRCm39 Ensembl GRCm38 13 51,408,618 - 51,422,797 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 13 51,408,639 - 51,422,797 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 13 51,503,987 - 51,518,166 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 13 51,421,260 - 51,435,293 (+) NCBI MGSCv36 mm8 Celera 13 52,481,303 - 52,495,482 (+) NCBI Celera Cytogenetic Map 13 A5 NCBI cM Map 13 26.12 NCBI
S1pr3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955515 3,024,258 - 3,035,996 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955515 3,024,258 - 3,035,996 (-) NCBI ChiLan1.0 ChiLan1.0
S1PR3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 11 50,455,855 - 50,460,900 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 9 50,459,337 - 50,463,288 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 9 60,080,189 - 60,094,311 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 9 88,126,416 - 88,140,149 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 9 88,126,476 - 88,137,333 (+) Ensembl panpan1.1 panPan2
S1PR3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 97,102,708 - 97,107,611 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 97,104,652 - 97,105,857 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 97,565,504 - 97,576,501 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 97,714,499 - 97,725,495 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 97,714,526 - 97,725,557 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 97,342,250 - 97,353,244 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 97,061,323 - 97,072,318 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 97,819,845 - 97,830,838 (-) NCBI UU_Cfam_GSD_1.0
S1pr3
S1PR3
S1PR3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 12 99,484,615 - 99,498,211 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 12 99,494,423 - 99,495,559 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 87,806,079 - 87,819,666 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
S1pr3
.
Predicted Target Of
Count of predictions: 40 Count of miRNA genes: 37 Interacting mature miRNAs: 38 Transcripts: ENSRNOT00000019473 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1354581 Bp247 Blood pressure QTL 247 4.5 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 17 1 69599340 Rat 2300002 Iddm36 Insulin dependent diabetes mellitus QTL 36 1.98 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 17 9991286 40540197 Rat 631499 Stl1 Serum triglyceride level QTL 1 3.6 blood triglyceride amount (VT:0002644) blood triglyceride level (CMO:0000118) 17 3271398 27389946 Rat 2293664 Bmd28 Bone mineral density QTL 28 5.1 0.0001 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 17 4354487 27028127 Rat 1300123 Bp194 Blood pressure QTL 194 2.82 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 17 2115149 34551001 Rat 1582224 Epfw4 Epididymal fat weight QTL 4 3.5 0.0058 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 17 9201365 23653323 Rat 1582225 Bw67 Body weight QTL 67 6.2 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 17 9201365 23653323 Rat 1582226 Bw64 Body weight QTL 64 4.2 0.0017 body mass (VT:0001259) body weight (CMO:0000012) 17 9201365 23653323 Rat 1354651 Lmblg2 Limb length QTL 2 6 tibia length (VT:0004357) tibia length (CMO:0000450) 17 4299130 69599340 Rat 10401807 Kidm52 Kidney mass QTL 52 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 17 1 31701463 Rat 10054088 Scort28 Serum corticosterone level QTL 28 2.04 0.0102 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 17 4528038 49528038 Rat 1354630 Cm34 Cardiac mass QTL 34 8.7 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 17 4299130 69599340 Rat 1582208 Kidm32 Kidney mass QTL 32 3.9 0.0018 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 17 9201365 23653323 Rat 1354638 Insul1 Insulin level QTL 1 4.8 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 17 4299130 69599340 Rat 1354613 Kidm14 Kidney mass QTL 14 6.2 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 17 4299130 35837242 Rat 2324619 Coatc4 Coat color QTL 4 0.001 coat/hair pigmentation trait (VT:0010463) pigmented dorsal coat/hair area to total dorsal coat/hair area ratio (CMO:0001811) 17 4299130 21293263 Rat 2303627 Vencon8 Ventilatory control QTL 8 0.001 respiration trait (VT:0001943) tidal volume (CMO:0000222) 17 4528038 49528038 Rat 70184 BpQTLcluster14 Blood pressure QTL cluster 14 3.38 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 17 1 31990913 Rat 1581553 Pur14 Proteinuria QTL 14 5.3 0.0001 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 17 7979968 16317111 Rat 2303561 Bw91 Body weight QTL 91 2 body mass (VT:0001259) body weight (CMO:0000012) 17 8868462 53868462 Rat 1582258 Bw76 Body weight QTL 76 4.6 0.0005 body mass (VT:0001259) body weight (CMO:0000012) 17 9201365 23653323 Rat 631207 Niddm41 Non-insulin dependent diabetes mellitus QTL 41 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 17 1 37830672 Rat 1582199 Insul5 Insulin level QTL 5 3.4 0.0119 blood insulin amount (VT:0001560) calculated serum insulin level (CMO:0000359) 17 9201365 23653323 Rat 1354596 Bw32 Body weight QTL 32 4.5 body mass (VT:0001259) body weight (CMO:0000012) 17 4299130 60781592 Rat 1354662 Rf49 Renal function QTL 49 2.9 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 17 1 69599340 Rat 2293648 Bmd31 Bone mineral density QTL 31 4.5 0.0001 femur size trait (VT:1000369) femoral neck cortical cross-sectional area (CMO:0001702) 17 4354487 27028127 Rat 1354658 Spl8 Serum phospholipid level QTL 8 3.8 blood VLDL phospholipid amount (VT:0010507) blood very low density lipoprotein phospholipid level (CMO:0001571) 17 1 60781592 Rat 1641902 Colcr7 Colorectal carcinoma resistance QTL 7 3.35 0.0044 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 17 2115149 21881669 Rat 1582241 Bw70 Body weight QTL 70 4.6 0.0003 body mass (VT:0001259) body weight (CMO:0000012) 17 9201365 23653323 Rat 1582245 Bw73 Body weight QTL 73 4.6 0.0004 body mass (VT:0001259) body weight (CMO:0000012) 17 9201365 23653323 Rat 9590316 Scort21 Serum corticosterone level QTL 21 4.75 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 17 1 22871563 Rat
RH132124
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 17 13,781,313 - 13,781,506 (+) MAPPER mRatBN7.2 Rnor_6.0 17 13,799,647 - 13,799,839 NCBI Rnor6.0 Rnor_5.0 17 15,871,515 - 15,871,707 UniSTS Rnor5.0 RGSC_v3.4 17 19,658,086 - 19,658,278 UniSTS RGSC3.4 Celera 17 13,529,510 - 13,529,702 UniSTS RH 3.4 Map 17 145.5 UniSTS Cytogenetic Map 17 p14 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000019473 ⟹ ENSRNOP00000019473
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 17 13,781,050 - 13,794,505 (-) Ensembl Rnor_6.0 Ensembl 17 13,799,383 - 13,812,615 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000085581 ⟹ ENSRNOP00000074813
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 17 13,799,384 - 13,812,704 (-) Ensembl
RefSeq Acc Id:
NM_001271143 ⟹ NP_001258072
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 13,932,773 - 13,946,013 (-) NCBI mRatBN7.2 17 13,781,050 - 13,794,296 (-) NCBI Rnor_6.0 17 13,799,383 - 13,812,615 (-) NCBI Rnor_5.0 17 15,871,251 - 15,884,751 (-) NCBI Celera 17 13,529,246 - 13,542,351 (-) NCBI
Sequence:
GCAAGTTCAGGGGCAGGCGACAAGGTCCGGGTGCTGAGCGAGGCGGCTGGACAAGCTTAGCCAGAGAGAAACCTGAGGCCACGAGCGACCTCCGGAGGAGCCCCTAAACTGGAGCCTTAGCTGAGACT
hide sequence
RefSeq Acc Id:
XM_006253680 ⟹ XP_006253742
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 13,932,773 - 13,946,141 (-) NCBI mRatBN7.2 17 13,781,050 - 13,794,408 (-) NCBI Rnor_6.0 17 13,799,383 - 13,812,746 (-) NCBI Rnor_5.0 17 15,871,251 - 15,884,751 (-) NCBI
Sequence:
AAATGGGAACCAGCCCGCAGAAGCTCTGAAGCTTGGGTTAGGGGCGGCAGGAGGCGGGTGACTC
hide sequence
RefSeq Acc Id:
XM_063276353 ⟹ XP_063132423
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 13,932,773 - 13,946,213 (-) NCBI
RefSeq Acc Id:
NP_001258072 ⟸ NM_001271143
- UniProtKB:
F1M9D3 (UniProtKB/TrEMBL)
- Sequence:
MASTHAQGHPPVLGNDTLREHYDYVGKLAGRLRDPPEGSTLITTILFLVTCSFIVLENLMVLIAIWKNNKFHNRMYFFIGNLALCDLLAGIAYKVNILMSGRKTFSLSPTVWFLREGSMFVALGASTC
hide sequence
RefSeq Acc Id:
XP_006253742 ⟸ XM_006253680
- Peptide Label:
isoform X2
- UniProtKB:
A0A0G2K910 (UniProtKB/TrEMBL)
- Sequence:
MNVPGAPSRGLLSFIVLENLMVLIAIWKNNKFHNRMYFFIGNLALCDLLAGIAYKVNILMSGRKTFSLSPTVWFLREGSMFVALGASTCSLLAIAIERHLTMIKMRPYDANKKHRVFLLIGMCWLIAF
hide sequence
Ensembl Acc Id:
ENSRNOP00000074813 ⟸ ENSRNOT00000085581
Ensembl Acc Id:
ENSRNOP00000019473 ⟸ ENSRNOT00000019473
RefSeq Acc Id:
XP_063132423 ⟸ XM_063276353
- Peptide Label:
isoform X1
- UniProtKB:
F1M9D3 (UniProtKB/TrEMBL)
RGD ID: 13700340 Promoter ID: EPDNEW_R10863 Type: multiple initiation site Name: S1pr3_1 Description: sphingosine-1-phosphate receptor 3 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 17 13,812,628 - 13,812,688 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-05-20
S1pr3
sphingosine-1-phosphate receptor 3
Edg3
endothelial differentiation, sphingolipid G-protein-coupled receptor, 3
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-03-12
Edg3
endothelial differentiation, sphingolipid G-protein-coupled receptor, 3
LOC306792
similar to Sphingosine 1-phosphate receptor Edg-3 (S1P receptor Edg-3) (Endothelial differentiation G-protein coupled receptor 3) (Sphingosine 1-phosphate receptor 3) (S1P3) (Lysophospholipid receptor B3)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-11-19
LOC306792
similar to Sphingosine 1-phosphate receptor Edg-3 (S1P receptor Edg-3) (Endothelial differentiation G-protein coupled receptor 3) (Sphingosine 1-phosphate receptor 3) (S1P3) (Lysophospholipid receptor B3)
Symbol and Name status set to provisional
70820 PROVISIONAL
