Symbol:
Msl1
Name:
MSL complex subunit 1
RGD ID:
1564778
Description:
Predicted to enable protein-macromolecule adaptor activity. Predicted to be involved in chromatin remodeling and positive regulation of DNA-templated transcription. Predicted to be located in nuclear speck. Predicted to be part of MSL complex. Orthologous to human MSL1 (MSL complex subunit 1); INTERACTS WITH 1,3,5-trinitro-1,3,5-triazinane; 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC303514; male specific lethal 1 homolog; male-specific lethal 1 homolog; male-specific lethal 1 homolog (Drosophila); RGD1564778; similar to RIKEN cDNA 4121402D02
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
MSL1 (MSL complex subunit 1) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):
Msl1 (male specific lethal 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Msl1 (MSL complex subunit 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
MSL1 (MSL complex subunit 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
MSL1 (MSL complex subunit 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Msl1 (MSL complex subunit 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
MSL1 (MSL complex subunit 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
MSL1 (MSL complex subunit 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Msl1 (MSL complex subunit 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Msl1 (male specific lethal 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
MSL1 (MSL complex subunit 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
msl1a (MSL complex subunit 1a)
Alliance
DIOPT (InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
msl1b (MSL complex subunit 1b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|PANTHER)
Drosophila melanogaster (fruit fly):
msl-1
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|OrthoInspector|PANTHER)
Xenopus tropicalis (tropical clawed frog):
msl1
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|OrthoInspector|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 84,251,362 - 84,263,384 (+) NCBI GRCr8 mRatBN7.2 10 83,755,380 - 83,767,147 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 83,755,720 - 83,765,726 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 88,699,593 - 88,709,611 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 88,197,668 - 88,207,686 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 83,590,370 - 83,600,388 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 86,710,925 - 86,722,659 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 86,711,240 - 86,721,246 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 86,507,409 - 86,518,912 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 87,568,556 - 87,578,572 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 10 82,503,569 - 82,513,585 (+) NCBI Celera Cytogenetic Map 10 q31 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Msl1 Rat (1->4)-beta-D-glucan multiple interactions ISO Msl1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of MSL1 mRNA CTD PMID:36331819 Msl1 Rat 1,2-dimethylhydrazine increases expression ISO Msl1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of MSL1 mRNA CTD PMID:22206623 Msl1 Rat 1,3,5-trinitro-1,3,5-triazinane decreases expression EXP 6480464 cyclonite results in decreased expression of MSL1 mRNA CTD PMID:25559034 Msl1 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of MSL1 mRNA CTD PMID:29097150 Msl1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Msl1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of MSL1 mRNA CTD PMID:19770486 Msl1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of MSL1 mRNA CTD PMID:33387578 Msl1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of MSL1 mRNA CTD PMID:34747641 Msl1 Rat 2-hydroxypropanoic acid increases expression ISO MSL1 (Homo sapiens) 6480464 Lactic Acid results in increased expression of MSL1 mRNA CTD PMID:30851411 Msl1 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of MSL1 mRNA CTD PMID:36041667 Msl1 Rat acetochlor multiple interactions ISO MSL1 (Homo sapiens) 6480464 [Herbicides results in increased abundance of acetochlor] which affects the methylation of MSL1 gene CTD PMID:34516295 Msl1 Rat aflatoxin B1 increases expression ISO Msl1 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of MSL1 mRNA CTD PMID:19770486 Msl1 Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of MSL1 mRNA CTD PMID:30779732 Msl1 Rat antimycin A increases expression ISO MSL1 (Homo sapiens) 6480464 Antimycin A results in increased expression of MSL1 mRNA CTD PMID:33770205 Msl1 Rat antirheumatic drug increases expression ISO MSL1 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of MSL1 mRNA CTD PMID:24449571 Msl1 Rat aristolochic acid A increases expression ISO MSL1 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of MSL1 protein CTD PMID:33212167 Msl1 Rat arsane affects methylation ISO MSL1 (Homo sapiens) 6480464 Arsenic affects the methylation of MSL1 gene CTD PMID:25304211 Msl1 Rat arsenic atom affects methylation ISO MSL1 (Homo sapiens) 6480464 Arsenic affects the methylation of MSL1 gene CTD PMID:25304211 Msl1 Rat arsenous acid increases expression ISO Msl1 (Mus musculus) 6480464 Arsenic Trioxide results in increased expression of MSL1 mRNA CTD PMID:35676786 Msl1 Rat bazedoxifene increases expression ISO MSL1 (Homo sapiens) 6480464 bazedoxifene results in increased expression of MSL1 mRNA CTD PMID:19914376 Msl1 Rat benzo[a]pyrene increases expression ISO Msl1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of MSL1 mRNA CTD PMID:19770486 Msl1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of MSL1 mRNA CTD PMID:25181051 Msl1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of MSL1 mRNA CTD PMID:36041667 Msl1 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of MSL1 mRNA CTD PMID:36041667 Msl1 Rat butanal decreases expression ISO MSL1 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of MSL1 mRNA CTD PMID:26079696 Msl1 Rat cadmium dichloride increases methylation EXP 6480464 Cadmium Chloride results in increased methylation of MSL1 promoter CTD PMID:22457795 Msl1 Rat caffeine affects phosphorylation ISO MSL1 (Homo sapiens) 6480464 Caffeine affects the phosphorylation of MSL1 protein CTD PMID:35688186 Msl1 Rat carbon nanotube decreases expression ISO Msl1 (Mus musculus) 6480464 Nanotubes and Carbon analog results in decreased expression of MSL1 mRNA CTD PMID:25554681 Msl1 Rat corosolic acid increases expression ISO MSL1 (Homo sapiens) 6480464 corosolic acid results in increased expression of MSL1 mRNA CTD PMID:37939859 Msl1 Rat cyclosporin A increases expression ISO Msl1 (Mus musculus) 6480464 Cyclosporine results in increased expression of MSL1 mRNA CTD PMID:19770486 Msl1 Rat diarsenic trioxide increases expression ISO Msl1 (Mus musculus) 6480464 Arsenic Trioxide results in increased expression of MSL1 mRNA CTD PMID:35676786 Msl1 Rat Dibutyl phosphate affects expression ISO MSL1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of MSL1 mRNA CTD PMID:37042841 Msl1 Rat diuron increases expression EXP 6480464 Diuron results in increased expression of MSL1 mRNA CTD PMID:21551480 Msl1 Rat dorsomorphin multiple interactions ISO MSL1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Msl1 Rat doxorubicin decreases expression ISO MSL1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of MSL1 mRNA CTD PMID:29803840 Msl1 Rat enzyme inhibitor multiple interactions ISO MSL1 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of MSL1 protein CTD PMID:23301498 Msl1 Rat ethanol affects expression ISO Msl1 (Mus musculus) 6480464 Ethanol affects the expression of MSL1 mRNA CTD PMID:30319688 Msl1 Rat formaldehyde decreases expression ISO MSL1 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of MSL-1 mRNA CTD PMID:20655997 Msl1 Rat FR900359 affects phosphorylation ISO MSL1 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of MSL1 protein CTD PMID:37730182 Msl1 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of MSL1 mRNA CTD PMID:33387578 Msl1 Rat herbicide multiple interactions ISO MSL1 (Homo sapiens) 6480464 [Herbicides results in increased abundance of acetochlor] which affects the methylation of MSL1 gene CTD PMID:34516295 Msl1 Rat lead(0) decreases expression ISO MSL1 (Homo sapiens) 6480464 Lead results in decreased expression of MSL1 mRNA CTD PMID:19921347 Msl1 Rat lead(0) affects splicing ISO MSL1 (Homo sapiens) 6480464 Lead affects the splicing of MSL1 mRNA CTD PMID:28903495 Msl1 Rat methyl methanesulfonate decreases expression ISO MSL1 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of MSL1 mRNA CTD PMID:23649840 Msl1 Rat methylmercury chloride decreases expression ISO MSL1 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of MSL1 mRNA CTD PMID:28001369 Msl1 Rat methylparaben decreases expression ISO MSL1 (Homo sapiens) 6480464 methylparaben results in decreased expression of MSL1 mRNA CTD PMID:31745603 Msl1 Rat ozone multiple interactions ISO MSL1 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of MSL1 mRNA CTD PMID:35430440 Msl1 Rat p-toluidine decreases expression EXP 6480464 4-toluidine results in decreased expression of MSL1 mRNA CTD PMID:27638505 Msl1 Rat panobinostat decreases expression ISO MSL1 (Homo sapiens) 6480464 Panobinostat results in decreased expression of MSL1 mRNA CTD PMID:33770205 Msl1 Rat panobinostat multiple interactions ISO MSL1 (Homo sapiens) 6480464 (+)-JQ1 compound promotes the reaction [panobinostat affects the expression of MSL1 mRNA] and panobinostat promotes the reaction [(+)-JQ1 compound affects the expression of MSL1 mRNA] CTD PMID:26733615 Msl1 Rat panobinostat affects expression ISO MSL1 (Homo sapiens) 6480464 panobinostat affects the expression of MSL1 mRNA CTD PMID:26733615 Msl1 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of MSL1 mRNA CTD PMID:33387578 Msl1 Rat pentanal decreases expression ISO MSL1 (Homo sapiens) 6480464 pentanal results in decreased expression of MSL1 mRNA CTD PMID:26079696 Msl1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Msl1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of MSL1 mRNA CTD PMID:36331819 Msl1 Rat phenylmercury acetate decreases expression ISO MSL1 (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of MSL1 mRNA CTD PMID:26272509 Msl1 Rat phenylmercury acetate multiple interactions ISO MSL1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of MSL1 mRNA CTD PMID:27188386 Msl1 Rat pirinixic acid decreases expression ISO Msl1 (Mus musculus) 6480464 pirinixic acid results in decreased expression of MSL1 mRNA CTD PMID:23811191 Msl1 Rat rac-lactic acid increases expression ISO MSL1 (Homo sapiens) 6480464 Lactic Acid results in increased expression of MSL1 mRNA CTD PMID:30851411 Msl1 Rat resveratrol multiple interactions ISO MSL1 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of MSL1 mRNA CTD PMID:23557933 Msl1 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of MSL1 mRNA CTD PMID:19013527 Msl1 Rat SB 431542 multiple interactions ISO MSL1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Msl1 Rat sunitinib increases expression ISO MSL1 (Homo sapiens) 6480464 Sunitinib results in increased expression of MSL1 mRNA CTD PMID:31533062 Msl1 Rat tetrachloromethane decreases expression ISO Msl1 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of MSL1 mRNA CTD PMID:31919559 Msl1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of MSL1 mRNA CTD PMID:34492290 Msl1 Rat titanium dioxide decreases expression ISO Msl1 (Mus musculus) 6480464 titanium dioxide results in decreased expression of MSL1 mRNA CTD PMID:23557971 Msl1 Rat titanium dioxide decreases methylation ISO Msl1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of MSL1 promoter CTD PMID:35295148 Msl1 Rat trichostatin A decreases expression ISO MSL1 (Homo sapiens) 6480464 trichostatin A results in decreased expression of MSL1 mRNA CTD PMID:24935251 and PMID:26272509 Msl1 Rat trichostatin A affects expression ISO MSL1 (Homo sapiens) 6480464 trichostatin A affects the expression of MSL1 mRNA CTD PMID:28542535 Msl1 Rat trichostatin A multiple interactions ISO MSL1 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of MSL1 mRNA CTD PMID:27188386 Msl1 Rat triphenyl phosphate affects expression ISO MSL1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of MSL1 mRNA CTD PMID:37042841 Msl1 Rat triptonide decreases expression ISO Msl1 (Mus musculus) 6480464 triptonide results in decreased expression of MSL1 mRNA CTD PMID:33045310 Msl1 Rat troglitazone decreases expression ISO Msl1 (Mus musculus) 6480464 troglitazone results in decreased expression of MSL1 mRNA CTD PMID:28973697 Msl1 Rat valproic acid affects expression ISO Msl1 (Mus musculus) 6480464 Valproic Acid affects the expression of MSL1 mRNA CTD PMID:17963808 Msl1 Rat valproic acid multiple interactions ISO MSL1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of MSL1 mRNA CTD PMID:27188386 Msl1 Rat valproic acid decreases expression ISO MSL1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of MSL1 mRNA CTD PMID:23179753 more ... Msl1 Rat valproic acid affects expression ISO MSL1 (Homo sapiens) 6480464 Valproic Acid affects the expression of MSL1 mRNA CTD PMID:25979313 Msl1 Rat valproic acid decreases expression ISO Msl1 (Mus musculus) 6480464 Valproic Acid results in decreased expression of MSL1 mRNA CTD PMID:21427059 Msl1 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of MSL1 mRNA CTD PMID:19015723 Msl1 Rat vorinostat decreases expression ISO MSL1 (Homo sapiens) 6480464 vorinostat results in decreased expression of MSL1 mRNA CTD PMID:27188386
(1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 1,3,5-trinitro-1,3,5-triazinane (EXP) 17alpha-ethynylestradiol (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-hydroxypropanoic acid (ISO) 4,4'-sulfonyldiphenol (EXP) acetochlor (ISO) aflatoxin B1 (ISO) amphetamine (EXP) antimycin A (ISO) antirheumatic drug (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) bazedoxifene (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP) bisphenol F (EXP) butanal (ISO) cadmium dichloride (EXP) caffeine (ISO) carbon nanotube (ISO) corosolic acid (ISO) cyclosporin A (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) diuron (EXP) dorsomorphin (ISO) doxorubicin (ISO) enzyme inhibitor (ISO) ethanol (ISO) formaldehyde (ISO) FR900359 (ISO) gentamycin (EXP) herbicide (ISO) lead(0) (ISO) methyl methanesulfonate (ISO) methylmercury chloride (ISO) methylparaben (ISO) ozone (ISO) p-toluidine (EXP) panobinostat (ISO) paracetamol (EXP) pentanal (ISO) perfluorooctane-1-sulfonic acid (ISO) phenylmercury acetate (ISO) pirinixic acid (ISO) rac-lactic acid (ISO) resveratrol (ISO) rotenone (EXP) SB 431542 (ISO) sunitinib (ISO) tetrachloromethane (ISO) thioacetamide (EXP) titanium dioxide (ISO) trichostatin A (ISO) triphenyl phosphate (ISO) triptonide (ISO) troglitazone (ISO) valproic acid (ISO) vinclozolin (EXP) vorinostat (ISO)
Msl1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 84,251,362 - 84,263,384 (+) NCBI GRCr8 mRatBN7.2 10 83,755,380 - 83,767,147 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 83,755,720 - 83,765,726 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 88,699,593 - 88,709,611 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 88,197,668 - 88,207,686 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 83,590,370 - 83,600,388 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 86,710,925 - 86,722,659 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 86,711,240 - 86,721,246 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 86,507,409 - 86,518,912 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 87,568,556 - 87,578,572 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 10 82,503,569 - 82,513,585 (+) NCBI Celera Cytogenetic Map 10 q31 NCBI
MSL1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 40,121,971 - 40,136,917 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 40,121,971 - 40,136,917 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 38,278,224 - 38,293,170 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 35,532,316 - 35,546,568 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 17 34,939,245 - 34,953,515 (+) NCBI Celera Cytogenetic Map 17 q21.1 NCBI HuRef 17 34,072,418 - 34,086,448 (+) NCBI HuRef CHM1_1 17 38,514,496 - 38,528,748 (+) NCBI CHM1_1 T2T-CHM13v2.0 17 40,985,855 - 41,000,801 (+) NCBI T2T-CHM13v2.0
Msl1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 98,684,214 - 98,698,685 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 98,686,342 - 98,698,685 (+) Ensembl GRCm39 Ensembl GRCm38 11 98,793,508 - 98,807,862 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 98,795,516 - 98,807,859 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 98,657,083 - 98,669,173 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 98,611,606 - 98,622,517 (+) NCBI MGSCv36 mm8 Celera 11 108,450,534 - 108,462,629 (+) NCBI Celera Cytogenetic Map 11 D NCBI cM Map 11 62.67 NCBI
Msl1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955451 14,772,224 - 14,780,839 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955451 14,769,893 - 14,783,213 (+) NCBI ChiLan1.0 ChiLan1.0
MSL1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 24,818,118 - 24,833,517 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 26,712,913 - 26,727,748 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 17,152,296 - 17,167,127 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 17,373,780 - 17,387,329 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 17,373,780 - 17,387,351 (-) Ensembl panpan1.1 panPan2
MSL1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 9 22,429,371 - 22,441,686 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 9 22,429,522 - 22,441,767 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 9 21,901,643 - 21,913,922 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 9 23,222,191 - 23,234,472 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 9 23,222,204 - 23,234,365 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 9 21,995,939 - 22,008,217 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 9 22,254,672 - 22,266,943 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 9 22,379,645 - 22,391,924 (-) NCBI UU_Cfam_GSD_1.0
Msl1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 21,825,478 - 21,839,052 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936490 15,236,081 - 15,249,926 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936490 15,236,087 - 15,249,661 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
MSL1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 12 22,224,615 - 22,237,587 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 12 22,224,611 - 22,237,557 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 12 22,502,558 - 22,515,232 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MSL1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 16 66,040,879 - 66,055,975 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 16 66,040,661 - 66,055,942 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666077 36,944,141 - 36,960,612 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Msl1
.
Assembly: RGSC_v3.4 Assembly: Rnor_5.0 Assembly: Rnor_6.0
Predicted Target Of
Count of predictions: 112 Count of miRNA genes: 92 Interacting mature miRNAs: 108 Transcripts: ENSRNOT00000012812 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1549846 Scl47 Serum cholesterol level QTL 47 3.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 50574707 95574707 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 631552 Vetf2 Vascular elastic tissue fragility QTL 2 4.5 0.0002 aorta elastic tissue integrity trait (VT:0010556) artery internal elastic lamina non-tumorous lesion count (CMO:0001913) 10 41142633 86142633 Rat 61449 Ciaa2 CIA Autoantibody QTL 2 7.1 blood autoantibody amount (VT:0003725) calculated serum anti-type 2 collagen antibody titer (CMO:0001279) 10 63221094 107211142 Rat 631555 Bp134 Blood pressure QTL 134 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 80515287 91230079 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1298078 Stresp5 Stress response QTL 5 2.99 0.00025 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 42045676 104670812 Rat 1549831 Bss6 Bone structure and strength QTL 6 4 lumbar vertebra strength trait (VT:0010574) vertebra ultimate force (CMO:0001678) 10 57576521 102576521 Rat 70164 Bw21 Body weight QTL 21 4.36 0.00005 body mass (VT:0001259) body weight (CMO:0000012) 10 53797494 98952626 Rat 4889948 Bss91 Bone structure and strength QTL 91 4 tibia area (VT:1000281) tibia midshaft total cross-sectional area (CMO:0001715) 10 82564856 92369470 Rat 61463 Bp12 Blood pressure QTL 12 6.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 41333258 86333258 Rat 2298548 Neuinf7 Neuroinflammation QTL 7 3.4 nervous system integrity trait (VT:0010566) spinal cord RT1-B protein level (CMO:0002132) 10 72224939 107211142 Rat 1579919 Bp281 Blood pressure QTL 281 0.01 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 74372084 94965338 Rat 1302404 Cia27 Collagen induced arthritis QTL 27 2.6 0.0045 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 10 76452683 107211142 Rat 1300107 Rf18 Renal function QTL 18 3.41 urine output (VT:0003620) timed urine volume (CMO:0000260) 10 78775516 98279596 Rat 8694173 Bw149 Body weight QTL 149 4.38 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 10 44441699 89441699 Rat 2300218 Hpcl2 Hepatic cholesterol level QTL 2 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 45029650 95600334 Rat 2317754 Glom25 Glomerulus QTL 25 3.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 82685200 107211142 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 70171 Cari1 Carrageenan-induced inflammation QTL 1 4.9 0.0005 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 10 53797385 107211142 Rat 10450495 Bp383 Blood pressure QTL 383 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 76246085 94965338 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2292617 Ept18 Estrogen-induced pituitary tumorigenesis QTL 18 3.9 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 10 73453136 96120911 Rat 2301967 Cm73 Cardiac mass QTL 73 4.55 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 10 14487011 89062041 Rat 2313103 Bss80 Bone structure and strength QTL 80 2 0.0001 tibia strength trait (VT:1000284) tibia midshaft endosteal cross-sectional area (CMO:0001716) 10 62057807 107057807 Rat 2293646 Bss25 Bone structure and strength QTL 25 10.96 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 10 69738412 107211142 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 70188 BpQTLcluster1 Blood pressure QTL cluster 1 4.864 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 42323132 87323132 Rat 2300172 Bmd57 Bone mineral density QTL 57 9.8 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 10 69738412 107211142 Rat 724516 Uae17 Urinary albumin excretion QTL 17 3.6 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 10 78210622 85220348 Rat 70193 Mcs7 Mammary carcinoma susceptibility QTL 7 2.38 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 10 72224939 107211142 Rat 2313105 Bss79 Bone structure and strength QTL 79 1.8 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 62057807 107057807 Rat 9589030 Epfw9 Epididymal fat weight QTL 9 19.24 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 10 44441699 89441699 Rat 1357344 Bp249 Blood pressure QTL 249 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 66743655 98003205 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 70198 BpQTLcluster9 Blood pressure QTL cluster 9 2.94 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 42323132 87323132 Rat 2306970 Anxrr22 Anxiety related response QTL 22 5.95 fear/anxiety-related behavior trait (VT:1000241) number of periods of voluntary immobility (CMO:0001045) 10 61345276 98211570 Rat 1359017 Hrtrt21 Heart rate QTL 21 2.4 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 10 51772940 96772940 Rat 2293663 Bss33 Bone structure and strength QTL 33 9.34 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 10 69738412 107211142 Rat 7387312 Bw125 Body weight QTL 125 3 0.0047 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight (CMO:0000356) 10 64890616 107211142 Rat 2312672 Insul15 Insulin level QTL 15 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 10 57134272 102134272 Rat 6893357 Bw102 Body weight QTL 102 0.5 0.36 body mass (VT:0001259) body weight (CMO:0000012) 10 80515287 101325465 Rat 2317029 Aia19 Adjuvant induced arthritis QTL 19 2.98 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 66978955 107211142 Rat 2303589 Bw87 Body weight QTL 87 2 body mass (VT:0001259) body weight (CMO:0000012) 10 81285008 107211142 Rat 724556 Pur2 Proteinuria QTL 2 5.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 22427500 90627625 Rat 2306793 Ean5 Experimental allergic neuritis QTL 5 4.7 nervous system integrity trait (VT:0010566) IFNG-secreting splenocyte count (CMO:0002122) 10 72552416 93995749 Rat 61387 Bp1 Blood pressure QTL 1 5.1 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 51770177 107211142 Rat 2317039 Aia6 Adjuvant induced arthritis QTL 6 4.31 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 66978955 107211142 Rat 61396 Bp9 Blood pressure QTL 9 4.8 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 68420376 107211142 Rat 1358915 Stresp7 Stress response QTL 7 3.52 blood norepinephrine amount (VT:0005663) plasma norepinephrine level (CMO:0001010) 10 78899655 87307728 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 70364 Bp72 Blood pressure QTL 72 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 51121100 96121100 Rat 10450498 Bp384 Blood pressure QTL 384 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 67750049 107211142 Rat 4889492 Pancm2 Pancreatic morphology QTL 2 3.2 pancreatic beta cell morphology trait (VT:0005217) ratio of insulin-positive cell area to total area of splenic region of pancreas (CMO:0001814) 10 76748906 107211142 Rat 6893366 Bw106 Body weight QTL 106 0.3 0.47 body mass (VT:0001259) body weight (CMO:0000012) 10 70199100 107211142 Rat 2293698 Bss43 Bone structure and strength QTL 43 5.33 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 10 59209888 104209888 Rat 631530 Tls3 T-lymphoma susceptibility QTL 3 0 0.0001 thymus integrity trait (VT:0010555) percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911) 10 51774612 95600334 Rat 1354608 Cm33 Cardiac mass QTL 33 2.8 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 10 54809292 99809292 Rat 1558643 Cm44 Cardiac mass QTL 44 4.8 0.0000368 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 61345276 99703528 Rat 631535 Cm51 Cardiac mass QTL 51 3 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 10 51786282 91669536 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1576308 Schws1 Schwannoma susceptibility QTL 1 0.0041 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 40035094 102359817 Rat 631269 Cia22 Collagen induced arthritis QTL 22 8.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 631270 Cia23 Collagen induced arthritis QTL 23 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 7411614 Foco18 Food consumption QTL 18 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 44441699 89441699 Rat 2325836 Bp346 Blood pressure QTL 346 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 76246085 84007272 Rat 6893336 Cm75 Cardiac mass QTL 75 0.1 0.87 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 61345276 99703528 Rat 631547 Bp87 Blood pressure QTL 87 4.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 47369470 92369470 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 2292438 Bp311 Blood pressure QTL 311 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 76246085 107211142 Rat 2312662 Slep8 Serum leptin concentration QTL 8 0.05 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 10 57134272 102134272 Rat 12880050 Am10 Aortic mass QTL 10 0.016 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 10 74372084 84007272 Rat 1358188 Ept9 Estrogen-induced pituitary tumorigenesis QTL 9 3.9 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 10 73453136 96120911 Rat 631537 Oia4 Oil induced arthritis QTL 4 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 75631887 87055282 Rat 634354 Rends3 Renal damage susceptibility QTL 3 0.05 kidney blood vessel morphology trait (VT:0000530) organ lesion measurement (CMO:0000677) 10 79813789 85160854 Rat 1642980 Bp300 Blood pressure QTL 300 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 68383129 107211142 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat 2312668 Scl65 Serum cholesterol level QTL 65 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 57134272 102134272 Rat
RH128648
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 83,766,807 - 83,767,007 (+) MAPPER mRatBN7.2 Rnor_6.0 10 86,722,328 - 86,722,527 NCBI Rnor6.0 Rnor_5.0 10 86,518,573 - 86,518,772 UniSTS Rnor5.0 RGSC_v3.4 10 87,579,644 - 87,579,843 UniSTS RGSC3.4 Celera 10 82,514,657 - 82,514,856 UniSTS RH 3.4 Map 10 860.5 UniSTS Cytogenetic Map 10 q31 UniSTS
BI289288
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 83,764,834 - 83,765,007 (+) MAPPER mRatBN7.2 Rnor_6.0 10 86,720,355 - 86,720,527 NCBI Rnor6.0 Rnor_5.0 10 86,516,600 - 86,516,772 UniSTS Rnor5.0 RGSC_v3.4 10 87,577,671 - 87,577,843 UniSTS RGSC3.4 Celera 10 82,512,684 - 82,512,856 UniSTS RH 3.4 Map 10 840.3 UniSTS Cytogenetic Map 10 q31 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000012812 ⟹ ENSRNOP00000012812
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 83,755,720 - 83,765,726 (+) Ensembl Rnor_6.0 Ensembl 10 86,711,240 - 86,721,246 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000101887 ⟹ ENSRNOP00000095416
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 83,758,614 - 83,765,726 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000103183 ⟹ ENSRNOP00000097671
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 83,760,942 - 83,765,726 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000107825 ⟹ ENSRNOP00000079028
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 83,755,720 - 83,765,726 (+) Ensembl
RefSeq Acc Id:
NM_001107048 ⟹ NP_001100518
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 84,251,965 - 84,261,981 (+) NCBI mRatBN7.2 10 83,755,720 - 83,765,736 (+) NCBI Rnor_6.0 10 86,711,240 - 86,721,256 (+) NCBI Rnor_5.0 10 86,507,409 - 86,518,912 (+) NCBI RGSC_v3.4 10 87,568,556 - 87,578,572 (+) RGD Celera 10 82,503,569 - 82,513,585 (+) RGD
Sequence:
TCCGTCTCGGTCCCCCGCGCCGCTCCGGACCACTATGACCATGAGATCCGCAGTGTTCAAGGCGGCCGCGGCCCCTGCCGGCGGCAACCCCGAGCAGCGACTGGACTACGAGCGGGCTGCGGCTCTGG
hide sequence
RefSeq Acc Id:
XM_006247304 ⟹ XP_006247366
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 84,251,362 - 84,263,384 (+) NCBI mRatBN7.2 10 83,755,380 - 83,767,147 (+) NCBI Rnor_6.0 10 86,710,925 - 86,722,659 (+) NCBI Rnor_5.0 10 86,507,409 - 86,518,912 (+) NCBI
Sequence:
AGGCGGGCCCGGCCGGGCCAGGGGGGGCCGAAGCGAGCTCCGGGGATGAGCTCGGGGGCGGCTGGGTGCGAGCTCCTGCCTCTGCGGCGAAGGCGACCGTGGCGGCAGCAGAGGCGGCGGCGAGGCCA
hide sequence
RefSeq Acc Id:
NP_001100518 ⟸ NM_001107048
- UniProtKB:
D3ZBD0 (UniProtKB/TrEMBL), A6HIV1 (UniProtKB/TrEMBL)
- Sequence:
MTMRSAVFKAAAAPAGGNPEQRLDYERAAALGGPEDESGAAETHFLPRHRKLKEPGPPLASTQGGSPAPSPAGCGGGKGRGLLLPAGAAPGQQEESWGGSVPLPCPPPATKQAGIGGEPVAAGAGCSP
hide sequence
RefSeq Acc Id:
XP_006247366 ⟸ XM_006247304
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I5ZM69 (UniProtKB/TrEMBL), A6HIV0 (UniProtKB/TrEMBL)
- Sequence:
MTMRSAVFKAAAAPAGGNPEQRLDYERAAALGGPEDESGAAETHFLPRHRKLKEPGPPLASTQGGSPAPSPAGCGGGKGRGLLLPAGAAPGQQEESWGGSVPLPCPPPATKQAGIGGEPVAAGAGCSP
hide sequence
Ensembl Acc Id:
ENSRNOP00000012812 ⟸ ENSRNOT00000012812
Ensembl Acc Id:
ENSRNOP00000095416 ⟸ ENSRNOT00000101887
Ensembl Acc Id:
ENSRNOP00000097671 ⟸ ENSRNOT00000103183
Ensembl Acc Id:
ENSRNOP00000079028 ⟸ ENSRNOT00000107825
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2018-12-04
Msl1
MSL complex subunit 1
Msl1
male specific lethal 1 homolog
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2016-04-14
Msl1
male specific lethal 1 homolog
Msl1
male-specific lethal 1 homolog (Drosophila)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2009-06-12
Msl1
male-specific lethal 1 homolog (Drosophila)
RGD1564778
similar to RIKEN cDNA 4121402D02
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
RGD1564778
similar to RIKEN cDNA 4121402D02
RGD1564778_predicted
similar to RIKEN cDNA 4121402D02 (predicted)
'predicted' is removed
2292626 APPROVED
2006-03-07
RGD1564778_predicted
similar to RIKEN cDNA 4121402D02 (predicted)
LOC303514
similar to RIKEN cDNA 4121402D02
Symbol and Name status set to approved
1299863 APPROVED
2006-02-09
LOC303514
similar to RIKEN cDNA 4121402D02
Symbol and Name status set to provisional
70820 PROVISIONAL
