Advanced Search (OLGA)

Gene: Gdf3 (growth differentiation factor 3) Rattus norvegicus

Analyze

Symbol:

Gdf3

Name:

growth differentiation factor 3

RGD ID:

1564178

Description:

Predicted to enable cytokine activity and protein kinase binding activity. Predicted to be involved in several processes, including BMP signaling pathway; negative regulation of BMP signaling pathway; and positive regulation of fat cell differentiation. Predicted to act upstream of or within several processes, including anterior/posterior axis specification; negative regulation of myoblast differentiation; and response to dietary excess. Predicted to be located in cytoplasm. Predicted to be active in extracellular space. Human ortholog(s) of this gene implicated in Klippel-Feil syndrome 3 and isolated microphthalmia 7. Orthologous to human GDF3 (growth differentiation factor 3); INTERACTS WITH 1,2-dimethylhydrazine; 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

growth/differentiation factor 3; LOC500311; RGD1564178; similar to growth/differentiation factor GDF-3 precursor - mouse

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GDF3 (growth differentiation factor 3)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Gdf3 (growth differentiation factor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Gdf3 (growth differentiation factor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GDF3 (growth differentiation factor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GDF3 (growth differentiation factor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Gdf3 (growth differentiation factor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GDF3 (growth differentiation factor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GDF3 (growth differentiation factor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Gdf3 (growth differentiation factor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Gdf3 (growth differentiation factor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	TOM1 (target of myb1 membrane trafficking protein)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	GDF3 (growth differentiation factor 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Gdf3 (growth differentiation factor 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gdf3 (growth differentiation factor 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	gdf3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	gdf1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	157,503,547 - 157,507,923 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	157,502,884 - 157,507,907 (-)	Ensembl				GRCr8
mRatBN7.2	4	155,831,572 - 155,835,953 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	155,830,909 - 155,835,937 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	162,096,256 - 162,100,528 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	157,879,466 - 157,883,738 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	156,524,567 - 156,528,834 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	155,417,667 - 155,422,014 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	155,417,004 - 155,421,998 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	222,441,866 - 222,445,551 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	159,064,054 - 159,067,854 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	144,650,730 - 144,655,147 (-)	NCBI		Celera
Cytogenetic Map	4	q42	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Camptocormia (ISO)

congenital heart disease (ISO)

Desbuquois dysplasia (ISO)

Edema (ISO)

Germ Cell and Embryonal Neoplasms (ISO)

isolated microphthalmia 7 (ISO)

Isolated Microphthalmia with Coloboma 6 (ISO)

Klippel-Feil syndrome 3 (ISO)

scoliosis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-catechin (ISO)

1,2-dimethylhydrazine (EXP)

17alpha-ethynylestradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

4,4'-sulfonyldiphenol (ISO)

5-aza-2'-deoxycytidine (ISO)

5-fluorouracil (ISO)

acetic acid (ISO)

all-trans-retinoic acid (ISO)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bromochloroacetic acid (ISO)

bucladesine (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

cisplatin (ISO)

dichloroacetic acid (ISO)

folic acid (ISO)

genistein (ISO)

gentamycin (EXP)

inulin (ISO)

lidocaine (EXP)

lipopolysaccharide (ISO)

methapyrilene (ISO)

Monobutylphthalate (EXP)

ozone (ISO)

paracetamol (ISO)

paraquat (ISO)

perfluorooctane-1-sulfonic acid (ISO)

tamoxifen (ISO)

testosterone (ISO)

trichloroethene (EXP)

triclosan (ISO)

triptonide (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

animal organ development (IEA)

biological_process (ND)

BMP signaling pathway (IBA)

endoderm development (ISO)

eye development (ISO)

formation of anatomical boundary (ISO)

in utero embryonic development (ISO)

mesoderm development (ISO)

negative regulation of BMP signaling pathway (ISO)

negative regulation of epidermal cell differentiation (ISO)

negative regulation of myoblast differentiation (ISO)

notochord development (ISO)

positive regulation of fat cell differentiation (IEA,ISO)

primitive streak formation (ISO)

regulation of cell fate commitment (ISO)

response to dietary excess (ISO)

signal transduction (ISO)

skeletal system development (ISO)

somite rostral/caudal axis specification (ISO)

Cellular Component

cytoplasm (ISO)

extracellular region (IEA)

extracellular space (IBA,IEA)

Molecular Function

cytokine activity (IBA,IEA)

growth factor activity (IEA)

protein binding (ISO)

protein kinase binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
3.	GOA pipeline	RGD automated data pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	Comprehensive gene review and curation	RGD comprehensive gene curation

Additional References at PubMed

PMID:16368929	PMID:17936261	PMID:18480259	PMID:18823971	PMID:19864492	PMID:21805089	PMID:22223106	PMID:23844157	PMID:35477223

Genomics

Comparative Map Data

Gdf3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	157,503,547 - 157,507,923 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	157,502,884 - 157,507,907 (-)	Ensembl				GRCr8
mRatBN7.2	4	155,831,572 - 155,835,953 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	155,830,909 - 155,835,937 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	162,096,256 - 162,100,528 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	157,879,466 - 157,883,738 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	156,524,567 - 156,528,834 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	155,417,667 - 155,422,014 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	155,417,004 - 155,421,998 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	222,441,866 - 222,445,551 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	159,064,054 - 159,067,854 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	144,650,730 - 144,655,147 (-)	NCBI		Celera
Cytogenetic Map	4	q42	NCBI

GDF3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	7,689,784 - 7,695,775 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	7,689,784 - 7,695,775 (-)	Ensembl			hg38	GRCh38
GRCh37	12	7,842,380 - 7,848,371 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	7,733,648 - 7,739,627 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	12	7,733,647 - 7,739,627	NCBI
Celera	12	9,419,392 - 9,425,368 (-)	NCBI		Celera
Cytogenetic Map	12	p13.31	NCBI
HuRef	12	7,656,489 - 7,662,465 (-)	NCBI		HuRef
CHM1_1	12	7,839,618 - 7,847,334 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	12	7,704,552 - 7,710,540 (-)	NCBI		T2T-CHM13v2.0

Gdf3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	122,582,362 - 122,587,046 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	122,582,362 - 122,587,046 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	6	122,605,403 - 122,610,087 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	122,605,403 - 122,610,087 (-)	Ensembl			mm10	GRCm38
MGSCv37	6	122,555,421 - 122,560,089 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	6	122,571,022 - 122,575,690 (-)	NCBI		MGSCv36	mm8
Celera	6	124,400,537 - 124,405,205 (-)	NCBI		Celera
Cytogenetic Map	6	F1	NCBI
cM Map	6	57.7	NCBI

Gdf3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955413	6,493,734 - 6,516,315 (-)	NCBI	ChiLan1.0	ChiLan1.0

GDF3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	13,248,001 - 13,262,305 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	13,244,760 - 13,259,063 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	7,813,288 - 7,819,418 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	7,972,941 - 7,979,654 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	7,972,907 - 7,979,815 (-)	Ensembl			panPan2	panpan1.1

GDF3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	27	37,125,845 - 37,129,567 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	27	37,125,928 - 37,129,484 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	27	9,486,781 - 9,490,505 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	27	37,475,220 - 37,478,894 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	27	37,475,303 - 37,478,814 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	27	37,356,251 - 37,359,922 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	27	37,391,174 - 37,394,862 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	27	8,972,861 - 8,976,557 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Gdf3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	98,790,269 - 98,799,229 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004937847	7,456 - 16,783 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004937847	8,179 - 16,783 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GDF3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	62,835,880 - 62,841,884 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	5	62,835,926 - 62,841,827 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	65,666,056 - 65,672,100 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GDF3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	7,727,818 - 7,733,514 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	7,727,913 - 7,733,075 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666063	470,438 - 475,790 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gdf3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624860	4,968,624 - 4,970,362 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Gdf3
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	6	24,489,549 - 24,493,669 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Gdf3
16 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	93
Count of miRNA genes:	81
Interacting mature miRNAs:	81
Transcripts:	ENSRNOT00000041552
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
6478754	Anxrr43	Anxiety related response QTL 43		0.14035	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	146370897	184426481	Rat
724558	Plsm2	Polydactyly-luxate syndrome (PLS) morphotypes QTL 2		0.0003	hindlimb integrity trait (VT:0010563)	hind foot phalanges count (CMO:0001949)	4	134095016	179095016	Rat
1582237	Kidm34	Kidney mass QTL 34	4	0.0001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	4	149763204	169799698	Rat
61446	Coreg2	Compensatory renal growth QTL 2	3.5		kidney mass (VT:0002707)	compensatory renal growth score (CMO:0001894)	4	150095743	159267220	Rat
6478757	Anxrr44	Anxiety related response QTL 44		0.01087	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
6478693	Anxrr32	Anxiety related response QTL 32		0.00092	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	4	146370897	184426481	Rat
1358364	Sradr4	Stress Responsive Adrenal Weight QTL 4	4.92		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	4	131384565	176384565	Rat
10755501	Bp390	Blood pressure QTL 390	2.5		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	4	27730518	170099664	Rat
61451	Ciaa4	CIA Autoantibody QTL 4	3.1		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	4	123870974	168870974	Rat
1331738	Bp209	Blood pressure QTL 209	2.979		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	140059299	181024663	Rat
1331802	Srn5	Serum renin concentration QTL 5	3.045		renin activity (VT:0005581)	plasma renin activity level (CMO:0000116)	4	117559384	162559384	Rat
6478700	Anxrr33	Anxiety related response QTL 33		0.00896	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	146370897	184426481	Rat
1298524	Oia8	Oil induced arthritis QTL 8			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	140059299	184426481	Rat
10053718	Scort25	Serum corticosterone level QTL 25	2.15	0.0097	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	157292416	184426481	Rat
738009	Sach4	Saccharine consumption QTL 4	4.9	0.000016	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	60916264	184426481	Rat
737821	Hcar9	Hepatocarcinoma resistance QTL 9	3.7		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	4	106848959	168870974	Rat
634335	Anxrr16	Anxiety related response QTL 16	7.22		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	94638356	168870820	Rat
7411558	Bw133	Body weight QTL 133	13.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	127263297	172263297	Rat
6478778	Anxrr51	Anxiety related response QTL 51		0.25384	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	4	126334185	171334185	Rat
10401796	Kidm48	Kidney mass QTL 48			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	4	147299608	184426481	Rat
6478718	Anxrr34	Anxiety related response QTL 34		0.00896	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	146370897	184426481	Rat
6478782	Anxrr52	Anxiety related response QTL 52		0.02091	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
631511	Pia7	Pristane induced arthritis QTL 7	4.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	123870974	168870974	Rat
634347	Hcar8	Hepatocarcinoma resistance QTL 8	5.8		liver integrity trait (VT:0010547)	liver tumorous lesion area to total liver area ratio (CMO:0001075)	4	124700988	169700988	Rat
6478720	Alc23	Alcohol consumption QTL 23		0.00509	drinking behavior trait (VT:0001422)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	155834926	184426481	Rat
6478785	Anxrr53	Anxiety related response QTL 53		0.01397	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
738031	Alc14	Alcohol consumption QTL 14	7.6	0.00003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	60916264	174095838	Rat
1576316	Ept5	Estrogen-induced pituitary tumorigenesis QTL 5	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	4	100752691	179366077	Rat
1581566	Eae21	Experimental allergic encephalomyelitis QTL 21	6.2		body mass (VT:0001259)	maximum body weight loss to initial body weight ratio (CMO:0001400)	4	137447185	182447185	Rat
1576305	Emca6	Estrogen-induced mammary cancer QTL 6	5.8		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	4	45429709	157555683	Rat
1578674	Bmd12	Bone mineral density QTL 12	3.8		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	4	137430611	182430611	Rat
6478728	Anxrr36	Anxiety related response QTL 36		0.01061	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
738016	Alc16	Alcohol consumption QTL 16	3.6	0.00015	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	60916264	184426481	Rat
1358202	Gluco11	Glucose level QTL 11	2.4	0.02	adipocyte glucose uptake trait (VT:0004185)	absolute change in adipocyte glucose uptake (CMO:0000873)	4	86709649	168870974	Rat
61422	Cia13	Collagen induced arthritis QTL 13	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	134199006	168870974	Rat
634342	Cia24	Collagen induced arthritis QTL 24	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	148121375	176967367	Rat
6478733	Anxrr37	Anxiety related response QTL 37		0.00095	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
737978	Pia23	Pristane induced arthritis QTL 23	5.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	123870974	168870974	Rat
61362	Oia2	Oil induced arthritis QTL 2		0.001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	140059299	184426481	Rat
631674	Iddm14	Insulin dependent diabetes mellitus QTL 14			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	4	65495851	159259805	Rat
6478737	Anxrr38	Anxiety related response QTL 38		0.00159	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
12798519	Anxrr54	Anxiety related response QTL 54	2.54	0.05	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	116184844	161184844	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	12212457	182430611	Rat
6478748	Anxrr42	Anxiety related response QTL 42		0.28008	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	146370897	184426481	Rat
12798525	Anxrr57	Anxiety related response QTL 57	3.21	0.05	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	148834094	168870974	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	8	39	103	65	63	34	34	34	6	206	96	5	79	53	78	29	14	14

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001109671	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473964	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ372084	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000041552 ⟹ ENSRNOP00000050554

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	157,502,884 - 157,507,907 (-)	Ensembl
mRatBN7.2 Ensembl	4	155,830,909 - 155,835,937 (-)	Ensembl
Rnor_6.0 Ensembl	4	155,417,004 - 155,421,998 (-)	Ensembl

RefSeq Acc Id:

NM_001109671 ⟹ NP_001103141

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	157,503,547 - 157,507,923 (-)	NCBI
mRatBN7.2	4	155,831,572 - 155,835,953 (-)	NCBI
Rnor_6.0	4	155,417,667 - 155,422,014 (-)	NCBI
Rnor_5.0	4	222,441,866 - 222,445,551 (-)	NCBI
RGSC_v3.4	4	159,064,054 - 159,067,854 (-)	RGD
Celera	4	144,650,730 - 144,655,147 (-)	RGD

Sequence:

show sequence

TGAGGAGCTGGGAAGAGAGCAATTCACACTTGATTACCTCCCAGGCTCCTGAATTGAGCAGTGA
AGGCTAGACCGCTGAGCTCCCCAGAGGCTGCACTCTCTCGCTCGGTCGACCATGCAACCTTCCC
AAAGGCTTCTGACTCTCGGCTTCCTTCTGTTAACCCTGGCCCGGGGCCAGACATCCGAGTTTCA
AGACTATGACTTTTTGCAATTTCTGGGCTTAAAGAAAGCGCCTTCACCCCACAGGTTCCAACCT
GTGCCTCGCATCTTAAGGAAAATCATACGGGCTCGAGAAACCGCTGCAGCCAGCGGGGCCTCGC
AGGACTTATGCTACGTGAAGGAGCTGGGCGTCCGTGGGAACCTGCTTCGGCTTCTCCCAGACCA
GGGTTTTTTCCTTAACACACAGAAACCTTCCCAAGATGGCTCCTGTCTACAGAAGGTCCTCTCT
TTTAACTTGTCTGCCGTCAAAGAAAAGGGAAAGTTGACCATGGCCCAGCTGATTCTACACTTGG
GGCCCAGGTCCTACCATTACCTGCAGCTGGAGCTGGTGGTGGCTGTATCTGTGGTTCAGGATCG
TGGTGTGTGGGGGCGATCCCACCCTAAGCTGGGCAGGTTGCTCGTTCAGAAGTCTGTCCTGGGA
CCTCAAGGTTCTCTTCAGTTCAACCTGCAGGGTGTGGTTAAGGATTGGAACCGCCACCAACTGA
AGAATTTGGACTTATACTTAGAGATTCTGGTCAAAGAGGACAGATACTCCAGGGTAAATGCCCA
GCTTGATAACCCCTGTAACCAGCTGATGCACTCTCTTCATGCCTCCCTGCTGGTGGTGACCCTC
AACCTTAAACACTGTCACCCTTCTTCCAGAAAGAAGAGGGCAGCCATCCCTATTCCCAAGGGTC
TTTGTAGGAACCTCTGCCATCGTCACCAACTGTTCGTCAACTTCCAGGACCTGGGTTGGCACAA
GTGGGTCATTGCCCCTAAGGGTTTCATGGCAAACTACTGTCATGGAGATTGCCCCTTCACAATG
ACCACGTATTTGAATAGCTCCAATTATGCCTTCATGCAGGCTCTGATGCATATGGCTGACCCCA
GGGTCCCCAAGGCTGTCTGTATCCCCACCAAGCTGTCTCCAATCTCCATGCTCTATCAAGATAA
CGAGAAGAACGTCATTCTCCGACATTATGAAGACATGGTAGTGGATGAGTGTGGGTGTGGGTAG
AGTGTCAGGAATAGGATAGGAGTGTTCTTAGGGTAAATCCTTCAATAAAACCAC

hide sequence

Protein Sequences


Protein RefSeqs	NP_001103141	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	ABD17388	(Get FASTA)	NCBI Sequence Viewer
	EDM01985	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000050554
	ENSRNOP00000050554.3

RefSeq Acc Id:	NP_001103141 ⟸ NM_001109671
- Peptide Label:	precursor
- UniProtKB:	A2SY89 (UniProtKB/TrEMBL), F7ET17 (UniProtKB/TrEMBL)
- Sequence:	show sequence MQPSQRLLTLGFLLLTLARGQTSEFQDYDFLQFLGLKKAPSPHRFQPVPRILRKIIRARETAAA SGASQDLCYVKELGVRGNLLRLLPDQGFFLNTQKPSQDGSCLQKVLSFNLSAVKEKGKLTMAQL ILHLGPRSYHYLQLELVVAVSVVQDRGVWGRSHPKLGRLLVQKSVLGPQGSLQFNLQGVVKDWN RHQLKNLDLYLEILVKEDRYSRVNAQLDNPCNQLMHSLHASLLVVTLNLKHCHPSSRKKRAAIP IPKGLCRNLCHRHQLFVNFQDLGWHKWVIAPKGFMANYCHGDCPFTMTTYLNSSNYAFMQALMH MADPRVPKAVCIPTKLSPISMLYQDNEKNVILRHYEDMVVDECGCG hide sequence

Ensembl Acc Id:

ENSRNOP00000050554 ⟸ ENSRNOT00000041552

Protein Domains

TGF-beta family profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A2SY89-F1-model_v2	AlphaFold	A2SY89	1-366	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1564178	AgrOrtholog
BioCyc Gene	G2FUF-43149	BioCyc
Ensembl Genes	ENSRNOG00000015331	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000041552	ENTREZGENE
	ENSRNOT00000041552.5	UniProtKB/TrEMBL
Gene3D-CATH	2.10.90.10	UniProtKB/TrEMBL
	2.60.120.970	UniProtKB/TrEMBL
InterPro	Cystine-knot_cytokine	UniProtKB/TrEMBL
	TGF-b_propeptide	UniProtKB/TrEMBL
	TGFb	UniProtKB/TrEMBL
	TGFb_CS	UniProtKB/TrEMBL
	TGFbeta	UniProtKB/TrEMBL
KEGG Report	rno:500311	UniProtKB/TrEMBL
NCBI Gene	500311	ENTREZGENE
PANTHER	GROWTH/DIFFERENTIATION FACTOR 3	UniProtKB/TrEMBL
	TGFbeta	UniProtKB/TrEMBL
Pfam	TGF_beta	UniProtKB/TrEMBL
	TGFb_propeptide	UniProtKB/TrEMBL
PhenoGen	Gdf3	PhenoGen
PRINTS	INHIBINA	UniProtKB/TrEMBL
PROSITE	TGF_BETA_1	UniProtKB/TrEMBL
	TGF_BETA_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000015331	RatGTEx
SMART	TGFB	UniProtKB/TrEMBL
Superfamily-SCOP	SSF57501	UniProtKB/TrEMBL
UniProt	A2SY89	ENTREZGENE, UniProtKB/TrEMBL
	F7ET17	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-07	Gdf3	growth differentiation factor 3	RGD1564178_predicted	similar to growth/differentiation factor GDF-3 precursor - mouse (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-07	RGD1564178_predicted	similar to growth/differentiation factor GDF-3 precursor - mouse (predicted)	LOC500311	similar to growth/differentiation factor GDF-3 precursor - mouse	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC500311	similar to growth/differentiation factor GDF-3 precursor - mouse			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM