Advanced Search (OLGA)

Gene: Hhip (Hedgehog-interacting protein) Rattus norvegicus

Analyze

Symbol:

Hhip

Name:

Hedgehog-interacting protein

RGD ID:

1564108

Description:

Predicted to enable hedgehog family protein binding activity and zinc ion binding activity. Involved in negative regulation of apoptotic process. Predicted to be located in cell surface and plasma membrane. Biomarker of diabetic neuropathy and primary biliary cholangitis. Human ortholog(s) of this gene implicated in chronic obstructive pulmonary disease. Orthologous to human HHIP (hedgehog interacting protein); PARTICIPATES IN Hedgehog signaling pathway; basal cell carcinoma pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3,4-methylenedioxymethamphetamine; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Hedgehog-interacting protein-like; LOC291936; RGD1564108; similar to hedgehog-interacting protein

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	HHIP (hedgehog interacting protein)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Hhip (Hedgehog-interacting protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Hhip (hedgehog interacting protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	HHIP (hedgehog interacting protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	HHIP (hedgehog interacting protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Hhip (hedgehog interacting protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	HHIP (hedgehog interacting protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	HHIP (hedgehog interacting protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Hhip (hedgehog interacting protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Hhip (hedgehog interacting protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	HHIP (hedgehog interacting protein)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Hhip (Hedgehog-interacting protein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	hhip (hedgehog interacting protein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	hhip	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	44,768,038 - 44,856,878 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	19	44,767,536 - 44,862,795 (+)	Ensembl				GRCr8
mRatBN7.2	19	27,863,684 - 27,952,528 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	27,863,213 - 27,952,528 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	19	34,712,650 - 34,808,109 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	35,366,712 - 35,462,195 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	37,595,871 - 37,684,377 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	31,525,134 - 31,614,487 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	31,524,671 - 31,614,246 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	19	42,430,120 - 42,518,700 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	19	29,752,595 - 29,840,439 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	19	27,371,896 - 27,460,078 (+)	NCBI		Celera
Cytogenetic Map	19	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

basal cell carcinoma (ISO)

chronic obstructive pulmonary disease (ISO)

Colorectal Neoplasms (ISO)

diabetic neuropathy (IEP)

gastrointestinal stromal tumor (ISO)

hepatocellular carcinoma (ISO)

hypospadias (ISO)

liver cirrhosis (ISO)

Peripheral Nerve Injuries (IEP)

primary biliary cholangitis (IEP)

pulmonary emphysema (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dichloroethane (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-palmitoylglycerol (ISO)

3,4-methylenedioxymethamphetamine (EXP,ISO)

3-methylcholanthrene (ISO)

4,4'-sulfonyldiphenol (ISO)

5-aza-2'-deoxycytidine (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

aflatoxin B1 (EXP,ISO)

Aflatoxin B2 alpha (ISO)

all-trans-retinoic acid (ISO)

antirheumatic drug (ISO)

aristolochic acid A (EXP)

arsane (ISO)

arsenic atom (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (EXP)

bromobenzene (EXP)

cadmium dichloride (EXP,ISO)

calciol (ISO)

calcitriol (ISO)

carbamazepine (ISO)

carbon nanotube (ISO)

chloroprene (EXP)

chlorpyrifos (ISO)

choline (ISO)

chromium atom (ISO)

chromium(6+) (ISO)

cobalt dichloride (ISO)

cocaine (EXP)

crocidolite asbestos (ISO)

Cuprizon (EXP)

deguelin (ISO)

dibenz[a,h]anthracene (ISO)

dibutyl phthalate (EXP,ISO)

dimethylarsinic acid (EXP)

dioxygen (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

elemental selenium (ISO)

epoxiconazole (ISO)

ethanol (EXP)

folic acid (ISO)

fonofos (ISO)

genistein (ISO)

hydrogen peroxide (EXP)

indole-3-methanol (EXP)

L-methionine (ISO)

lipopolysaccharide (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

methylisothiazolinone (ISO)

mono(2-ethylhexyl) phthalate (ISO)

N-acetyl-L-cysteine (EXP)

N-nitrosodiethylamine (EXP)

panobinostat (ISO)

paraquat (EXP)

parathion (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenylmercury acetate (ISO)

phorbol 13-acetate 12-myristate (ISO)

pioglitazone (ISO)

potassium chromate (ISO)

potassium dichromate (ISO)

resveratrol (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

selenium atom (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sulforaphane (ISO)

terbufos (ISO)

tetrachloromethane (ISO)

thifluzamide (ISO)

titanium dioxide (ISO)

trichostatin A (ISO)

valproic acid (ISO)

vismodegib (ISO)

vorinostat (ISO)

XL147 (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

animal organ morphogenesis (ISO)

dorsal/ventral pattern formation (ISO)

epithelial tube branching involved in lung morphogenesis (ISO)

negative regulation of apoptotic process (IMP)

negative regulation of signal transduction (ISO)

negative regulation of smoothened signaling pathway (ISO)

neuroblast proliferation (ISO)

regulation of fibroblast growth factor receptor signaling pathway (ISO)

signal transduction (ISO)

skeletal system morphogenesis (ISO)

Cellular Component

cell surface (ISO)

extracellular region (IEA)

plasma membrane (IEA,ISO)

Molecular Function

hedgehog family protein binding (ISO)

metal ion binding (IEA)

protein binding (ISO)

zinc ion binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

basal cell carcinoma pathway (IEA)

Hedgehog signaling pathway (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	The role of hedgehog-interacting protein in maintaining cavernous nerve integrity and adult penile morphology.	Angeloni NL, etal., J Sex Med. 2009 Sep;6(9):2480-93. doi: 10.1111/j.1743-6109.2009.01349.x. Epub 2009 Jun 9.
2.	Interactions between Hedgehog proteins and their binding partners come into view.	Beachy PA, etal., Genes Dev. 2010 Sep 15;24(18):2001-12.
3.	Hedgehog pathway activation and epithelial-to-mesenchymal transitions during myofibroblastic transformation of rat hepatic cells in culture and cirrhosis.	Choi SS, etal., Am J Physiol Gastrointest Liver Physiol. 2009 Dec;297(6):G1093-106. doi: 10.1152/ajpgi.00292.2009. Epub 2009 Oct 8.
4.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.	Haploinsufficiency of Hedgehog interacting protein causes increased emphysema induced by cigarette smoke through network rewiring.	Lao T, etal., Genome Med. 2015 Feb 14;7(1):12. doi: 10.1186/s13073-015-0137-3. eCollection 2015.
6.	The hedgehog pathway regulates remodelling responses to biliary obstruction in rats.	Omenetti A, etal., Gut. 2008 Sep;57(9):1275-82. doi: 10.1136/gut.2008.148619. Epub 2008 Mar 28.
7.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
8.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
9.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
11.	Comprehensive gene review and curation	RGD comprehensive gene curation
12.	Hedgehog-interacting protein is a COPD susceptibility gene: the Rotterdam Study.	Van Durme YM, etal., Eur Respir J. 2010 Jul;36(1):89-95. doi: 10.1183/09031936.00129509. Epub 2009 Dec 8.
13.	Immunoprevention of basal cell carcinomas with recombinant hedgehog-interacting protein.	Vogt A, etal., J Exp Med. 2004 Mar 15;199(6):753-61.
14.	Gene susceptibility identification in a longitudinal study confirms new loci in the development of chronic obstructive pulmonary disease and influences lung function decline.	Xie J, etal., Respir Res. 2015 Apr 18;16:49. doi: 10.1186/s12931-015-0209-3.

Additional References at PubMed

PMID:10050855	PMID:12569124	PMID:12917290	PMID:15294024	PMID:15576403	PMID:19561609	PMID:19561611

Genomics

Comparative Map Data

Hhip
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	44,768,038 - 44,856,878 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	19	44,767,536 - 44,862,795 (+)	Ensembl				GRCr8
mRatBN7.2	19	27,863,684 - 27,952,528 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	27,863,213 - 27,952,528 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	19	34,712,650 - 34,808,109 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	35,366,712 - 35,462,195 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	37,595,871 - 37,684,377 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	31,525,134 - 31,614,487 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	31,524,671 - 31,614,246 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	19	42,430,120 - 42,518,700 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	19	29,752,595 - 29,840,439 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	19	27,371,896 - 27,460,078 (+)	NCBI		Celera
Cytogenetic Map	19	q11	NCBI

HHIP
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	144,646,156 - 144,745,271 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	144,646,156 - 144,745,271 (+)	Ensembl			hg38	GRCh38
GRCh37	4	145,567,308 - 145,666,423 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	145,786,623 - 145,879,331 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	4	145,924,777 - 146,017,486	NCBI
Celera	4	142,895,050 - 142,987,336 (+)	NCBI		Celera
Cytogenetic Map	4	q31.21	NCBI
HuRef	4	141,298,063 - 141,390,789 (+)	NCBI		HuRef
CHM1_1	4	145,543,638 - 145,636,362 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	4	147,963,548 - 148,062,608 (+)	NCBI		T2T-CHM13v2.0

Hhip
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	80,692,480 - 80,784,637 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	80,692,480 - 80,784,635 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	8	79,965,850 - 80,058,060 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	79,965,851 - 80,058,006 (-)	Ensembl			mm10	GRCm38
MGSCv37	8	82,489,750 - 82,581,907 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	8	82,867,946 - 82,954,065 (-)	NCBI		MGSCv36	mm8
Celera	8	84,241,203 - 84,333,109 (-)	NCBI		Celera
Cytogenetic Map	8	C2	NCBI
cM Map	8	37.95	NCBI

Hhip
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955428	657,900 - 745,250 (+)	Ensembl
ChiLan1.0	NW_004955428	657,918 - 745,255 (+)	NCBI	ChiLan1.0	ChiLan1.0

HHIP
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	3	142,524,310 - 142,620,159 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	4	142,887,844 - 142,985,062 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	4	136,989,818 - 137,085,407 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	4	148,651,597 - 148,743,933 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	4	148,651,597 - 148,744,619 (+)	Ensembl			panPan2	panpan1.1

HHIP
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	15	43,432,464 - 43,525,973 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	15	43,431,650 - 43,520,861 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	15	43,824,285 - 43,917,965 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	15	44,093,271 - 44,162,284 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	15	44,093,295 - 44,162,122 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	15	43,369,053 - 43,460,672 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	15	43,453,081 - 43,546,222 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	15	43,725,148 - 43,818,741 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Hhip
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405301	46,766,102 - 46,868,595 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936535	4,210,305 - 4,305,930 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936535	4,210,305 - 4,305,930 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

HHIP
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	8	83,583,739 - 83,679,136 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	8	83,583,735 - 83,678,368 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	8	88,870,182 - 88,941,146 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

HHIP
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	7	91,216,874 - 91,311,392 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	7	91,216,955 - 91,310,387 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666037	70,844,677 - 70,944,651 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Hhip
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624853	3,649,967 - 3,735,834 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624853	3,649,974 - 3,739,344 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Hhip
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	17	20,062,152 - 20,151,695 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Hhip
906 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	183
Count of miRNA genes:	141
Interacting mature miRNAs:	158
Transcripts:	ENSRNOT00000024616
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61447	Tcas1	Tongue tumor susceptibility QTL 1	6.08		tongue integrity trait (VT:0010553)	squamous cell carcinoma of the tongue maximum tumor diameter (CMO:0001875)	19	19220689	64220689	Rat
9590298	Uminl5	Urine mineral level QTL 5	3.59	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	19	7997750	52997750	Rat
1331737	Uae29	Urinary albumin excretion QTL 29	5.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	36289	74246245	Rat
61328	Eae8	Experimental allergic encephalomyelitis QTL 8	4		nervous system integrity trait (VT:0010566)	percentage of study population developing experimental autoimmune encephalomyelitis during a period of time (CMO:0001047)	19	41720609	49971820	Rat
2313395	Anxrr26	Anxiety related response QTL 26			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	19	44385134	74246245	Rat
1578764	Stresp19	Stress response QTL 19	3.6	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	19	32539615	74246245	Rat
1558656	Prcs1	Prostate cancer susceptibility QTL 1	5		prostate integrity trait (VT:0010571)	percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943)	19	31287532	51431640	Rat
9590090	Insglur8	Insulin/glucose ratio QTL 8	10.81	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	19	7997750	52997750	Rat
1331788	Rf45	Renal function QTL 45	2.818		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	19	31777888	74246245	Rat
1554318	Bmd5	Bone mineral density QTL 5	12.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	19	23188586	68188586	Rat
1549835	Tcas7	Tongue tumor susceptibility QTL 7		0.001	tongue integrity trait (VT:0010553)	squamous cell carcinoma of the head and neck tumor number (CMO:0001876)	19	41722546	74246245	Rat
724566	Uae12	Urinary albumin excretion QTL 12	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	2194317	74246245	Rat
1354633	Bw28	Body weight QTL 28	6.04		body mass (VT:0001259)	body weight (CMO:0000012)	19	40727092	54856850	Rat
61407	Scl12	Serum cholesterol level QTL 12		0.001	blood HDL cholesterol amount (VT:0000184)	serum high density lipoprotein cholesterol level (CMO:0000361)	19	30099383	47207961	Rat
8552935	Pigfal10	Plasma insulin-like growth factor 1 level QTL 10	5.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	19	7997750	52997750	Rat
631840	Niddm38	Non-insulin dependent diabetes mellitus QTL 38	3.86		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	19	10329076	74246245	Rat
1358200	Insglur2	Insulin/glucose ratio QTL 2	4.1		blood glucose amount (VT:0000188)	serum glucose level (CMO:0000543)	19	5748064	50748064	Rat
7411549	Bw130	Body weight QTL 130	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	32365311	74246245	Rat
724518	Uae19	Urinary albumin excretion QTL 19	5.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	24093973	69093973	Rat
61423	Cia14	Collagen induced arthritis QTL 14	3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	19	10833618	74246245	Rat
2303628	Vencon9	Ventilatory control QTL 9		0.005	respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	19	23188586	68188586	Rat
9590250	Scort11	Serum corticosterone level QTL 11	23.45	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	19	7997750	52997750	Rat
2317848	Alcrsp21	Alcohol response QTL 21	1.899999976158142	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	19	20109306	65109306	Rat
1354607	Gmadr1	Adrenal mass QTL 1	5.83		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	19	40727092	54856850	Rat
7247442	Uae39	Urinary albumin excretion QTL 39			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	2194317	74246245	Rat
1354600	Salc2	Saline consumption QTL 2	9.91	0.001	drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	19	40727092	54856850	Rat

Markers in Region

BI302228

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	27,900,260 - 27,900,416 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	31,561,847 - 31,562,002	NCBI	Rnor6.0
Rnor_5.0	19	42,466,947 - 42,467,102	UniSTS	Rnor5.0
RGSC_v3.4	19	29,790,390 - 29,790,545	UniSTS	RGSC3.4
Celera	19	27,408,446 - 27,408,601	UniSTS
RH 3.4 Map	19	249.19	UniSTS
Cytogenetic Map	19	q11	UniSTS

RH142844

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	27,952,353 - 27,952,497 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	31,614,313 - 31,614,456	NCBI	Rnor6.0
Rnor_5.0	19	42,518,526 - 42,518,669	UniSTS	Rnor5.0
RGSC_v3.4	19	29,840,265 - 29,840,408	UniSTS	RGSC3.4
Celera	19	27,459,904 - 27,460,047	UniSTS
Cytogenetic Map	19	q11	UniSTS

RH138698

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	27,952,351 - 27,952,496 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	31,614,311 - 31,614,455	NCBI	Rnor6.0
Rnor_5.0	19	42,518,524 - 42,518,668	UniSTS	Rnor5.0
RGSC_v3.4	19	29,840,263 - 29,840,407	UniSTS	RGSC3.4
Celera	19	27,459,902 - 27,460,046	UniSTS
Cytogenetic Map	19	q11	UniSTS

RH141770

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	27,890,373 - 27,890,558 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	31,551,948 - 31,552,132	NCBI	Rnor6.0
Rnor_5.0	19	42,457,354 - 42,457,538	UniSTS	Rnor5.0
RGSC_v3.4	19	29,779,393 - 29,779,577	UniSTS	RGSC3.4
Celera	19	27,398,583 - 27,398,767	UniSTS
Cytogenetic Map	19	q11	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
14	10	42	145	91	90	59	27	59	6	242	99	8	120	62	69	31	8	8

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001191817	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473972	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000019	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000024616 ⟹ ENSRNOP00000024616

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	19	44,767,536 - 44,857,213 (+)	Ensembl
mRatBN7.2 Ensembl	19	27,863,213 - 27,952,528 (+)	Ensembl
Rnor_6.0 Ensembl	19	31,524,671 - 31,614,246 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000123732 ⟹ ENSRNOP00000100240

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	19	44,767,536 - 44,862,795 (+)	Ensembl

RefSeq Acc Id:

NM_001191817 ⟹ NP_001178746

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	44,768,038 - 44,856,878 (+)	NCBI
mRatBN7.2	19	27,863,684 - 27,952,528 (+)	NCBI
Rnor_6.0	19	31,525,134 - 31,614,487 (+)	NCBI
Rnor_5.0	19	42,430,120 - 42,518,700 (+)	NCBI
Celera	19	27,371,896 - 27,460,078 (+)	NCBI

Sequence:

show sequence

ATGCTGAAGATGCTCTCGTTTAAGCTGCTACTGCTGGCCGTGGCTCTGGGCTTCTTTGAAGGAG
ATGCCAAGTTTGGGGAAAGGAGCGAAGGGAGCGGAGCGAGGAGGAGAAGGTGCCTGAATGGGAG
CCCCCCAAAGCGCCTGAAAAGAAGGGACAGGAGGATGATGTCCCAGCTGGAGCTGCTGAGTGGA
GGAGAGATTCTGTGTGGTGGCTTCTACCCAAGAGTATCCTGCTGCCTGCAGAGTGACAGCCCTG
GATTGGGGCGTCTGGAGAACAAGATCTTTTCTGCCACCAACAACACAGAATGTGGGAGGCTCCT
GGAGGAGATCAAATGTGCTCCTTGCTCTCCCCACTCCCAGAGCCTGTTCTTCTCACCTGAAAGA
GATGTCCTGGATGGAGACCTTGCACTTCCACTCCTCTGCAAGGACTACTGCAAAGAATTCTTTT
ACACTTGTCGGGGCCATATTCCAGGTCTTCTTCAAACAACTGCTGATGAATTTTGCTTTTACTA
TGCAAGAAAAGATGCTGGGTTATGCTTTCCAGACTTCCCGAGAAAGCAAGTCAGAGGACCAGCA
TCTAACTATTTGGACCAGATGGAAGACTATGAGAAAGTCGAAGAGATCAGCAGAAAGCACAAAC
ACAACTGCTTCTGTGTCCAGGAGGTCATGAGTGGGCTGCGGCAGCCTGTGGGTGCTGTGCACAG
TGGGGATGGCTCCCTTCGACTCTTCATCCTAGAGAAGGAAGGCTACGTGAAGATTCTAACCCCA
GAAGGAGAAATGCTCAAGGAGCCTTACTTGGACATTCACAAACTTGTTCAGAGTGGAATAAAGG
GAGGAGACGAGAGGGGCCTGCTAAGCCTGGCATTCCACCCCAATTACAAGAAAAACGGGAAGCT
CTACGTGTCTTACACCACCAACCAGGAACGGTGGGCTATTGGGCCTCACGACCACATCCTTAGG
GTTGTGGAATACACAGTATCCAGGAAAAATCCCCATCAAGTTGATGTAAGAACAGCCAGGGTGT
TTCTGGAAGTTGCAGAGCTCCACCGGAAGCATCTTGGGGGACAGCTGCTCTTTGGTCCTGATGG
CTTTTTGTACATCATCCTCGGGGATGGGATGATCACACTGGATGACATGGAGGAGATGGATGGG
TTAAGTGATTTCACAGGCTCTGTGCTGAGGCTGGATGCGGACACCGACATGTGCAATGTGCCTT
ACTCCATTCCTCGGAGTAACCCCCACTTCAACAGCACCAACCAGCCTCCAGAAGTATTTGCCCA
TGGCCTCCATGATCCAGGCAGATGTGCCGTGGATCGACATCCCACTGATATAAACATCAATTTA
ACAATACTTTGCTCAGATTCCAATGGGAAGAACAGATCGTCGGCCAGAATTCTACAGATAATAA
AAGGAAGAGATTACGAAAGCGAGCAATCTCTTCTAGAATTCAAGCCATTCAGTAACGGCCCTTT
GGTTGGTGGATTCGTTTACAGAGGCTGCCAGTCTGAAAGATTGTACGGAAGCTACGTGTTCGGA
GATCGCAATGGGAATTTCTTAACCCTCCAGCAAAGCCCAGTGACTAAGCAATGGCAAGAAAAGC
CACTCTGTCTGGGTGCCAGCGGCTCCTGTCAAGGCTACTTTTCGGGTCACATCTTGGGATTTGG
AGAAGATGAATTAGGAGAGGTTTACATTCTATCAAGCAGTAAGAGTATGACCCAGACTCACAAT
GGAAAACTCTACAAGATCATAGACCCAAAAAGACCTTTGATGCCTGAGGAATGCAGAGTCACAG
TTCAACCTGCCCAGACACTGACCTCAGATATTTCCCGGCTCTGTCGGAACGGCTACTACACCCC
CACGGGCAAGTGCTGCTGCAGTCCTGGCTGGGAGGGAGACTTCTGCAGAATTGCCAAATGTGAG
CCACCTTGTCGTCACGGAGGTGTCTGTGTCAGACCAAACAAGTGCCTCTGTAAAAAGGGCTATC
TCGGCCCTCAGTGTGAACGAGCGGACAGGAGCATGCGCAGAGTGACCAGGGCAGGTATTCTTGA
CCAGATCATTGACGTGACGTCTTACTTGCTGGATCTCACAAGTTACATCGTATAGTTTCTGGGA
CGGTTTGAGTCTATCTTTCCGGTGGGCATTCCGATCTTGTCATGAAAAAAGAGAGACTGTCCTT
CCGCTACACACTCCTGCGACTTCATTTCCTTTCGGTAATTTAAAAGCAATCTCCAGAAATGTAC
AGGTCTCAGCATGTATGTTGGAACGTTTTTTTCACATCTGCACATGCACTCACAGCCCCAGACT
CAAGGTTGTATAACAGAAGGGTGTTTTGTTTTGTTTTTAATATCTACTCTCTTGGCGTGTACTT
TGCACAGAAGTTCCACTGCAAATTGATCACAGAGTTTCTTATGGCATCAGAAGATATTCTTTTA
CGTTTCGGGAAATTTCTGTCTGTGATTACTAAAGTCAACCTTCCTAGGGTTTTAAAATGTTATT
GTGCAATGTGGTGGGGGTATTTTTATATTAAAGGTCTATAATGAGA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001178746	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL92304	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000024616.6
	ENSRNOP00000100240
	ENSRNOP00000100240.1

RefSeq Acc Id:	NP_001178746 ⟸ NM_001191817
- Peptide Label:	precursor
- UniProtKB:	D3ZGL3 (UniProtKB/TrEMBL)
- Sequence:	show sequence MLKMLSFKLLLLAVALGFFEGDAKFGERSEGSGARRRRCLNGSPPKRLKRRDRRMMSQLELLSG GEILCGGFYPRVSCCLQSDSPGLGRLENKIFSATNNTECGRLLEEIKCAPCSPHSQSLFFSPER DVLDGDLALPLLCKDYCKEFFYTCRGHIPGLLQTTADEFCFYYARKDAGLCFPDFPRKQVRGPA SNYLDQMEDYEKVEEISRKHKHNCFCVQEVMSGLRQPVGAVHSGDGSLRLFILEKEGYVKILTP EGEMLKEPYLDIHKLVQSGIKGGDERGLLSLAFHPNYKKNGKLYVSYTTNQERWAIGPHDHILR VVEYTVSRKNPHQVDVRTARVFLEVAELHRKHLGGQLLFGPDGFLYIILGDGMITLDDMEEMDG LSDFTGSVLRLDADTDMCNVPYSIPRSNPHFNSTNQPPEVFAHGLHDPGRCAVDRHPTDININL TILCSDSNGKNRSSARILQIIKGRDYESEQSLLEFKPFSNGPLVGGFVYRGCQSERLYGSYVFG DRNGNFLTLQQSPVTKQWQEKPLCLGASGSCQGYFSGHILGFGEDELGEVYILSSSKSMTQTHN GKLYKIIDPKRPLMPEECRVTVQPAQTLTSDISRLCRNGYYTPTGKCCCSPGWEGDFCRIAKCE PPCRHGGVCVRPNKCLCKKGYLGPQCERADRSMRRVTRAGILDQIIDVTSYLLDLTSYIV hide sequence

Ensembl Acc Id:

ENSRNOP00000024616 ⟸ ENSRNOT00000024616

Ensembl Acc Id:

ENSRNOP00000100240 ⟸ ENSRNOT00000123732

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZGL3-F1-model_v2	AlphaFold	D3ZGL3	1-700	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13701048

Promoter ID:

EPDNEW_R11571

Type:

multiple initiation site

Name:

Hhip_1

Description:

Hedgehog-interacting protein

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	19	31,524,637 - 31,524,697	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1564108	AgrOrtholog
BioCyc Gene	G2FUF-5967	BioCyc
Ensembl Genes	ENSRNOG00000018268	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000024616.9	UniProtKB/TrEMBL
	ENSRNOT00000123732	ENTREZGENE
	ENSRNOT00000123732.1	UniProtKB/TrEMBL
Gene3D-CATH	2.120.10.30	UniProtKB/TrEMBL
	Laminin	UniProtKB/TrEMBL
InterPro	6-blade_b-propeller_TolB-like	UniProtKB/TrEMBL
	EGF_3	UniProtKB/TrEMBL
	EGF_extracell	UniProtKB/TrEMBL
	Folate_rcpt_cons-reg	UniProtKB/TrEMBL
	Glc/Sorbosone_DH	UniProtKB/TrEMBL
	Quinoprot_gluc/sorb_DH	UniProtKB/TrEMBL
KEGG Report	rno:291936	UniProtKB/TrEMBL
NCBI Gene	291936	ENTREZGENE
PANTHER	HEDGEHOG-INTERACTING PROTEIN	UniProtKB/TrEMBL
	HEDGEHOG-INTERACTING PROTEIN	UniProtKB/TrEMBL
Pfam	EGF_2	UniProtKB/TrEMBL
	Folate_rec	UniProtKB/TrEMBL
	GSDH	UniProtKB/TrEMBL
PhenoGen	Hhip	PhenoGen
PROSITE	EGF_1	UniProtKB/TrEMBL
	EGF_2	UniProtKB/TrEMBL
	EGF_3	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000018268	RatGTEx
SMART	EGF	UniProtKB/TrEMBL
Superfamily-SCOP	EGF/Laminin	UniProtKB/TrEMBL
	Quino_gluc_DH	UniProtKB/TrEMBL
UniProt	A0ABK0LBT8_RAT	UniProtKB/TrEMBL
	D3ZGL3	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-05-24	Hhip	Hedgehog-interacting protein	LOC100366089	Hedgehog-interacting protein-like	Data merged from RGD:2324369	1643240	APPROVED
2010-05-06	LOC100366089	Hedgehog-interacting protein-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2008-03-06	Hhip	Hedgehog-interacting protein	RGD1564108_predicted	similar to hedgehog-interacting protein (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-07	RGD1564108_predicted	similar to hedgehog-interacting protein (predicted)	LOC291936	similar to hedgehog-interacting protein	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC291936	similar to hedgehog-interacting protein			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)