Symbol:
Iqgap1
Name:
IQ motif containing GTPase activating protein 1
RGD ID:
1311884
Description:
Enables mitogen-activated protein kinase binding activity. Involved in several processes, including positive regulation of dendrite development; positive regulation of protein phosphorylation; and regulation of cell junction assembly. Located in cytoskeleton; focal adhesion; and growth cone. Part of protein-containing complex. Is active in postsynapse. Orthologous to human IQGAP1 (IQ motif containing GTPase activating protein 1); PARTICIPATES IN E-cadherin signaling pathway; insulin responsive facilitative sugar transporter mediated glucose transport pathway; platelet-derived growth factor signaling pathway; INTERACTS WITH 1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane; 1-naphthyl isothiocyanate; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC361598; ras GTPase-activating-like protein IQGAP1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 144,088,788 - 144,178,989 (-) NCBI GRCr8 mRatBN7.2 1 134,679,581 - 134,769,776 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 134,679,586 - 134,769,755 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 142,588,968 - 142,679,115 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 149,758,382 - 149,848,532 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 142,676,568 - 142,767,383 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 142,525,041 - 142,615,673 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 142,525,046 - 142,615,673 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 143,476,882 - 143,567,395 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 136,552,358 - 136,642,545 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 136,631,848 - 136,722,691 (-) NCBI Celera 1 126,734,261 - 126,824,269 (-) NCBI Celera Cytogenetic Map 1 q31 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Iqgap1 Rat (1->4)-beta-D-glucan multiple interactions ISO Iqgap1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of IQGAP1 mRNA CTD PMID:36331819 Iqgap1 Rat 1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane multiple interactions EXP 6480464 2 more ... CTD PMID:19414516 Iqgap1 Rat 1,2-dimethylhydrazine multiple interactions ISO Iqgap1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of IQGAP1 mRNA CTD PMID:22206623 Iqgap1 Rat 1-chloro-2,4-dinitrobenzene affects binding ISO IQGAP1 (Homo sapiens) 6480464 Dinitrochlorobenzene binds to IQGAP1 protein CTD PMID:32991956 Iqgap1 Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of IQGAP1 mRNA CTD PMID:25380136 Iqgap1 Rat 17beta-estradiol increases expression ISO IQGAP1 (Homo sapiens) 6480464 Estradiol results in increased expression of IQGAP1 mRNA CTD PMID:16514628 Iqgap1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO IQGAP1 (Homo sapiens) 6480464 Cycloheximide inhibits the reaction [Tetrachlorodibenzodioxin results in increased expression of IQGAP1 mRNA] CTD PMID:11007951 Iqgap1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of IQGAP1 mRNA CTD PMID:33387578 and PMID:34747641 Iqgap1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of IQGAP1 mRNA CTD PMID:32109520 Iqgap1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Iqgap1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of IQGAP1 mRNA CTD PMID:21570461 Iqgap1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Iqgap1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of IQGAP1 mRNA CTD PMID:19770486 Iqgap1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO IQGAP1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of IQGAP1 mRNA CTD PMID:11007951 and PMID:12377990 Iqgap1 Rat 2,6-dimethoxyphenol multiple interactions ISO IQGAP1 (Homo sapiens) 6480464 [Furaldehyde co-treated with pyrogallol 1 more ... CTD PMID:38598786 Iqgap1 Rat 2-amino-14,16-dimethyloctadecan-3-ol decreases expression ISO IQGAP1 (Homo sapiens) 6480464 2-amino-14 and 16-dimethyloctadecan-3-ol results in decreased expression of IQGAP1 protein CTD PMID:32044396 Iqgap1 Rat 3',5'-cyclic AMP multiple interactions EXP 6480464 2 more ... CTD PMID:19414516 Iqgap1 Rat 3-chloropropane-1,2-diol decreases expression EXP 6480464 alpha-Chlorohydrin results in decreased expression of IQGAP1 mRNA CTD PMID:28522335 Iqgap1 Rat 4,4'-diaminodiphenylmethane increases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of IQGAP1 mRNA CTD PMID:25380136 Iqgap1 Rat 4,4'-sulfonyldiphenol decreases expression ISO Iqgap1 (Mus musculus) 6480464 bisphenol S results in decreased expression of IQGAP1 mRNA CTD PMID:39298647 Iqgap1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of IQGAP1 mRNA CTD PMID:30047161 Iqgap1 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of IQGAP1 mRNA CTD PMID:31881176 Iqgap1 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of IQGAP1 mRNA CTD PMID:28959563 Iqgap1 Rat afatinib decreases phosphorylation ISO IQGAP1 (Homo sapiens) 6480464 Afatinib results in decreased phosphorylation of IQGAP1 protein CTD PMID:33087447 Iqgap1 Rat afimoxifene decreases expression ISO IQGAP1 (Homo sapiens) 6480464 afimoxifene results in decreased expression of IQGAP1 mRNA CTD PMID:16514628 Iqgap1 Rat aflatoxin B1 affects expression ISO IQGAP1 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of IQGAP1 protein CTD PMID:20106945 Iqgap1 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of IQGAP1 mRNA CTD PMID:30047161 Iqgap1 Rat aristolochic acid A decreases expression ISO IQGAP1 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of IQGAP1 mRNA CTD PMID:33212167 Iqgap1 Rat aristolochic acids increases expression EXP 6480464 Aristolochic Acids results in increased expression of IQGAP1 mRNA CTD PMID:19717638 Iqgap1 Rat arsane multiple interactions ISO IQGAP1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of IQGAP1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of IQGAP1 mRNA CTD PMID:39836092 Iqgap1 Rat arsenic atom multiple interactions ISO IQGAP1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of IQGAP1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of IQGAP1 mRNA CTD PMID:39836092 Iqgap1 Rat arsenite(3-) increases expression ISO Iqgap1 (Mus musculus) 6480464 arsenite results in increased expression of IQGAP1 protein CTD PMID:37955338 Iqgap1 Rat arsenite(3-) multiple interactions ISO IQGAP1 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to IQGAP1 mRNA] and arsenite promotes the reaction [G3BP1 protein binds to IQGAP1 protein] CTD PMID:32406909 Iqgap1 Rat benzo[a]pyrene decreases expression ISO Iqgap1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of IQGAP1 mRNA CTD PMID:19770486 Iqgap1 Rat benzo[a]pyrene decreases expression ISO IQGAP1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of IQGAP1 protein CTD PMID:33278487 Iqgap1 Rat benzo[a]pyrene increases expression ISO IQGAP1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of IQGAP1 mRNA CTD PMID:32234424 Iqgap1 Rat benzo[a]pyrene diol epoxide I decreases expression ISO IQGAP1 (Homo sapiens) 6480464 7 more ... CTD PMID:20018196 Iqgap1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of IQGAP1 mRNA CTD PMID:30816183 and PMID:34947998 Iqgap1 Rat bisphenol A increases expression ISO IQGAP1 (Homo sapiens) 6480464 bisphenol A results in increased expression of IQGAP1 protein CTD PMID:34186270 Iqgap1 Rat bisphenol AF increases expression ISO IQGAP1 (Homo sapiens) 6480464 bisphenol AF results in increased expression of IQGAP1 protein CTD PMID:34186270 Iqgap1 Rat Bisphenol B increases expression ISO IQGAP1 (Homo sapiens) 6480464 bisphenol B results in increased expression of IQGAP1 protein CTD PMID:34186270 Iqgap1 Rat bisphenol F increases expression ISO IQGAP1 (Homo sapiens) 6480464 bisphenol F results in increased expression of IQGAP1 protein CTD PMID:34186270 Iqgap1 Rat butanal decreases expression ISO IQGAP1 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of IQGAP1 mRNA CTD PMID:26079696 Iqgap1 Rat calcium atom multiple interactions ISO Iqgap1 (Mus musculus) 6480464 Calcium promotes the reaction [PAFAH1B1 protein binds to IQGAP1 protein binds to CDC42 protein] CTD PMID:16369480 Iqgap1 Rat calcium(0) multiple interactions ISO Iqgap1 (Mus musculus) 6480464 Calcium promotes the reaction [PAFAH1B1 protein binds to IQGAP1 protein binds to CDC42 protein] CTD PMID:16369480 Iqgap1 Rat captan increases expression ISO Iqgap1 (Mus musculus) 6480464 Captan results in increased expression of IQGAP1 mRNA CTD PMID:31558096 Iqgap1 Rat CGP 52608 multiple interactions ISO IQGAP1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to IQGAP1 gene] CTD PMID:28238834 Iqgap1 Rat choline multiple interactions ISO Iqgap1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of IQGAP1 mRNA CTD PMID:20938992 Iqgap1 Rat coumarin increases phosphorylation ISO IQGAP1 (Homo sapiens) 6480464 coumarin results in increased phosphorylation of IQGAP1 protein CTD PMID:35688186 Iqgap1 Rat crizotinib decreases phosphorylation ISO IQGAP1 (Homo sapiens) 6480464 Crizotinib results in decreased phosphorylation of IQGAP1 protein CTD PMID:33087447 Iqgap1 Rat crocidolite asbestos affects expression ISO IQGAP1 (Homo sapiens) 6480464 Asbestos and Crocidolite affects the expression of IQGAP1 mRNA CTD PMID:17331233 Iqgap1 Rat CU-O LINKAGE increases expression ISO IQGAP1 (Homo sapiens) 6480464 cupric oxide results in increased expression of IQGAP1 protein CTD PMID:25470785 Iqgap1 Rat cycloheximide multiple interactions ISO IQGAP1 (Homo sapiens) 6480464 Cycloheximide inhibits the reaction [Tetrachlorodibenzodioxin results in increased expression of IQGAP1 mRNA] CTD PMID:11007951 Iqgap1 Rat cyclosporin A increases expression ISO IQGAP1 (Homo sapiens) 6480464 Cyclosporine results in increased expression of IQGAP1 mRNA CTD PMID:20106945 and PMID:25562108 Iqgap1 Rat deguelin increases expression ISO IQGAP1 (Homo sapiens) 6480464 deguelin results in increased expression of IQGAP1 mRNA CTD PMID:33512557 Iqgap1 Rat dibenzo[a,l]pyrene increases expression ISO Iqgap1 (Mus musculus) 6480464 dibenzo(a and l)pyrene results in increased expression of IQGAP1 mRNA CTD PMID:25908611 Iqgap1 Rat Dibutyl phosphate affects expression ISO IQGAP1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of IQGAP1 mRNA CTD PMID:37042841 Iqgap1 Rat dihydroartemisinin affects binding ISO IQGAP1 (Homo sapiens) 6480464 artenimol analog binds to IQGAP1 protein modified form CTD PMID:26340163 Iqgap1 Rat dimethylarsinous acid decreases expression ISO IQGAP1 (Homo sapiens) 6480464 dimethylarsinous acid results in decreased expression of IQGAP1 mRNA CTD PMID:23487506 Iqgap1 Rat dorsomorphin multiple interactions ISO IQGAP1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Iqgap1 Rat doxorubicin decreases expression ISO IQGAP1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of IQGAP1 mRNA CTD PMID:29803840 Iqgap1 Rat entinostat multiple interactions ISO IQGAP1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of IQGAP1 mRNA CTD PMID:27188386 Iqgap1 Rat entinostat increases expression ISO IQGAP1 (Homo sapiens) 6480464 entinostat results in increased expression of IQGAP1 mRNA CTD PMID:26272509 Iqgap1 Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of IQGAP1 protein CTD PMID:20829428 Iqgap1 Rat folic acid multiple interactions ISO Iqgap1 (Mus musculus) 6480464 [1 more ... CTD PMID:20938992 and PMID:22206623 Iqgap1 Rat folic acid decreases expression ISO Iqgap1 (Mus musculus) 6480464 Folic Acid results in decreased expression of IQGAP1 mRNA CTD PMID:25629700 Iqgap1 Rat folic acid decreases expression ISO IQGAP1 (Homo sapiens) 6480464 Folic Acid results in decreased expression of IQGAP1 mRNA CTD PMID:21867686 Iqgap1 Rat folpet increases expression ISO Iqgap1 (Mus musculus) 6480464 folpet results in increased expression of IQGAP1 mRNA CTD PMID:31558096 Iqgap1 Rat FR900359 decreases phosphorylation ISO IQGAP1 (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of IQGAP1 protein CTD PMID:37730182 Iqgap1 Rat fulvestrant decreases expression ISO IQGAP1 (Homo sapiens) 6480464 fulvestrant results in decreased expression of IQGAP1 mRNA CTD PMID:16514628 Iqgap1 Rat furfural multiple interactions ISO IQGAP1 (Homo sapiens) 6480464 [Furaldehyde co-treated with pyrogallol 1 more ... CTD PMID:38598786 Iqgap1 Rat geldanamycin increases expression ISO IQGAP1 (Homo sapiens) 6480464 geldanamycin results in increased expression of IQGAP1 mRNA CTD PMID:26705709 Iqgap1 Rat gemcitabine increases expression ISO IQGAP1 (Homo sapiens) 6480464 Gemcitabine results in increased expression of IQGAP1 mRNA CTD PMID:17039268 Iqgap1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of IQGAP1 mRNA CTD PMID:22061828 Iqgap1 Rat griseofulvin affects expression ISO Iqgap1 (Mus musculus) 6480464 Griseofulvin affects the expression of IQGAP1 mRNA CTD PMID:12735108 Iqgap1 Rat ivermectin decreases expression ISO IQGAP1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of IQGAP1 protein CTD PMID:32959892 Iqgap1 Rat L-methionine multiple interactions ISO Iqgap1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of IQGAP1 mRNA CTD PMID:20938992 Iqgap1 Rat manganese atom multiple interactions ISO IQGAP1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of IQGAP1 mRNA and [manganese chloride results in increased abundance of Manganese] which results in decreased expression of IQGAP1 mRNA CTD PMID:39836092 Iqgap1 Rat manganese(0) multiple interactions ISO IQGAP1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of IQGAP1 mRNA and [manganese chloride results in increased abundance of Manganese] which results in decreased expression of IQGAP1 mRNA CTD PMID:39836092 Iqgap1 Rat manganese(II) chloride increases expression EXP 6480464 manganese chloride results in increased expression of IQGAP1 mRNA CTD PMID:28801915 Iqgap1 Rat manganese(II) chloride multiple interactions ISO IQGAP1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of IQGAP1 mRNA and [manganese chloride results in increased abundance of Manganese] which results in decreased expression of IQGAP1 mRNA CTD PMID:39836092 Iqgap1 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of IQGAP1 mRNA CTD PMID:30047161 Iqgap1 Rat methylmercury chloride increases expression ISO IQGAP1 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of IQGAP1 mRNA CTD PMID:26272509 and PMID:28001369 Iqgap1 Rat mitoxantrone affects response to substance ISO IQGAP1 (Homo sapiens) 6480464 IQGAP1 protein affects the susceptibility to Mitoxantrone CTD PMID:16217747 Iqgap1 Rat N-nitrosodiethylamine increases expression ISO Iqgap1 (Mus musculus) 6480464 Diethylnitrosamine results in increased expression of IQGAP1 mRNA CTD PMID:26464624 Iqgap1 Rat N-nitrosodimethylamine increases expression EXP 6480464 Dimethylnitrosamine results in increased expression of IQGAP1 mRNA CTD PMID:25380136 Iqgap1 Rat ochratoxin A increases expression EXP 6480464 ochratoxin A results in increased expression of IQGAP1 mRNA CTD PMID:19717638 Iqgap1 Rat panobinostat multiple interactions ISO IQGAP1 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of IQGAP1 mRNA CTD PMID:27188386 Iqgap1 Rat panobinostat increases expression ISO IQGAP1 (Homo sapiens) 6480464 panobinostat results in increased expression of IQGAP1 mRNA CTD PMID:26272509 Iqgap1 Rat paracetamol affects expression ISO Iqgap1 (Mus musculus) 6480464 Acetaminophen affects the expression of IQGAP1 mRNA CTD PMID:17562736 Iqgap1 Rat paracetamol increases expression ISO Iqgap1 (Mus musculus) 6480464 Acetaminophen results in increased expression of IQGAP1 mRNA CTD PMID:29246445 Iqgap1 Rat paracetamol multiple interactions ISO Iqgap1 (Mus musculus) 6480464 PANX1 gene mutant form inhibits the reaction [Acetaminophen results in increased expression of IQGAP1 mRNA] CTD PMID:29246445 Iqgap1 Rat paraquat increases expression ISO IQGAP1 (Homo sapiens) 6480464 Paraquat results in increased expression of IQGAP1 protein CTD PMID:34064677 Iqgap1 Rat perfluorohexanesulfonic acid decreases expression ISO Iqgap1 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in decreased expression of IQGAP1 mRNA CTD PMID:37995155 Iqgap1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Iqgap1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of IQGAP1 mRNA CTD PMID:36331819 Iqgap1 Rat perfluorooctanoic acid increases expression ISO Iqgap1 (Mus musculus) 6480464 perfluorooctanoic acid results in increased expression of IQGAP1 protein CTD PMID:37422089 Iqgap1 Rat phenobarbital affects expression ISO Iqgap1 (Mus musculus) 6480464 Phenobarbital affects the expression of IQGAP1 mRNA CTD PMID:23091169 Iqgap1 Rat phenylmercury acetate increases expression ISO IQGAP1 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of IQGAP1 mRNA CTD PMID:26272509 Iqgap1 Rat phenylmercury acetate multiple interactions ISO IQGAP1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of IQGAP1 mRNA CTD PMID:27188386 Iqgap1 Rat pirinixic acid multiple interactions ISO IQGAP1 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of IQGAP1 mRNA CTD PMID:19710929 Iqgap1 Rat pyrogallol increases expression ISO Iqgap1 (Mus musculus) 6480464 Pyrogallol results in increased expression of IQGAP1 mRNA CTD PMID:20362636 Iqgap1 Rat quercetin decreases expression ISO IQGAP1 (Homo sapiens) 6480464 Quercetin results in decreased expression of IQGAP1 mRNA and Quercetin results in decreased expression of IQGAP1 protein CTD PMID:19207037 and PMID:24397597 Iqgap1 Rat quercetin multiple interactions ISO IQGAP1 (Homo sapiens) 6480464 Quercetin inhibits the reaction [IQGAP1 protein binds to MAPK1 protein binds to MAPK3 protein] CTD PMID:24397597 Iqgap1 Rat quercetin increases expression ISO IQGAP1 (Homo sapiens) 6480464 Quercetin results in increased expression of IQGAP1 mRNA CTD PMID:21632981 Iqgap1 Rat raloxifene decreases expression ISO IQGAP1 (Homo sapiens) 6480464 Raloxifene Hydrochloride results in decreased expression of IQGAP1 mRNA CTD PMID:16514628 Iqgap1 Rat rimonabant multiple interactions ISO Iqgap1 (Mus musculus) 6480464 Rimonabant inhibits the reaction [Dietary Fats results in increased expression of IQGAP1 mRNA] CTD PMID:19030233 Iqgap1 Rat rimonabant affects expression ISO Iqgap1 (Mus musculus) 6480464 Rimonabant affects the expression of IQGAP1 mRNA CTD PMID:19030233 Iqgap1 Rat rotenone increases expression ISO IQGAP1 (Homo sapiens) 6480464 Rotenone results in increased expression of IQGAP1 mRNA CTD PMID:33512557 Iqgap1 Rat sarin decreases expression ISO IQGAP1 (Homo sapiens) 6480464 Sarin results in decreased expression of IQGAP1 mRNA CTD PMID:19522546 Iqgap1 Rat SB 431542 multiple interactions ISO IQGAP1 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 and PMID:37664457 Iqgap1 Rat serpentine asbestos increases expression ISO Iqgap1 (Mus musculus) 6480464 Asbestos and Serpentine results in increased expression of IQGAP1 mRNA CTD PMID:16251409 Iqgap1 Rat silicon dioxide increases expression EXP 6480464 Silicon Dioxide results in increased expression of IQGAP1 mRNA CTD PMID:22431001 Iqgap1 Rat sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of IQGAP1 protein CTD PMID:29459688 Iqgap1 Rat sodium arsenite increases expression ISO Iqgap1 (Mus musculus) 6480464 sodium arsenite results in increased expression of IQGAP1 mRNA CTD PMID:36209798 Iqgap1 Rat sodium arsenite multiple interactions ISO IQGAP1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of IQGAP1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of IQGAP1 mRNA CTD PMID:39836092 Iqgap1 Rat sodium arsenite increases expression ISO IQGAP1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of IQGAP1 mRNA CTD PMID:38568856 Iqgap1 Rat sodium chloride multiple interactions ISO IQGAP1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of IQGAP1 protein more ... CTD PMID:38598786 Iqgap1 Rat sodium dichromate increases expression ISO Iqgap1 (Mus musculus) 6480464 sodium bichromate results in increased expression of IQGAP1 mRNA CTD PMID:31558096 Iqgap1 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of IQGAP1 mRNA CTD PMID:30047161 Iqgap1 Rat sunitinib decreases expression ISO IQGAP1 (Homo sapiens) 6480464 Sunitinib results in decreased expression of IQGAP1 mRNA CTD PMID:31533062 Iqgap1 Rat temozolomide decreases expression ISO IQGAP1 (Homo sapiens) 6480464 Temozolomide results in decreased expression of IQGAP1 mRNA CTD PMID:31758290 Iqgap1 Rat tetrachloromethane increases expression ISO Iqgap1 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of IQGAP1 mRNA CTD PMID:27339419 more ... Iqgap1 Rat tetrachloromethane decreases expression ISO Iqgap1 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of IQGAP1 mRNA CTD PMID:34224798 Iqgap1 Rat thapsigargin increases expression ISO Iqgap1 (Mus musculus) 6480464 Thapsigargin results in increased expression of IQGAP1 protein CTD PMID:24648495 Iqgap1 Rat thimerosal decreases expression ISO IQGAP1 (Homo sapiens) 6480464 Thimerosal results in decreased expression of IQGAP1 mRNA CTD PMID:27188386 Iqgap1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of IQGAP1 mRNA CTD PMID:34492290 Iqgap1 Rat titanium dioxide increases methylation ISO Iqgap1 (Mus musculus) 6480464 titanium dioxide results in increased methylation of IQGAP1 gene CTD PMID:35295148 Iqgap1 Rat toluene increases expression EXP 6480464 Toluene results in increased expression of IQGAP1 mRNA CTD PMID:22967744 Iqgap1 Rat trichostatin A increases expression ISO IQGAP1 (Homo sapiens) 6480464 trichostatin A results in increased expression of IQGAP1 mRNA CTD PMID:24935251 and PMID:26272509 Iqgap1 Rat trichostatin A multiple interactions ISO IQGAP1 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of IQGAP1 mRNA CTD PMID:27188386 Iqgap1 Rat tungsten decreases expression ISO Iqgap1 (Mus musculus) 6480464 Tungsten results in decreased expression of IQGAP1 mRNA CTD PMID:30912803 Iqgap1 Rat valproic acid decreases expression ISO IQGAP1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of IQGAP1 mRNA CTD PMID:29154799 Iqgap1 Rat valproic acid affects splicing EXP 6480464 Valproic Acid affects the splicing of IQGAP1 mRNA CTD PMID:29427782 Iqgap1 Rat valproic acid multiple interactions ISO IQGAP1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of IQGAP1 mRNA CTD PMID:27188386 Iqgap1 Rat valproic acid increases expression ISO IQGAP1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of IQGAP1 mRNA CTD PMID:23179753 more ... Iqgap1 Rat vancomycin decreases expression ISO Iqgap1 (Mus musculus) 6480464 Vancomycin results in decreased expression of IQGAP1 mRNA CTD PMID:18930951 Iqgap1 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of IQGAP1 mRNA CTD PMID:19015723 Iqgap1 Rat vinclozolin increases methylation EXP 6480464 vinclozolin results in increased methylation of IQGAP1 gene CTD PMID:31682807 Iqgap1 Rat vinclozolin decreases methylation EXP 6480464 vinclozolin results in decreased methylation of IQGAP1 gene CTD PMID:31079544 Iqgap1 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of IQGAP1 mRNA CTD PMID:23034163 Iqgap1 Rat vitamin E decreases expression ISO IQGAP1 (Homo sapiens) 6480464 Vitamin E results in decreased expression of IQGAP1 mRNA CTD PMID:19244175 Iqgap1 Rat vorinostat decreases expression ISO IQGAP1 (Homo sapiens) 6480464 vorinostat results in decreased expression of IQGAP1 mRNA CTD PMID:27188386
Imported Annotations - PID (archival)
(1->4)-beta-D-glucan (ISO) 1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane (EXP) 1,2-dimethylhydrazine (ISO) 1-chloro-2,4-dinitrobenzene (ISO) 1-naphthyl isothiocyanate (EXP) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,6-dimethoxyphenol (ISO) 2-amino-14,16-dimethyloctadecan-3-ol (ISO) 3',5'-cyclic AMP (EXP) 3-chloropropane-1,2-diol (EXP) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) acrylamide (EXP) afatinib (ISO) afimoxifene (ISO) aflatoxin B1 (ISO) amitrole (EXP) aristolochic acid A (ISO) aristolochic acids (EXP) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) butanal (ISO) calcium atom (ISO) calcium(0) (ISO) captan (ISO) CGP 52608 (ISO) choline (ISO) coumarin (ISO) crizotinib (ISO) crocidolite asbestos (ISO) CU-O LINKAGE (ISO) cycloheximide (ISO) cyclosporin A (ISO) deguelin (ISO) dibenzo[a,l]pyrene (ISO) Dibutyl phosphate (ISO) dihydroartemisinin (ISO) dimethylarsinous acid (ISO) dorsomorphin (ISO) doxorubicin (ISO) entinostat (ISO) ethanol (EXP) folic acid (ISO) folpet (ISO) FR900359 (ISO) fulvestrant (ISO) furfural (ISO) geldanamycin (ISO) gemcitabine (ISO) gentamycin (EXP) griseofulvin (ISO) ivermectin (ISO) L-methionine (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (EXP,ISO) methimazole (EXP) methylmercury chloride (ISO) mitoxantrone (ISO) N-nitrosodiethylamine (ISO) N-nitrosodimethylamine (EXP) ochratoxin A (EXP) panobinostat (ISO) paracetamol (ISO) paraquat (ISO) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenobarbital (ISO) phenylmercury acetate (ISO) pirinixic acid (ISO) pyrogallol (ISO) quercetin (ISO) raloxifene (ISO) rimonabant (ISO) rotenone (ISO) sarin (ISO) SB 431542 (ISO) serpentine asbestos (ISO) silicon dioxide (EXP) sodium arsenite (EXP,ISO) sodium chloride (ISO) sodium dichromate (ISO) sulfadimethoxine (EXP) sunitinib (ISO) temozolomide (ISO) tetrachloromethane (ISO) thapsigargin (ISO) thimerosal (ISO) thioacetamide (EXP) titanium dioxide (ISO) toluene (EXP) trichostatin A (ISO) tungsten (ISO) valproic acid (EXP,ISO) vancomycin (ISO) vinclozolin (EXP) vitamin E (ISO) vorinostat (ISO)
Biological Process
caveola assembly (IEA,ISO) cell migration (ISO) cellular response to calcium ion (ISO) cellular response to epidermal growth factor stimulus (IEA,ISO) cellular response to fibroblast growth factor stimulus (IEA,ISO) cellular response to platelet-derived growth factor stimulus (IEA,ISO) epidermal growth factor receptor signaling pathway (IBA,IEA,ISO) fibroblast growth factor receptor signaling pathway (IEA,ISO) fibroblast migration (IBA,IEA,ISO) MAPK cascade (IEA) mitotic actomyosin contractile ring assembly actin filament organization (IBA) negative regulation of dephosphorylation (IEA,ISO) neuron projection extension (ISO) platelet-derived growth factor receptor signaling pathway (IEA,ISO) positive regulation of dendrite development (IMP) positive regulation of focal adhesion assembly (IMP) positive regulation of MAP kinase activity (IMP) positive regulation of MAPK cascade (ISO) positive regulation of peptidyl-tyrosine autophosphorylation (IMP) positive regulation of protein kinase activity (ISO) positive regulation of protein localization (IMP) positive regulation of vascular associated smooth muscle cell migration (IMP) regulation of cytokine production (IEA,ISO) regulation of mitotic cell cycle (ISO) regulation of postsynapse assembly (IDA,IMP) response to angiotensin (IEP)
Cellular Component
actin cytoskeleton (IDA) apical plasma membrane (IEA,ISO) axon (IDA) basolateral plasma membrane (IEA,ISO) cell cortex (IBA) cell leading edge (IEA,ISO) cell-cell junction (IEA,ISO) cortical actin cytoskeleton (IEA,ISO) cytoplasm (IEA,ISO) cytoplasmic ribonucleoprotein granule (ISO) cytoplasmic side of plasma membrane (ISO) focal adhesion (IDA,IEA,ISO) growth cone (IDA) lateral plasma membrane (IEA,ISO) microtubule (ISO) microtubule cytoskeleton (IDA) midbody (ISO) neuron projection (IDA,IEA,ISO) nucleus (IBA,IEA,ISO) plasma membrane (ISO) plasma membrane bounded cell projection (IEA) postsynapse (IDA,IMP) protein-containing complex (IDA) ribonucleoprotein complex (IEA,ISO) ruffle (ISO)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
3.
Regulation of spine density and morphology by IQGAP1 protein domains.
Jausoro I, etal., PLoS One. 2013;8(2):e56574. doi: 10.1371/journal.pone.0056574. Epub 2013 Feb 18.
4.
IQGAP1 translocates to the nucleus in early S-phase and contributes to cell cycle progression after DNA replication arrest.
Johnson M, etal., Int J Biochem Cell Biol. 2011 Jan;43(1):65-73. doi: 10.1016/j.biocel.2010.09.014. Epub 2010 Sep 29.
5.
IQGAP1 links PDGF receptor-beta signal to focal adhesions involved in vascular smooth muscle cell migration: role in neointimal formation after vascular injury.
Kohno T, etal., Am J Physiol Cell Physiol. 2013 Sep 15;305(6):C591-600. doi: 10.1152/ajpcell.00011.2013. Epub 2013 May 8.
6.
Nephrin forms a complex with adherens junction proteins and CASK in podocytes and in Madin-Darby canine kidney cells expressing nephrin.
Lehtonen S, etal., Am J Pathol. 2004 Sep;165(3):923-36.
7.
IQGAP1 promotes neurite outgrowth in a phosphorylation-dependent manner.
Li Z, etal., J Biol Chem. 2005 Apr 8;280(14):13871-8. Epub 2005 Jan 28.
8.
IQGAP1 mediates angiotensin II-induced apoptosis of podocytes via the ERK1/2 MAPK signaling pathway.
Liu Y, etal., Am J Nephrol. 2013;38(5):430-44. doi: 10.1159/000355970. Epub 2013 Nov 12.
9.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
10.
Identification of an IQGAP1/AKAP79 complex in beta-cells.
Nauert JB, etal., J Cell Biochem 2003 Sep 1;90(1):97-108.
11.
Phosphorylation-dependent interactions of alpha-Actinin-1/IQGAP1 with the AMPA receptor subunit GluR4.
Nuriya M, etal., J Neurochem. 2005 Oct;95(2):544-52. doi: 10.1111/j.1471-4159.2005.03410.x.
12.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
13.
GOA pipeline
RGD automated data pipeline
14.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
15.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
16.
Rho GTPases in insulin-stimulated glucose uptake.
Satoh T Small GTPases. 2014;5:e28102. doi: 10.4161/sgtp.28102. Epub 2014 Mar 10.
17.
CLIP-170 and IQGAP1 cooperatively regulate dendrite morphology.
Swiech L, etal., J Neurosci. 2011 Mar 23;31(12):4555-68. doi: 10.1523/JNEUROSCI.6582-10.2011.
18.
Hierarchical scaffolding of an ERK1/2 activation pathway.
Vetterkind S, etal., Cell Commun Signal. 2013 Aug 29;11:65. doi: 10.1186/1478-811X-11-65.
19.
IQGAP1, a novel vascular endothelial growth factor receptor binding protein, is involved in reactive oxygen species--dependent endothelial migration and proliferation.
Yamaoka-Tojo M, etal., Circ Res. 2004 Aug 6;95(3):276-83. Epub 2004 Jun 24.
Iqgap1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 144,088,788 - 144,178,989 (-) NCBI GRCr8 mRatBN7.2 1 134,679,581 - 134,769,776 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 134,679,586 - 134,769,755 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 142,588,968 - 142,679,115 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 149,758,382 - 149,848,532 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 142,676,568 - 142,767,383 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 142,525,041 - 142,615,673 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 142,525,046 - 142,615,673 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 143,476,882 - 143,567,395 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 136,552,358 - 136,642,545 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 136,631,848 - 136,722,691 (-) NCBI Celera 1 126,734,261 - 126,824,269 (-) NCBI Celera Cytogenetic Map 1 q31 NCBI
IQGAP1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 15 90,388,242 - 90,502,239 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 15 90,388,242 - 90,502,239 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 15 90,931,474 - 91,045,471 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 15 88,732,477 - 88,846,479 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 15 88,732,476 - 88,846,479 NCBI Celera 15 67,336,216 - 67,450,214 (+) NCBI Celera Cytogenetic Map 15 q26.1 NCBI HuRef 15 67,043,721 - 67,156,752 (+) NCBI HuRef CHM1_1 15 90,773,219 - 90,887,196 (+) NCBI CHM1_1 T2T-CHM13v2.0 15 88,144,255 - 88,258,256 (+) NCBI T2T-CHM13v2.0
Iqgap1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 80,361,331 - 80,453,288 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 80,361,331 - 80,475,722 (-) Ensembl GRCm39 Ensembl GRCm38 7 80,711,583 - 80,815,549 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 80,711,583 - 80,825,974 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 87,856,469 - 87,948,217 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 80,586,294 - 80,676,807 (-) NCBI MGSCv36 mm8 Celera 7 78,116,162 - 78,211,858 (-) NCBI Celera Cytogenetic Map 7 D3 NCBI cM Map 7 45.68 NCBI
Iqgap1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955416 14,560,292 - 14,650,036 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955416 14,558,628 - 14,652,031 (+) NCBI ChiLan1.0 ChiLan1.0
IQGAP1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 16 79,935,362 - 80,049,434 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 15 83,634,820 - 83,748,904 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 15 69,076,025 - 69,190,082 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 15 88,276,762 - 88,390,721 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 15 88,276,851 - 88,388,594 (+) Ensembl panpan1.1 panPan2
IQGAP1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 3 53,683,869 - 53,791,136 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 3 53,683,791 - 53,792,186 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 3 56,321,230 - 56,429,279 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 3 54,099,750 - 54,207,801 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 3 54,098,495 - 54,207,760 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 3 53,618,792 - 53,726,768 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 3 53,830,202 - 53,938,180 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 3 54,170,507 - 54,278,357 (-) NCBI UU_Cfam_GSD_1.0
Iqgap1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 129,739,918 - 129,845,387 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936483 16,489,133 - 16,594,783 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936483 16,489,127 - 16,594,712 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
IQGAP1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 29 9,363,273 - 9,485,644 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 29 9,362,926 - 9,485,526 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666059 37,209,223 - 37,324,055 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Iqgap1
.
Predicted Target Of
Count of predictions: 506 Count of miRNA genes: 224 Interacting mature miRNAs: 274 Transcripts: ENSRNOT00000018021 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
61442 Strs1 Sensitivity to stroke QTL 1 7.4 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 1 121767634 166767634 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 1578654 Bss10 Bone structure and strength QTL 10 4 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 1 49393172 159356837 Rat 1598866 Bp287 Blood pressure QTL 287 5.1 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 121006655 166006655 Rat 1578770 Stresp23 Stress response QTL 23 kidney sympathetic nerve activity (VT:0004050) stimulated renal sympathetic nerve activity to basal renal sympathetic nerve activity ratio (CMO:0001786) 1 123350408 182418476 Rat 9590300 Scort16 Serum corticosterone level QTL 16 4.39 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 103111621 148111621 Rat 2298545 Neuinf8 Neuroinflammation QTL 8 4.6 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 1 57336763 151090257 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 631199 Cm23 Cardiac mass QTL 23 4.6 0.0004 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 115585465 172949803 Rat 2313402 Anxrr24 Anxiety related response QTL 24 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 1 48963584 144267916 Rat 1598850 Bp297 Blood pressure QTL 297 2.1 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 121006655 166006655 Rat 631570 Bp94 Blood pressure QTL 94 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123479780 142990467 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 152025232 Bw192 Body weight QTL 192 3.93 body mass (VT:0001259) 1 117917486 196963478 Rat 724521 Uae1 Urinary albumin excretion QTL 1 3.8 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 90508614 173018436 Rat 1358902 Bw47 Body weight QTL 47 1.67 body mass (VT:0001259) body weight (CMO:0000012) 1 90508614 180359386 Rat 61346 Rf2 Renal disease susceptibility QTL 2 3.7 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 1 99267916 144267916 Rat 8655649 Arrd1 Age-related retinal degeneration QTL 1 4.89 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 100357752 183970443 Rat 1300153 Bp171 Blood pressure QTL 171 3.37 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 90664883 143200202 Rat 2317833 Alcrsp19 Alcohol response QTL 19 12.4 0.001 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 1 100979852 145979852 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 631202 Gluco13 Glucose level QTL 13 0.0001 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 131763437 159756369 Rat 631205 Bp196 Blood pressure QTL 196 4 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118944897 199050459 Rat 1300158 Bp173 Blood pressure QTL 173 3.48 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 1 115540693 185145286 Rat 1641897 Alcrsp1 Alcohol response QTL 1 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 1 100979852 145979852 Rat 1331749 Hrtrt11 Heart rate QTL 11 2.973 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 94494440 198211706 Rat 1331751 Bp199 Blood pressure QTL 199 3.60022 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 94494440 181830018 Rat 2293142 Bp314 Blood pressure QTL 314 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 92184926 137184926 Rat 9685799 Bp375 Blood pressure QTL 375 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 170611501 Rat 2293140 Bp313 Blood pressure QTL 313 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 121833674 166833674 Rat 9685802 Bp376 Blood pressure QTL 376 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 126540680 171540680 Rat 724529 Cm16 Cardiac mass QTL 16 2.7 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 1 87580395 150700247 Rat 61370 Mcs3 Mammary carcinoma susceptibility QTL 3 2.15 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 1 102268556 147268556 Rat 1641895 Bp298 Blood pressure QTL 298 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 123350408 182418476 Rat 70209 Niddm23 Non-insulin dependent diabetes mellitus QTL 23 2.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 94494440 198324465 Rat 631496 Bp97 Blood pressure QTL 97 3.08 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 106047847 151047847 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 2303591 Gluco41 Glucose level QTL 41 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 102168504 147168504 Rat 1331793 Bp200 Blood pressure QTL 200 3.71601 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94494440 172949803 Rat 2313060 Bss71 Bone structure and strength QTL 71 2.6 0.0001 long bone metaphysis morphology trait (VT:0000133) tibia midshaft total cross-sectional area (CMO:0001715) 1 118944747 163944747 Rat 6893347 Bw98 Body weight QTL 98 0.2 0.53 body mass (VT:0001259) body weight (CMO:0000012) 1 133680936 178680936 Rat 1354591 Cm36 Cardiac mass QTL 36 4.1 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 102813953 201278233 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 61399 Tcat1 Tongue tumor resistance QTL 1 3.3 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 5 mm (CMO:0001879) 1 99267916 144267916 Rat 6893361 Bw104 Body weight QTL 104 0.59 0.27 body mass (VT:0001259) body weight (CMO:0000012) 1 133680936 178680936 Rat 724567 Tcas6 Tongue tumor susceptibility QTL 6 6.85 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 1 92948896 144267916 Rat 738006 Anxrr14 Anxiety related response QTL 14 4 0.00035 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 130636910 175636910 Rat 1558645 Bw55 Body weight QTL 55 3.2 0.004 body mass (VT:0001259) body weight (CMO:0000012) 1 133680936 178680936 Rat 1354615 Cm32 Cardiac mass QTL 32 5.2 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 102813953 201278233 Rat 634348 Bp138 Blood pressure QTL 138 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 168883176 Rat 8694370 Bw154 Body weight QTL 154 8.91 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 1 103111621 148111621 Rat 738028 Anxrr12 Anxiety related response QTL 12 4.9 0.00001 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 130636910 175636910 Rat 1354623 Rf46 Renal function QTL 46 3.8 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 1 102813953 151162766 Rat 631654 Bp107 Blood pressure QTL 107 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 170611501 Rat 631544 Bp84 Blood pressure QTL 84 5.6 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350408 181759564 Rat 152025212 Bw190 Body weight QTL 190 5.7 body mass (VT:0001259) 1 123556856 196963478 Rat 631549 Bp89 Blood pressure QTL 89 5.7 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350581 201284552 Rat 1358189 Cstrr1 Cold stress response QTL 1 0.0001 catecholamine amount (VT:0010543) urine norepinephrine level (CMO:0001629) 1 123350408 182418476 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat
D1Got124
Rat Assembly Chr Position (strand) Source JBrowse Rnor_6.0 1 142,624,945 - 142,625,025 NCBI Rnor6.0 Rnor_5.0 1 143,576,626 - 143,576,706 UniSTS Rnor5.0 RGSC_v3.4 1 136,652,602 - 136,652,683 RGD RGSC3.4 RGSC_v3.4 1 136,652,603 - 136,652,683 UniSTS RGSC3.4 RGSC_v3.1 1 136,731,009 - 136,731,089 RGD Celera 1 126,833,500 - 126,833,582 UniSTS RH 3.4 Map 1 1077.3 RGD RH 3.4 Map 1 1077.3 UniSTS RH 2.0 Map 1 689.9 RGD Cytogenetic Map 1 q31 UniSTS
RH129224
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 134,679,647 - 134,679,852 (+) MAPPER mRatBN7.2 Rnor_6.0 1 142,525,108 - 142,525,312 NCBI Rnor6.0 Rnor_5.0 1 143,476,949 - 143,477,153 UniSTS Rnor5.0 RGSC_v3.4 1 136,552,425 - 136,552,629 UniSTS RGSC3.4 Celera 1 126,734,328 - 126,734,532 UniSTS RH 3.4 Map 1 1075.5 UniSTS Cytogenetic Map 1 q31 UniSTS
AU047418
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 134,742,669 - 134,742,966 (+) MAPPER mRatBN7.2 Rnor_6.0 1 142,588,533 - 142,588,829 NCBI Rnor6.0 Rnor_5.0 1 143,540,374 - 143,540,670 UniSTS Rnor5.0 RGSC_v3.4 1 136,615,441 - 136,615,737 UniSTS RGSC3.4 Celera 1 126,797,222 - 126,797,518 UniSTS Cytogenetic Map 1 q31 UniSTS
RH137092
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 134,678,465 - 134,678,664 (+) MAPPER mRatBN7.2 Rnor_6.0 1 142,523,926 - 142,524,124 NCBI Rnor6.0 Rnor_5.0 1 143,475,767 - 143,475,965 UniSTS Rnor5.0 RGSC_v3.4 1 136,551,243 - 136,551,441 UniSTS RGSC3.4 Celera 1 126,733,146 - 126,733,344 UniSTS RH 3.4 Map 1 1075.5 UniSTS Cytogenetic Map 1 q31 UniSTS
AI011928
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 134,678,462 - 134,678,748 (+) MAPPER mRatBN7.2 Rnor_6.0 1 142,523,923 - 142,524,208 NCBI Rnor6.0 Rnor_5.0 1 143,475,764 - 143,476,049 UniSTS Rnor5.0 RGSC_v3.4 1 136,551,240 - 136,551,525 UniSTS RGSC3.4 Celera 1 126,733,143 - 126,733,428 UniSTS RH 3.4 Map 1 1075.7 UniSTS Cytogenetic Map 1 q31 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000018021 ⟹ ENSRNOP00000018021
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 134,679,586 - 134,769,755 (-) Ensembl Rnor_6.0 Ensembl 1 142,525,046 - 142,615,673 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000118439 ⟹ ENSRNOP00000093807
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 134,679,586 - 134,767,547 (-) Ensembl
RefSeq Acc Id:
NM_001108489 ⟹ NP_001101959
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 144,088,788 - 144,178,953 (-) NCBI mRatBN7.2 1 134,679,581 - 134,769,755 (-) NCBI Rnor_6.0 1 142,525,041 - 142,615,673 (-) NCBI Rnor_5.0 1 143,476,882 - 143,567,395 (-) NCBI RGSC_v3.4 1 136,552,358 - 136,642,545 (-) RGD Celera 1 126,734,261 - 126,824,269 (-) RGD
Sequence:
AGCGACAGCCCGCGCACTGGGCAGGAGTTGCTGCTGCTACGGTCGCCCGCGTCTTCAAGGTCTCTGCTCTTCCTCACCGGAGACCGGGACTCGGCCGCCATGTCCGCCGCGGAGGAGGTCGATGGCCT
hide sequence
RefSeq Acc Id:
XM_039082350 ⟹ XP_038938278
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 144,105,668 - 144,178,989 (-) NCBI mRatBN7.2 1 134,696,450 - 134,769,776 (-) NCBI
RefSeq Acc Id:
NP_001101959 ⟸ NM_001108489
- UniProtKB:
G3V7Q7 (UniProtKB/TrEMBL), A6JCC7 (UniProtKB/TrEMBL), A0A8I6AJK7 (UniProtKB/TrEMBL)
- Sequence:
MSAAEEVDGLGVVRPHYGSVLDNERLTAEEMDERRRQNVAYEYLCHLEEAKRWMEACLGEDLPPTTELEEGLRNGVYLAKLGNFFSPKVVSLKKIYDREQTRYKATGLHFRHTDNVIQWLNAMDEIGL
hide sequence
Ensembl Acc Id:
ENSRNOP00000018021 ⟸ ENSRNOT00000018021
RefSeq Acc Id:
XP_038938278 ⟸ XM_039082350
- Peptide Label:
isoform X1
Ensembl Acc Id:
ENSRNOP00000093807 ⟸ ENSRNOT00000118439
RGD ID: 13690148 Promoter ID: EPDNEW_R673 Type: initiation region Name: Iqgap1_1 Description: IQ motif containing GTPase activating protein 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 142,615,673 - 142,615,733 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Iqgap1
IQ motif containing GTPase activating protein 1
Iqgap1_predicted
IQ motif containing GTPase activating protein 1 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Iqgap1_predicted
IQ motif containing GTPase activating protein 1 (predicted)
Symbol and Name status set to approved
70820 APPROVED
