Rbx1 (ring-box 1) - Rat Genome Database

Name: Rbx1
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Rbx1 (ring-box 1) Rattus norvegicus

Analyze

Symbol:

Rbx1

Name:

ring-box 1

RGD ID:

1308453

Description:

Predicted to enable several functions, including cullin family protein binding activity; ubiquitin protein ligase binding activity; and ubiquitin-like protein ligase activity. Predicted to contribute to ubiquitin-protein transferase activity. Predicted to be involved in several processes, including positive regulation of intracellular signal transduction; proteasome-mediated ubiquitin-dependent protein catabolic process; and protein modification by small protein conjugation. Predicted to act upstream of or within protein K48-linked ubiquitination; protein catabolic process; and protein monoubiquitination. Part of VCB complex. Orthologous to human RBX1 (ring-box 1); PARTICIPATES IN hypoxia inducible factor pathway; neddylation pathway; nuclear factor kappa B signaling pathway; INTERACTS WITH 2,4-dinitrotoluene; 2,6-dinitrotoluene; 4,4'-sulfonyldiphenol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

E3 ubiquitin-protein ligase RBX1; LOC300084; MGC116275; ring-box 1, E3 ubiquitin protein ligase; ring-box 1-like; RING-box protein 1

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RBX1 (ring-box 1)	HGNC	Ensembl, Inparanoid, NCBI, Panther
Mus musculus (house mouse):	Rbx1 (ring-box 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rbx1 (ring-box 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RBX1 (ring-box 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RBX1 (ring-box 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rbx1 (ring-box 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RBX1 (ring-box 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RBX1 (ring-box 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rbx1 (ring-box 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	CRX (cone-rod homeobox)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	RBX1 (ring-box 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Rbx1 (ring-box 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rbx1 (ring-box 1, E3 ubiquitin protein ligase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	HRT1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Roc1a	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	rbx-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	114,870,893 - 114,881,194 (+)	NCBI		GRCr8
mRatBN7.2	7	112,976,863 - 113,001,051 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	112,990,835 - 113,001,051 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	114,753,189 - 114,763,404 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	116,976,687 - 116,986,902 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	116,946,098 - 116,956,313 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	122,700,849 - 122,710,907 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	122,700,854 - 122,709,935 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	122,677,395 - 122,687,076 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	119,794,976 - 119,805,104 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	119,828,667 - 119,836,146 (+)	NCBI
Celera	7	109,310,166 - 109,320,235 (+)	NCBI		Celera
Cytogenetic Map	7	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

adenylosuccinase lyase deficiency (ISO)

common variable immunodeficiency 4 (ISO)

nephronophthisis-like nephropathy 1 (ISO)

Rubinstein-Taybi syndrome (ISO)

Stevens-Johnson syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

2-acetamidofluorene (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (EXP)

all-trans-retinoic acid (ISO)

antimycin A (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

caffeine (ISO)

calycosin (ISO)

chloropicrin (ISO)

chlorpyrifos (ISO)

cisplatin (ISO)

cobalt dichloride (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

deguelin (ISO)

dibenzo[a,l]pyrene (ISO)

diclofenac (ISO)

dicrotophos (ISO)

dinophysistoxin 1 (ISO)

diuron (ISO)

doxorubicin (ISO)

endosulfan (EXP)

ethanol (ISO)

fenofibrate (ISO)

ferroheme b (ISO)

finasteride (EXP)

fipronil (EXP)

flutamide (EXP)

folic acid (ISO)

heme b (ISO)

hypochlorous acid (ISO)

ivermectin (ISO)

leflunomide (EXP)

maneb (ISO)

nefazodone (EXP)

nimesulide (EXP)

okadaic acid (ISO)

ozone (ISO)

paracetamol (ISO)

paraquat (ISO)

phenobarbital (ISO)

phorbol 13-acetate 12-myristate (ISO)

pinosylvin (ISO)

piroxicam (ISO)

potassium chromate (ISO)

pyrimidifen (ISO)

sertraline (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sodium dichromate (ISO)

solanesol (ISO)

sulindac (EXP)

tamoxifen (ISO)

tebufenpyrad (ISO)

thifluzamide (ISO)

trans-pinosylvin (ISO)

trovafloxacin (ISO)

urethane (ISO)

valdecoxib (EXP)

valproic acid (ISO)

vinclozolin (EXP)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to amino acid stimulus (ISO)

cellular response to UV (ISO)

DNA damage response (ISO)

negative regulation of response to oxidative stress (ISO)

negative regulation of type I interferon production (ISO)

positive regulation of canonical NF-kappaB signal transduction (ISO)

positive regulation of proteasomal ubiquitin-dependent protein catabolic process (ISO)

positive regulation of protein autoubiquitination (ISO)

positive regulation of protein catabolic process (ISO)

positive regulation of TORC1 signaling (ISO)

proteasome-mediated ubiquitin-dependent protein catabolic process (ISO)

protein catabolic process (ISO)

protein K48-linked ubiquitination (ISO)

protein monoubiquitination (ISO)

protein neddylation (ISO)

protein polyubiquitination (ISO)

protein ubiquitination (IBA,ISO)

SCF-dependent proteasomal ubiquitin-dependent protein catabolic process (ISO)

spermatogenesis (ISO)

T cell activation (ISO)

ubiquitin-dependent protein catabolic process (IBA,ISO)

ubiquitin-dependent protein catabolic process via the C-end degron rule pathway (ISO)

Cellular Component

Cul2-RING ubiquitin ligase complex (ISO)

Cul3-RING ubiquitin ligase complex (ISO)

Cul4A-RING E3 ubiquitin ligase complex (ISO)

Cul4B-RING E3 ubiquitin ligase complex (ISO)

Cul5-RING ubiquitin ligase complex (ISO)

Cul7-RING ubiquitin ligase complex (ISO)

cullin-RING ubiquitin ligase complex (IBA,ISO)

cytoplasm (ISO)

cytosol (ISO)

nucleoplasm (ISO)

nucleus (IBA,ISO)

SCF ubiquitin ligase complex (ISO)

VCB complex (IDA)

Molecular Function

cullin family protein binding (IBA,ISO)

molecular adaptor activity (ISO)

NEDD8 ligase activity (ISO)

protein binding (ISO)

protein-containing complex binding (IPI)

RNA polymerase II-specific DNA-binding transcription factor binding (ISO)

ubiquitin protein ligase activity (IBA,ISO)

ubiquitin protein ligase binding (ISO)

ubiquitin-protein transferase activity (IC,ISO)

ubiquitin-ubiquitin ligase activity (ISO)

zinc ion binding (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

cell cycle pathway, mitotic (IEA)

Endoplasmic Reticulum-associated degradation pathway (IEA)

hypoxia inducible factor pathway (ISO)

neddylation pathway (ISS)

nuclear factor kappa B signaling pathway (ISO)

nuclear factor, erythroid 2 like 2 signaling pathway (ISO)

nucleotide excision repair pathway (IEA)

proteasome degradation pathway involving cullin-dependent ubiquitin ligases (ISS)

renal cell carcinoma pathway (IEA)

transforming growth factor-beta superfamily mediated signaling pathway (IEA)

ubiquitin/proteasome degradation pathway (IEA)

Wnt signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	The Nrf2 regulatory network provides an interface between redox and intermediary metabolism.	Hayes JD and Dinkova-Kostova AT, Trends Biochem Sci. 2014 Apr;39(4):199-218. doi: 10.1016/j.tibs.2014.02.002. Epub 2014 Mar 16.
3.	VHL-box and SOCS-box domains determine binding specificity for Cul2-Rbx1 and Cul5-Rbx2 modules of ubiquitin ligases.	Kamura T, etal., Genes Dev. 2004 Dec 15;18(24):3055-65.
4.	Muf1, a novel Elongin BC-interacting leucine-rich repeat protein that can assemble with Cul5 and Rbx1 to reconstitute a ubiquitin ligase.	Kamura T, etal., J Biol Chem. 2001 Aug 10;276(32):29748-53. Epub 2001 May 30.
5.	Rbx1, a component of the VHL tumor suppressor complex and SCF ubiquitin ligase.	Kamura T, etal., Science. 1999 Apr 23;284(5414):657-61.
6.	Expanding role of ubiquitination in NF-kappaB signaling.	Liu S and Chen ZJ, Cell Res. 2011 Jan;21(1):6-21. Epub 2010 Dec 7.
7.	Multiple roles of Rbx1 in the VBC-Cul2 ubiquitin ligase complex.	Megumi Y, etal., Genes Cells. 2005 Jul;10(7):679-91.
8.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
9.	An intact NEDD8 pathway is required for Cullin-dependent ubiquitylation in mammalian cells.	Ohh M, etal., EMBO Rep. 2002 Feb;3(2):177-82. Epub 2002 Jan 29.
10.	Nedd8 on cullin: building an expressway to protein destruction.	Pan ZQ, etal., Oncogene. 2004 Mar 15;23(11):1985-97.
11.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
12.	GOA pipeline	RGD automated data pipeline
13.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
14.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
15.	Regulation of oxygen homeostasis by hypoxia-inducible factor 1.	Semenza GL Physiology (Bethesda). 2009 Apr;24:97-106.
16.	Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex.	Zheng N, etal., Nature. 2002 Apr 18;416(6882):703-9.

Additional References at PubMed

PMID:10230407	PMID:11956208	PMID:12140560	PMID:12477932	PMID:12732143	PMID:14528312	PMID:14739464	PMID:15103331	PMID:15983046	PMID:16880526	PMID:17085480	PMID:17543862
PMID:17636018	PMID:18498745	PMID:18794347	PMID:19028597	PMID:19250909	PMID:20129063	PMID:20223979	PMID:20389280	PMID:21343341	PMID:21572392	PMID:22358839	PMID:22405651
PMID:23263282	PMID:25585578	PMID:29593216

Genomics

Comparative Map Data

Rbx1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	114,870,893 - 114,881,194 (+)	NCBI		GRCr8
mRatBN7.2	7	112,976,863 - 113,001,051 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	112,990,835 - 113,001,051 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	114,753,189 - 114,763,404 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	116,976,687 - 116,986,902 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	116,946,098 - 116,956,313 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	122,700,849 - 122,710,907 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	122,700,854 - 122,709,935 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	122,677,395 - 122,687,076 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	119,794,976 - 119,805,104 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	119,828,667 - 119,836,146 (+)	NCBI
Celera	7	109,310,166 - 109,320,235 (+)	NCBI		Celera
Cytogenetic Map	7	q34	NCBI

RBX1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	22	40,951,378 - 40,973,309 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	22	40,951,347 - 40,973,309 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	22	41,347,382 - 41,369,313 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	22	39,677,331 - 39,698,614 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	22	39,671,884 - 39,693,168	NCBI
Celera	22	25,151,059 - 25,172,347 (+)	NCBI		Celera
Cytogenetic Map	22	q13.2	NCBI
HuRef	22	24,308,951 - 24,330,592 (+)	NCBI		HuRef
CHM1_1	22	41,306,113 - 41,327,855 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	22	41,423,571 - 41,445,506 (+)	NCBI		T2T-CHM13v2.0

Rbx1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	81,350,517 - 81,360,570 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	81,350,497 - 81,360,570 (+)	Ensembl		GRCm39 Ensembl
GRCm38	15	81,466,316 - 81,476,369 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	81,466,296 - 81,476,369 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	15	81,296,746 - 81,306,799 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	15	81,293,628 - 81,303,619 (+)	NCBI		MGSCv36	mm8
Celera	15	83,584,172 - 83,594,608 (+)	NCBI		Celera
Cytogenetic Map	15	E1	NCBI
cM Map	15	38.11	NCBI

Rbx1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955413	26,579,759 - 26,592,980 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955413	26,579,759 - 26,592,980 (+)	NCBI	ChiLan1.0	ChiLan1.0

RBX1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	23	50,781,027 - 50,802,296 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	22	53,480,935 - 53,503,770 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	22	21,845,351 - 21,866,627 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	22	39,941,405 - 39,962,175 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	22	39,941,405 - 39,962,175 (+)	Ensembl	panpan1.1		panPan2

RBX1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	10	24,265,733 - 24,280,253 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	10	24,266,408 - 24,280,235 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	10	24,200,859 - 24,214,782 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	10	25,014,111 - 25,028,037 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	10	25,013,516 - 25,028,019 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	10	24,729,691 - 24,743,612 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	10	25,050,324 - 25,064,237 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	10	25,224,699 - 25,238,847 (-)	NCBI		UU_Cfam_GSD_1.0

Rbx1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	7,861,902 - 7,880,482 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936492	873,576 - 890,835 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936492	872,316 - 890,860 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RBX1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	7,500,490 - 7,515,370 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	5	7,500,492 - 7,515,388 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

RBX1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	19	23,500,361 - 23,521,676 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	19	23,500,356 - 23,522,723 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666045	101,955,371 - 101,977,480 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rbx1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624752	7,546,959 - 7,560,668 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624752	7,547,702 - 7,560,605 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Rbx1
133 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	160
Count of miRNA genes:	140
Interacting mature miRNAs:	146
Transcripts:	ENSRNOT00000025979
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	924703	115097879	Rat
61357	Bp38	Blood pressure QTL 38	1.6	0.052	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	41333674	119109060	Rat
1300179	Kidm5	Kidney mass QTL 5	3.51		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	43747012	135012528	Rat
631504	Cm27	Cardiac mass QTL 27	3.45		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	7	44421311	118198041	Rat
70173	Niddm19	Non-insulin dependent diabetes mellitus QTL 19	4.33	0.00005	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	64002457	135012528	Rat
2316947	Rf58	Renal function QTL 58	7.8		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	7	68938720	113886318	Rat
2316952	Pur22	Proteinuria QTL 22	5.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	7	68938720	113886318	Rat
2316955	Stl24	Serum triglyceride level QTL 24	7.1		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	7	68938720	113886318	Rat
631540	Bw9	Body weight QTL 9	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	7	69736226	117455174	Rat
634331	Pia17	Pristane induced arthritis QTL 17	4.7		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	7	73829340	130221005	Rat
7411654	Foco25	Food consumption QTL 25	9.3	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	75918751	120918751	Rat
7411607	Foco15	Food consumption QTL 15		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	75918751	120918751	Rat
1331728	Bp214	Blood pressure QTL 214	2.825		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	80221299	124373579	Rat
1331768	Kidm10	Kidney mass QTL 10	4.62096		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	80221299	125221299	Rat
2317052	Aia17	Adjuvant induced arthritis QTL 17	2.13		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	7	81737938	126737938	Rat
634322	Bw12	Body weight QTL 12	0		body mass (VT:0001259)	body weight (CMO:0000012)	7	83153392	128153392	Rat
1358891	Bp265	Blood pressure QTL 265	2.21		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	83591953	134666232	Rat
1358914	Bp266	Blood pressure QTL 266			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	83591953	134666232	Rat
71114	Niddm14	Non-insulin dependent diabetes mellitus QTL 14	4.5		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	7	84257275	129257275	Rat
2298475	Eau6	Experimental allergic uveoretinitis QTL 6		0.0029	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	7	84257275	129257275	Rat
1558655	Swd4	Spike wave discharge measurement QTL 4	3.68	0.0002	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge severity grade (CMO:0001988)	7	86983365	131983365	Rat
1549899	Stresp8	Stress response QTL 8	4.37	0.0008	stress-related behavior trait (VT:0010451)	defensive burying duration (CMO:0001961)	7	90482196	135012528	Rat
2299163	Iddm34	Insulin dependent diabetes mellitus QTL 34	2.71		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	7	91281130	135012528	Rat
631687	Hcas1	Hepatocarcinoma susceptibility QTL 1	3.9	0.001	liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	7	91412594	129807172	Rat
2313102	Bmd79	Bone mineral density QTL 79	2.3	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	7	94811085	116738842	Rat
1357336	Gluco6	Glucose level QTL 6	3.4		blood glucose amount (VT:0000188)	serum glucose level (CMO:0000543)	7	94811326	116294265	Rat
731176	Glom5	Glomerulus QTL 5	2.5	0.0035	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	7	96670164	135012528	Rat
1331731	Bp216	Blood pressure QTL 216	2.851		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	102297359	133492884	Rat
70159	Bp61	Blood pressure QTL 61		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	103146217	116738842	Rat
731174	Uae23	Urinary albumin excretion QTL 23	2.4	0.0042	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	7	104603555	135012528	Rat
2306821	Bp335	Blood pressure QTL 335		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	106571501	135012528	Rat
631663	Bw6	Body weight QTL 6	3.4		body mass (VT:0001259)	body weight (CMO:0000012)	7	111075573	134976056	Rat
1300112	Bp183	Blood pressure QTL 183	3.51		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	7	111182207	135012528	Rat
1331748	Bp215	Blood pressure QTL 215	4.043		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	112308254	133492884	Rat
1357339	Stl14	Serum triglyceride level QTL 14	3.45	0.0001	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	7	112729683	133492707	Rat

Markers in Region

RH135115

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Rnor_6.0	7	122,710,269 - 122,710,460	NCBI	Rnor6.0
RH 3.4 Map	7	882.2	UniSTS
Cytogenetic Map	7	q34	UniSTS

RH137490

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	112,996,536 - 112,996,742 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	122,706,572 - 122,706,777	NCBI	Rnor6.0
Rnor_5.0	7	122,682,583 - 122,682,788	UniSTS	Rnor5.0
RGSC_v3.4	7	119,799,479 - 119,799,684	UniSTS	RGSC3.4
Celera	7	109,315,848 - 109,316,053	UniSTS
Cytogenetic Map	7	q34	UniSTS

RH131226

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	113,000,747 - 113,000,930 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	122,710,604 - 122,710,786	NCBI	Rnor6.0
Rnor_5.0	7	122,686,773 - 122,686,955	UniSTS	Rnor5.0
RGSC_v3.4	7	119,804,801 - 119,804,983	UniSTS	RGSC3.4
Celera	7	109,319,932 - 109,320,114	UniSTS
RH 3.4 Map	7	878.9	UniSTS
Cytogenetic Map	7	q34	UniSTS

RH142947

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	112,992,368 - 112,992,491 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	122,702,383 - 122,702,505	NCBI	Rnor6.0
Rnor_5.0	7	122,678,929 - 122,679,051	UniSTS	Rnor5.0
Celera	7	109,311,700 - 109,311,822	UniSTS
RH 3.4 Map	7	880.6	UniSTS
Cytogenetic Map	7	q34	UniSTS

RH137754

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	112,991,861 - 112,992,039 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	122,701,876 - 122,702,053	NCBI	Rnor6.0
Rnor_5.0	7	122,678,422 - 122,678,599	UniSTS	Rnor5.0
Celera	7	109,311,193 - 109,311,370	UniSTS
Cytogenetic Map	7	q34	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	57	41	19	41	8	11	74	35	41	11	8
Low
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001034135	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039078842	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC100258	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473950	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000086603 ⟹ ENSRNOP00000069049

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	112,990,835 - 113,001,051 (+)	Ensembl
Rnor_6.0 Ensembl	7	122,700,854 - 122,709,935 (+)	Ensembl

RefSeq Acc Id:

NM_001034135 ⟹ NP_001029307

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	114,870,979 - 114,881,194 (+)	NCBI
mRatBN7.2	7	112,990,835 - 113,001,051 (+)	NCBI
Rnor_6.0	7	122,700,849 - 122,710,907 (+)	NCBI
Rnor_5.0	7	122,677,395 - 122,687,076 (+)	NCBI
RGSC_v3.4	7	119,794,976 - 119,805,104 (+)	RGD
Celera	7	109,310,166 - 109,320,235 (+)	NCBI

Sequence:

show sequence

CCAAAATGGCGGCGGCGATGGATGTGGATACCCCCAGCGGCACCAACAGCGGCGCGGGCAAGAA
GCGCTTTGAAGTTAAAAAGTGGAATGCAGTAGCCCTCTGGGCCTGGGATATTGTGGTTGATAAC
TGTGCCATCTGCAGGAACCACATTATGGATCTTTGTATCGAGTGTCAGGCCAACCAGGCCTCAG
CTACTTCGGAAGAGTGCACGGTTGCTTGGGGAGTCTGTAACCACGCTTTTCATTTCCACTGCAT
CTCTCGGTGGCTCAAAACCAGGCAGGTGTGCCCCTTGGACAACAGAGAGTGGGAGTTCCAAAAG
TATGGGCATTAGGAAAGACTCTCCCGTAAAGCTTACCCATTTGTTACTCGTTTAGTGACTTCCT
GTTAATTATACATTAGATAGAACCATGGTTCTTTTCCTTTCCTTTGTCTTTGGAGTTTGGTGTT
CCCGCAGCCATACTGTGTTTTGTGTCAAATAAAGCCTTTAAGTTGGAGACGGTTGCTGTTTCAT
GTATGTGGAAAGAGTGAGCTGAGAAGGAGCCTCTTCAGAGCCAGGAAGCCAGCCTCAGAAAGTG
CACTGTTCTTGACGAGAACACACTTGTCTTCACAAGGTCACAAGGAACCTGTTAAAGTCTGCAA
GTGCGGGTCACTGGCACCTGGAAATGCCTGAGGCTCTGTCTTCCTTCTGAGATAGCACCAGGCA
GGAATGAGGAAGCACATGGCAGCCTTGGACCAGCCAGGCCTGCTCTGGGCTCTCACCTCTCCTG
AGGGAGTCTGAGAATGAGTGAATGGCATCAAATGGGCACAGAAAGGCTTTGTAAGCTCTGAACA
CCACAGAGTTGGTGCTGATTGTGGATGACATGTTGCAGTCTCTAGAACAAAACTTGACAAAAAA
ATCATAATATGTAATCTTGGCTGGCAATAGAATGATCTTAAAGTCAACTTGAAAACTGATATTT
GGACAGTTTGAGTATATGCCTGTAATTCCAGGTACTTGGGAATTAGGTAGAAGGATCCTTTGAA
TCCAGGAGACCTTGTTTCTAAATGAGATTCTAGTTTGGGGTCTAGGGGGTGCTGTAGCTCAGCT
GCTGTAAGGCCTTGAGTTCATTTGCTGGTGTGAATTTTTTTTTTTTTTTTAAAAAAGGTCGAAA
TTAAATTAAGTTAACAAGAACTCAGGTTTCCTTTAAACATGCTGGCCAGGAAAGGCGTGGCCAC
CCTGATGCTGATTCAGTGGCTGTAGTCTACTGAGACACTGTTTCTGTTGTTGTGATTTTCATGT
AGTTAACCATCCTACAAAGGTCCTGAAACCCTTCAGGGGAGCTTTCCTCTCTCCGGTGCCATTC
CATGTGTCCAGATAAAGCAGGTCTGAGACTCCCAACCATCTTCTGTTGTCAAGCAGAGAAAGAT
TGCAAAAATGTGAAACAATGCTGTCATTATTCATGTTTCCAAAGTTAATTTTAATAAAAATATT
TATGTTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039078842 ⟹ XP_038934770

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	114,870,893 - 114,881,194 (+)	NCBI
mRatBN7.2	7	112,990,797 - 113,001,051 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001029307	(Get FASTA)	NCBI Sequence Viewer
	XP_038934770	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI00259	(Get FASTA)	NCBI Sequence Viewer
	EDM15720	(Get FASTA)	NCBI Sequence Viewer
	EDM15721	(Get FASTA)	NCBI Sequence Viewer
	EDM15722	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000069049
	ENSRNOP00000069049.2

RefSeq Acc Id:	NP_001029307 ⟸ NM_001034135
- UniProtKB:	Q498D8 (UniProtKB/TrEMBL), A0A0G2JUC8 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASAT SEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH hide sequence

RefSeq Acc Id:

ENSRNOP00000069049 ⟸ ENSRNOT00000086603

RefSeq Acc Id:	XP_038934770 ⟸ XM_039078842
- Peptide Label:	isoform X1

Protein Domains

RING-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q498D8-F1-model_v2	AlphaFold	Q498D8	1-108	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13695511

Promoter ID:

EPDNEW_R6036

Type:

multiple initiation site

Name:

Rbx1_1

Description:

ring-box 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	7	122,700,840 - 122,700,900	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1308453	AgrOrtholog
BioCyc Gene	G2FUF-32677	BioCyc
Ensembl Genes	ENSRNOG00000058914	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000086603	ENTREZGENE
	ENSRNOT00000086603.2	UniProtKB/TrEMBL
Gene3D-CATH	3.30.40.10	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7444286	IMAGE-MGC_LOAD
InterPro	Znf_RING	UniProtKB/TrEMBL
	Znf_RING/FYVE/PHD	UniProtKB/TrEMBL
	Znf_RING_H2	UniProtKB/TrEMBL
KEGG Report	rno:300084	UniProtKB/TrEMBL
MGC_CLONE	MGC:116275	IMAGE-MGC_LOAD
NCBI Gene	300084	ENTREZGENE
PANTHER	E3 UBIQUITIN-PROTEIN LIGASE RBX1-RELATED	UniProtKB/TrEMBL
	RING BOX	UniProtKB/TrEMBL
Pfam	zf-rbx1	UniProtKB/TrEMBL
PhenoGen	Rbx1	PhenoGen
PROSITE	ZF_RING_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000058914	RatGTEx
Superfamily-SCOP	RING/U-box	UniProtKB/TrEMBL
UniProt	A0A0G2JUC8	ENTREZGENE, UniProtKB/TrEMBL
	A6HT00_RAT	UniProtKB/TrEMBL
	A6HT01_RAT	UniProtKB/TrEMBL
	A6HT02_RAT	UniProtKB/TrEMBL
	Q498D8	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-04-13	Rbx1	ring-box 1	Rbx1	ring-box 1, E3 ubiquitin protein ligase	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-05-24	Rbx1	ring-box 1, E3 ubiquitin protein ligase	LOC100363742	ring-box 1-like	Data merged from RGD:2322409	1643240	APPROVED
2012-10-10	Rbx1	ring-box 1, E3 ubiquitin protein ligase	Rbx1	ring-box 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2010-05-06	LOC100363742	ring-box 1-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2005-12-06	Rbx1	ring-box 1	Rbx1_predicted	ring-box 1 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Rbx1_predicted	ring-box 1 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - KEGG (archival)