Advanced Search (OLGA)

Gene: C17h7orf25 (similar to human chromosome 7 open reading frame 25) Rattus norvegicus

Analyze

Symbol:

C17h7orf25

Name:

similar to human chromosome 7 open reading frame 25

RGD ID:

1308147

Description:

Orthologous to human C7orf25 (chromosome 7 open reading frame 25); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A; finasteride.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

hypothetical protein LOC307008; LOC307008; MGC105979; RGD1308147; similar to expressed sequence AW209491; UPF0415 protein C7orf25 homolog

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	C7orf25 (chromosome 7 open reading frame 25)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	AW209491 (expressed sequence AW209491)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	CUNH7orf25 (chromosome unknown C7orf25 homolog)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	C6H7orf25 (chromosome 6 C7orf25 homolog)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	C18H7orf25 (chromosome 18 C7orf25 homolog)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	CUNH7orf25 (chromosome unknown C7orf25 homolog)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	C18H7orf25 (chromosome 18 C7orf25 homolog)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	C21H7orf25 (chromosome 21 C7orf25 homolog)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	CUNH7orf25 (chromosome unknown C7orf25 homolog)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	C14H7orf25 (chromosome 14 C7orf25 homolog)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	TBRG4 (transforming growth factor beta regulator 4)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	C7orf25 (chromosome 7 open reading frame 25)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	AW209491 (expressed sequence AW209491)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	zgc:55781	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	F33G12.3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	F33G12.3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG42553	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	c7orf25	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	55,238,751 - 55,245,399 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	17	55,236,313 - 55,246,284 (-)	Ensembl				GRCr8
mRatBN7.2	17	50,543,231 - 50,549,880 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	50,542,858 - 50,549,976 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	17	53,716,099 - 53,722,777 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	57,719,017 - 57,725,695 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	51,820,131 - 51,826,812 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	53,080,629 - 53,087,335 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	53,080,638 - 53,087,274 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	17	50,780,388 - 50,787,041 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	17	58,724,997 - 58,731,637 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	17	46,575,732 - 46,582,398 (-)	NCBI		Celera
RGSC_v3.1	17	58,727,841 - 58,734,478 (-)	NCBI
Cytogenetic Map	17	q12.1	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2,3,7,8-tetrachlorodibenzodioxine (EXP)

antirheumatic drug (ISO)

atrazine (ISO)

bisphenol A (EXP)

copper(II) sulfate (ISO)

DDE (ISO)

elemental selenium (ISO)

finasteride (EXP)

flutamide (EXP)

formaldehyde (ISO)

gentamycin (EXP)

leflunomide (EXP)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

methylmercury chloride (ISO)

paracetamol (EXP)

S-nitrosoglutathione (ISO)

Salinomycin (ISO)

selenium atom (ISO)

sulindac (EXP)

sunitinib (ISO)

thioacetamide (EXP)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Cellular Component

nucleoplasm (ISO)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
3.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:15489334

Genomics

Comparative Map Data

C17h7orf25
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	55,238,751 - 55,245,399 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	17	55,236,313 - 55,246,284 (-)	Ensembl				GRCr8
mRatBN7.2	17	50,543,231 - 50,549,880 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	50,542,858 - 50,549,976 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	17	53,716,099 - 53,722,777 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	57,719,017 - 57,725,695 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	51,820,131 - 51,826,812 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	53,080,629 - 53,087,335 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	53,080,638 - 53,087,274 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	17	50,780,388 - 50,787,041 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	17	58,724,997 - 58,731,637 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	17	46,575,732 - 46,582,398 (-)	NCBI		Celera
RGSC_v3.1	17	58,727,841 - 58,734,478 (-)	NCBI
Cytogenetic Map	17	q12.1	NCBI

C7orf25
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	42,909,273 - 42,912,070 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	42,908,619 - 42,912,518 (-)	Ensembl			hg38	GRCh38
GRCh37	7	42,948,872 - 42,951,669 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	42,915,397 - 42,918,214 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	7	42,722,113 - 42,724,897	NCBI
Celera	7	42,939,193 - 42,942,010 (-)	NCBI		Celera
Cytogenetic Map	7	p14.1	NCBI
HuRef	7	42,833,689 - 42,836,506 (-)	NCBI		HuRef
CHM1_1	7	42,952,434 - 42,955,251 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	7	43,067,417 - 43,070,214 (-)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	42,988,383 - 42,991,200 (-)	NCBI

AW209491
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	13	14,804,830 - 14,812,787 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	13	14,804,739 - 14,813,681 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	13	14,630,245 - 14,638,202 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	13	14,630,154 - 14,639,096 (+)	Ensembl			mm10	GRCm38
MGSCv37	13	14,722,512 - 14,730,469 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	13	14,422,403 - 14,431,222 (+)	NCBI		MGSCv36	mm8
Celera	13	14,936,524 - 14,944,233 (+)	NCBI		Celera
Cytogenetic Map	13	A1	NCBI
cM Map	13	5.36	NCBI

CUNH7orf25
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955460	894,516 - 898,445 (+)	Ensembl
ChiLan1.0	NW_004955460	895,201 - 897,703 (+)	NCBI	ChiLan1.0	ChiLan1.0

C6H7orf25
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	45,523,432 - 45,526,896 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	93,847,993 - 93,851,639 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	41,324,323 - 41,328,636 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	41,368,264 - 41,371,626 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	41,368,665 - 41,371,626 (+)	Ensembl			panPan2	panpan1.1

C18H7orf25
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	18	7,232,823 - 7,236,830 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	18	7,234,687 - 7,235,952 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	18	7,083,673 - 7,087,747 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	18	7,279,771 - 7,283,856 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	18	7,280,224 - 7,283,854 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	18	7,262,813 - 7,266,876 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	18	7,232,071 - 7,236,142 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	18	7,344,869 - 7,348,942 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

CUNH7orf25
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	98,864,831 - 98,871,901 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936478	18,076,572 - 18,079,310 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936478	18,076,562 - 18,079,316 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

C18H7orf25
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	18	51,924,280 - 51,928,145 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	18	51,924,285 - 51,928,154 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	18	56,949,181 - 56,953,045 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

C21H7orf25
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	21	15,691,880 - 15,694,682 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666062	6,794,059 - 6,797,036 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

CUNH7orf25
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624740	18,246,616 - 18,249,074 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624740	18,246,617 - 18,249,056 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

C14H7orf25
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	14	33,504,661 - 33,506,596 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in C17h7orf25
28 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	273
Count of miRNA genes:	176
Interacting mature miRNAs:	199
Transcripts:	ENSRNOT00000020794
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631497	Bp98	Blood pressure QTL 98	3.66		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	49496932	65155015	Rat
70210	Cm15	Cardiac mass QTL 15	6.5		heart right ventricle mass (VT:0007033)	heart right ventricle wet weight (CMO:0000072)	17	30066472	75066472	Rat
8552966	Pigfal18	Plasma insulin-like growth factor 1 level QTL 18	8.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	17	12860942	57860942	Rat
152023626	Bp403	Blood pressure QTL 403	3.86		arterial blood pressure trait (VT:2000000)		17	24136127	84432719	Rat
2301412	Kidm40	Kidney mass QTL 40		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	17	42388164	87388164	Rat
9590107	Sffal7	Serum free fatty acids level QTL 7	4.81	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	17	33104645	78104645	Rat
2302377	Scl61	Serum cholesterol level QTL 61	4.36		blood HDL cholesterol amount (VT:0000184)	serum high density lipoprotein cholesterol level (CMO:0000361)	17	6221998	58177198	Rat
1354654	Spl7	Serum phospholipid level QTL 7	5.5		blood phospholipid amount (VT:0006084)	blood phospholipid level (CMO:0001169)	17	38031354	83031354	Rat
70157	Niddm32	Non-insulin dependent diabetes mellitus QTL 32	4.34		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	17	22660799	55604694	Rat
9589151	Insul30	Insulin level QTL 30	8.82	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	17	12860942	57860942	Rat
2317038	Ginf3	Gastrointestinal inflammation QTL 3	2.89	0.005	liver integrity trait (VT:0010547)	liver granuloma severity score (CMO:0002157)	17	54829503	93515804	Rat
1598871	Memor5	Memory QTL 5	5.3		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	17	40968017	89341781	Rat
1581512	Cm55	Cardiac mass QTL 55	2.8	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	17	27233445	83975845	Rat
1354629	Scl31	Serum cholesterol level QTL 31	4.1		blood cholesterol amount (VT:0000180)	blood total cholesterol level (CMO:0000051)	17	38031354	83031354	Rat
61394	Bp8	Blood pressure QTL 8	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	23286322	64246472	Rat
9589057	Scfw6	Subcutaneous fat weight QTL 6	8.62	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	17	12860942	57860942	Rat
2317045	Aia11	Adjuvant induced arthritis QTL 11	4.06		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	17	26522051	71522051	Rat
1600398	Edcs5	Endometrial carcinoma susceptibility QTL 5	2.2		uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	17	35446949	75762341	Rat
9590154	Scort9	Serum corticosterone level QTL 9	23.57	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	17	12860942	57860942	Rat
10450503	Bp386	Blood pressure QTL 386		0.28	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	22019705	67019705	Rat
1559055	Bp278	Blood pressure QTL 278		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	23858926	68858926	Rat
152025238	Slep14	Serum leptin concentration QTL 14	4.62		blood leptin amount (VT:0005667)		17	24390595	84432719	Rat
9590088	Insglur7	Insulin/glucose ratio QTL 7	20.38	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	17	12860942	57860942	Rat
1354638	Insul1	Insulin level QTL 1	4.8		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	17	38031354	83031354	Rat
2313854	Bp343	Blood pressure QTL 343	3.9		life span trait (VT:0005372)	age at time of death (CMO:0001193)	17	32199534	55604694	Rat
2317053	Aia25	Adjuvant induced arthritis QTL 25	2.69		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	17	10604694	55604694	Rat
1354635	Bp245	Blood pressure QTL 245	6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	38031354	83031354	Rat
1331765	Hrtrt15	Heart rate QTL 15	4.094		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	17	15537025	60531414	Rat
8552928	Pigfal9	Plasma insulin-like growth factor 1 level QTL 9	9		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	17	33104645	78104645	Rat
7411666	Foco31	Food consumption QTL 31	11.4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	17	12860942	57860942	Rat
12904736	Cm121	Cardiac mass QTL 121		0.043	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	17	42388164	87388164	Rat
1300148	Bp192	Blood pressure QTL 192	3.47		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	17	46050126	91050126	Rat
12903980	Cm120	Cardiac mass QTL 120		0.002	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	17	23858926	68858926	Rat
12903981	Am17	Aortic mass QTL 17		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	17	23858926	68858926	Rat
4889955	Bss93	Bone structure and strength QTL 93	4.4		tibia size trait (VT:0100001)	tibia cortical bone volume to tibia total bone volume ratio (CMO:0001727)	17	27233445	65155015	Rat
4889891	Eae32	Experimental allergic encephalomyelitis QTL 32	4.8	0.0002	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	17	27233445	72233445	Rat
12903982	Kidm70	Kidney mass QTL 70		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	17	23858926	68858926	Rat
12903978	Cm118	Cardiac mass QTL 118		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	17	23858926	68858926	Rat
2324621	Coatc5	Coat color QTL 5			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	17	42654895	87654895	Rat
12903979	Cm119	Cardiac mass QTL 119		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	17	23858926	68858926	Rat
1354619	Bp242	Blood pressure QTL 242	6.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	37687877	82687877	Rat
1300129	Rf25	Renal function QTL 25	3.03		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	17	41062352	86062352	Rat
152023740	Bp406	Blood pressure QTL 406	6.06		arterial blood pressure trait (VT:2000000)		17	24136127	84432719	Rat
1354663	Bvd5	Brain ventricular dilatation QTL 5	3.51	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	17	32199534	86201342	Rat
7488966	Bp370	Blood pressure QTL 370		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	23858926	68858926	Rat
152023737	Bp405	Blood pressure QTL 405	5.06		arterial blood pressure trait (VT:2000000)			24136127	84432719	Rat
152023736	Bp404	Blood pressure QTL 404	3.78		arterial blood pressure trait (VT:2000000)		17	24136127	84432719	Rat
724528	Uae4	Urinary albumin excretion QTL 4	4.9	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	17	36045537	81045537	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	90	59	6	354	190	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001014010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001419483	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001419484	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001419485	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC088171	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC090337	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474030	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000017	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000020794 ⟹ ENSRNOP00000020794

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	17	55,238,356 - 55,245,452 (-)	Ensembl
mRatBN7.2 Ensembl	17	50,542,858 - 50,549,976 (-)	Ensembl
Rnor_6.0 Ensembl	17	53,080,638 - 53,087,274 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000114031 ⟹ ENSRNOP00000088598

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	17	55,238,765 - 55,242,378 (-)	Ensembl
mRatBN7.2 Ensembl	17	50,543,240 - 50,549,884 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000114059 ⟹ ENSRNOP00000096046

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	17	55,238,755 - 55,240,638 (-)	Ensembl
mRatBN7.2 Ensembl	17	50,542,858 - 50,549,976 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000131163 ⟹ ENSRNOP00000100762

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	17	55,236,313 - 55,246,284 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000132301 ⟹ ENSRNOP00000105727

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	17	55,237,301 - 55,245,542 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000153560 ⟹ ENSRNOP00000108374

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	17	55,236,313 - 55,245,542 (-)	Ensembl

RefSeq Acc Id:

NM_001014010 ⟹ NP_001014032

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	55,238,751 - 55,245,399 (-)	NCBI
mRatBN7.2	17	50,543,231 - 50,549,880 (-)	NCBI
Rnor_6.0	17	53,080,634 - 53,087,274 (-)	NCBI
Rnor_5.0	17	50,780,388 - 50,787,041 (-)	NCBI
RGSC_v3.4	17	58,724,997 - 58,731,637 (-)	RGD
Celera	17	46,575,732 - 46,582,398 (-)	RGD

Sequence:

show sequence

GCTCAGCAGAACAAGATATGCCGTCCTTCCACTCCCATCAAACTTCATGGTCTCTCAAAACAAC
AAAAACAAAGCACGCAGAAAACACAGGGACATGCTGTGGATTCTGTAGTCTGAAGAGGTAAAGG
TGTAAACAAGCGTCAGAATCCAGCACACTTCAGGAAGAGCTCAACTGTACAGCATTGTTTAGCT
GTCAGAAGGAAGGAAGGCTCTCCCACAATCCCATACACTGACGCCCAGGTTCATAGTCTTCATA
AACATTGTCGCTAGTGTGGACTTTCGAGTCATCATCCTAACAGTAACAGACATTGACATTTGCC
TTGTTTTTATGAAAGGAATAATGCTGTCAGCATGTCTGCATACTCCATGCTCTCTGAAAGAATT
GCCATGGCCAAGGAACTGATCAAAAGAGCAGAATCACTTTCTCGGTCAAAAAAAGGTGGCATAG
AAGGTGGTGCGAAGCTGTGCAGCAAACTGAAGTCAGAACTGAAATTCTTACAGAAAATAGAGTC
TGGGAAGGTAGCTATTAAGGAGTCCCATTTACAAAGCACGAATCTAACACACTTGAAAGCCATT
GTGGAATCGGCAGAGAACCTGGAAGAAGTTGTTAGTGTTCTTCGTGTCTTTGGTTACACAGATT
CCTTGGGAGAAAAACAGACTCTTGTGGTGGATGTCGTAGCAAATGGAGGTCATACTTGGGTCAA
AGCCATTGGTCGAAAGGCTGAAGCACTGCATAACATCTGGCTAGGCAGGGGCCAGTATGGCGAC
AAAAGCATCATTGAGCAGGCTGAAGATTTCCTCCAGGCCAGTCGACAGCAACCAGTGCAGTATA
GCAACCCTCACATTGTTTTTGCATTTTACAACAGTGTCTCCAGCCCCATGGCAGACAAGCTGAA
AGATATGGGCATATCAGTAAGAGGAGACATCGTCGCGGTCAACTCTCTGTTAAATCACCCCGAA
GAGTATCTGCTGAGCGAGAGTGAGTCAGATGACGAGGGCCAAGAACTTCTGCAGGTGACAAGAG
TGGACCTAGACAATGTACTGGCCCGTGTTGCCTTTCCAACAGAGATCAAGGTTGATGTGTGCAG
AAGAGTAAATCTGGACATTACTACTTTAATCACATATGTGTCTGCCATGAGTTATGGAGGCTGC
CACTTTATCTTCAAAGAAAAAGTACTCACGGAGCAAGCAGAGCAAGAGAGGAAAGAGCGGGTTC
TACCTCAGCTGGAAGCGTTTATGAAGGACAAGGAGTTGTTTGCCTGTGAATCTGCCGTCAAGGA
TTTCCAATCTATTCTAGATACCTTAGGGGGACCAGGAGAGAGAGAGAGAGCTGCTGTACTAATT
AAACGAATCAATGTGGTACCAGACCAACCTTCTGAGCGTGCCTTGAAACTAGTGGCGAGTTCAA
AAATTAATAGCCGTTCCTTAACAATTTTCGGGACAGGAGATACCCTGAAAGCCATCACAATGAC
TGCGAATAGTGGTTTTGTCAGAGCTGCCAACAATCAGGGTGTTAAATTCAGTGTGTTCATTCAT
CAGCCTAGAGCACTTACTGAGAGTAAAGAGGCATTAGCCGTTCCCTTACCAAAAGCCCGAACCA
ATGATAGTGCACACTAATGCTATCCTTTAAGTGTTGTCATGGAAATATGTTATTTATACCAAAG
GCTGGCCTTCCCATCTATATTGGGAGAAAAAAGTTTATAGTAAACATAATATTTAGAACTAAAT
AGAAGTTTTTTGTGTTTCATCTATTTAAGGTCTATAAATTAGAAAAATCCAAGAGACTGTCTTA
TTTATCTGTGTATTACATCACAGACTACATTGTAGCAGGTAAGAACAGAAATACATCTGCATAA
GGCTTTTACTTATCTTGTGATGCATTTGTTTGCCTCAGTAGGGCTTCAGCCTCCACCACAGGTA
ATCACATTTCATGGAATATGGCTACATGATTCTCAAATTCATTAAATATCTGGAGAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

NM_001419483 ⟹ NP_001406412

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	55,238,751 - 55,245,399 (-)	NCBI
mRatBN7.2	17	50,543,231 - 50,549,880 (-)	NCBI

RefSeq Acc Id:

NM_001419484 ⟹ NP_001406413

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	55,238,751 - 55,245,399 (-)	NCBI
mRatBN7.2	17	50,543,231 - 50,549,880 (-)	NCBI

RefSeq Acc Id:

NM_001419485 ⟹ NP_001406414

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	55,238,751 - 55,245,399 (-)	NCBI
mRatBN7.2	17	50,543,231 - 50,549,880 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001014032	(Get FASTA)	NCBI Sequence Viewer
	NP_001406412	(Get FASTA)	NCBI Sequence Viewer
	NP_001406413	(Get FASTA)	NCBI Sequence Viewer
	NP_001406414	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH88171	(Get FASTA)	NCBI Sequence Viewer
	AAH90337	(Get FASTA)	NCBI Sequence Viewer
	EDL87413	(Get FASTA)	NCBI Sequence Viewer
	EDL87414	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000020794.4
	ENSRNOP00000088598
	ENSRNOP00000096046
	ENSRNOP00000096046.1
	ENSRNOP00000105727
	ENSRNOP00000108374
GenBank Protein	Q5M888	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001014032 ⟸ NM_001014010

- UniProtKB:

Q5M888 (UniProtKB/Swiss-Prot), A6K9C0 (UniProtKB/TrEMBL), A0A8I6AA39 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSAYSMLSERIAMAKELIKRAESLSRSKKGGIEGGAKLCSKLKSELKFLQKIESGKVAIKESHL
QSTNLTHLKAIVESAENLEEVVSVLRVFGYTDSLGEKQTLVVDVVANGGHTWVKAIGRKAEALH
NIWLGRGQYGDKSIIEQAEDFLQASRQQPVQYSNPHIVFAFYNSVSSPMADKLKDMGISVRGDI
VAVNSLLNHPEEYLLSESESDDEGQELLQVTRVDLDNVLARVAFPTEIKVDVCRRVNLDITTLI
TYVSAMSYGGCHFIFKEKVLTEQAEQERKERVLPQLEAFMKDKELFACESAVKDFQSILDTLGG
PGERERAAVLIKRINVVPDQPSERALKLVASSKINSRSLTIFGTGDTLKAITMTANSGFVRAAN
NQGVKFSVFIHQPRALTESKEALAVPLPKARTNDSAH

hide sequence

Ensembl Acc Id:

ENSRNOP00000020794 ⟸ ENSRNOT00000020794

Ensembl Acc Id:

ENSRNOP00000096046 ⟸ ENSRNOT00000114059

Ensembl Acc Id:

ENSRNOP00000088598 ⟸ ENSRNOT00000114031

RefSeq Acc Id:	NP_001406414 ⟸ NM_001419485
- UniProtKB:	Q5M888 (UniProtKB/Swiss-Prot), A0A8I6AA39 (UniProtKB/TrEMBL), A6K9C0 (UniProtKB/TrEMBL)

RefSeq Acc Id:	NP_001406413 ⟸ NM_001419484
- UniProtKB:	Q5M888 (UniProtKB/Swiss-Prot), A0A8I6AA39 (UniProtKB/TrEMBL), A6K9C0 (UniProtKB/TrEMBL)

RefSeq Acc Id:	NP_001406412 ⟸ NM_001419483
- UniProtKB:	Q5M888 (UniProtKB/Swiss-Prot), A0A8I6AA39 (UniProtKB/TrEMBL), A6K9C0 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000105727 ⟸ ENSRNOT00000132301

Ensembl Acc Id:

ENSRNOP00000100762 ⟸ ENSRNOT00000131163

Ensembl Acc Id:

ENSRNOP00000108374 ⟸ ENSRNOT00000153560

Protein Domains

DUF1308 DUF5614

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5M888-F1-model_v2	AlphaFold	Q5M888	1-421	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13700513

Promoter ID:

EPDNEW_R11036

Type:

multiple initiation site

Name:

RGD1308147_1

Description:

similar to expressed sequence AW209491

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	17	53,087,282 - 53,087,342	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1308147	AgrOrtholog
BioCyc Gene	G2FUF-9071	BioCyc
Ensembl Genes	ENSRNOG00000015523	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000020794.6	UniProtKB/Swiss-Prot
	ENSRNOT00000114031	ENTREZGENE
	ENSRNOT00000114059	ENTREZGENE
	ENSRNOT00000114059.1	UniProtKB/Swiss-Prot
	ENSRNOT00000132301	ENTREZGENE
	ENSRNOT00000153560	ENTREZGENE
IMAGE_CLONE	IMAGE:7302860	IMAGE-MGC_LOAD
	IMAGE:7322765	IMAGE-MGC_LOAD
InterPro	DUF1308	UniProtKB/Swiss-Prot
	DUF5614	UniProtKB/Swiss-Prot
KEGG Report	rno:307008	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:105979	IMAGE-MGC_LOAD
	MGC:108798	IMAGE-MGC_LOAD
NCBI Gene	307008	ENTREZGENE
PANTHER	UNCHARACTERIZED DUF1308	UniProtKB/Swiss-Prot
	UPF0415 PROTEIN C7ORF25	UniProtKB/Swiss-Prot
Pfam	DUF1308	UniProtKB/Swiss-Prot
	DUF5614	UniProtKB/Swiss-Prot
PhenoGen	C17h7orf25	PhenoGen
RatGTEx	ENSRNOG00000015523	RatGTEx
UniProt	A0A8I6AA39	ENTREZGENE, UniProtKB/TrEMBL
	A6K9C0	ENTREZGENE, UniProtKB/TrEMBL
	CG025_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2023-09-19	C17h7orf25	similar to human chromosome 7 open reading frame 25	RGD1308147	similar to expressed sequence AW209491	Symbol and Name Changed	1299863	APPROVED
2005-12-06	RGD1308147	similar to expressed sequence AW209491	RGD1308147_predicted	similar to expressed sequence AW209491 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1308147_predicted	similar to expressed sequence AW209491 (predicted)	LOC307008_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC307008_predicted	similar to expressed sequence AW209491 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message