Advanced Search (OLGA)

Gene: Wdr73 (WD repeat domain 73) Rattus norvegicus

Analyze

Symbol:

Wdr73

Name:

WD repeat domain 73

RGD ID:

1306429

Description:

Predicted to enable protein-macromolecule adaptor activity. Predicted to be involved in cytoplasmic microtubule organization and nucleus organization. Predicted to be located in cleavage furrow. Predicted to be active in cytoplasm. Predicted to colocalize with cytosol and spindle pole. Human ortholog(s) of this gene implicated in Galloway-Mowat syndrome 1. Orthologous to human WDR73 (WD repeat domain 73); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A; dibutyl phthalate.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC308751; neuromedin B; Nmb; WD repeat-containing protein 73

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	WDR73 (WD repeat domain 73)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Wdr73 (WD repeat domain 73)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Wdr73 (WD repeat domain 73)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	WDR73 (WD repeat domain 73)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	WDR73 (WD repeat domain 73)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Wdr73 (WD repeat domain 73)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	WDR73 (WD repeat domain 73)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	WDR73 (WD repeat domain 73)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Wdr73 (WD repeat domain 73)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Wdr73 (WD repeat domain 73)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	AKAP1 (A-kinase anchoring protein 1)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	WDR73 (WD repeat domain 73)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Wdr73 (WD repeat domain 73)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	wdr73 (WD repeat domain 73)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	wdr73	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	wdr73	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	144,269,561 - 144,277,707 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	144,269,562 - 144,277,840 (-)	Ensembl				GRCr8
mRatBN7.2	1	134,860,329 - 134,868,475 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	134,860,180 - 134,868,479 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	142,775,188 - 142,783,352 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	149,944,606 - 149,952,770 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	142,857,740 - 142,865,908 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	142,711,955 - 142,720,292 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	142,711,789 - 142,720,257 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	143,663,956 - 143,672,463 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	137,088,347 - 137,096,492 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	126,913,330 - 126,921,487 (-)	NCBI		Celera
RGSC_v3.1	1	137,166,589 - 137,174,851 (-)	NCBI
Cytogenetic Map	1	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

dystonia (ISO)

epilepsy (ISO)

Galloway-Mowat syndrome (ISO)

Galloway-Mowat syndrome 1 (ISO)

genetic disease (ISO)

nephrotic syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

3,4-methylenedioxymethamphetamine (ISO)

aflatoxin B1 (ISO)

antirheumatic drug (ISO)

atrazine (ISO)

beta-lapachone (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbamazepine (ISO)

carbon nanotube (ISO)

chlorpyrifos (ISO)

clofibrate (ISO)

cobalt dichloride (ISO)

copper(II) sulfate (ISO)

dibenzo[a,l]pyrene (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP,ISO)

dichloroacetic acid (ISO)

doxorubicin (ISO)

epoxiconazole (ISO)

folic acid (ISO)

gentamycin (EXP)

GSK-J4 (ISO)

indole-3-methanol (EXP)

ivermectin (ISO)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

pirinixic acid (ISO)

resveratrol (ISO)

rotenone (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

tacrolimus hydrate (ISO)

testosterone (EXP)

thioacetamide (EXP)

thiram (ISO)

triptonide (ISO)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cytoplasmic microtubule organization (IBA,ISO)

nucleus organization (ISO)

Cellular Component

cleavage furrow (ISO)

cytoplasm (ISO)

cytosol (IBA,ISO)

spindle pole (IBA,ISO)

Molecular Function

protein binding (ISO)

protein-macromolecule adaptor activity (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:25466283

Genomics

Comparative Map Data

Wdr73
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	144,269,561 - 144,277,707 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	144,269,562 - 144,277,840 (-)	Ensembl				GRCr8
mRatBN7.2	1	134,860,329 - 134,868,475 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	134,860,180 - 134,868,479 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	142,775,188 - 142,783,352 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	149,944,606 - 149,952,770 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	142,857,740 - 142,865,908 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	142,711,955 - 142,720,292 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	142,711,789 - 142,720,257 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	143,663,956 - 143,672,463 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	137,088,347 - 137,096,492 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	126,913,330 - 126,921,487 (-)	NCBI		Celera
RGSC_v3.1	1	137,166,589 - 137,174,851 (-)	NCBI
Cytogenetic Map	1	q31	NCBI

WDR73
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	15	84,639,285 - 84,654,283 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	15	84,639,285 - 84,654,343 (-)	Ensembl			hg38	GRCh38
GRCh37	15	85,182,516 - 85,197,514 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	15	82,987,003 - 82,998,525 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	15	61,611,526 - 61,623,048 (-)	NCBI		Celera
Cytogenetic Map	15	q25.2	NCBI
HuRef	15	61,271,897 - 61,283,419 (-)	NCBI		HuRef
CHM1_1	15	85,027,130 - 85,038,652 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	15	82,391,705 - 82,406,696 (-)	NCBI		T2T-CHM13v2.0

Wdr73
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	80,540,471 - 80,551,017 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	80,540,471 - 80,551,017 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	7	80,890,723 - 80,901,269 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	80,890,723 - 80,901,269 (-)	Ensembl			mm10	GRCm38
MGSCv37	7	88,035,609 - 88,046,155 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	7	80,764,236 - 80,774,782 (-)	NCBI		MGSCv36	mm8
Celera	7	78,299,308 - 78,309,859 (-)	NCBI		Celera
Cytogenetic Map	7	D3	NCBI
cM Map	7	45.71	NCBI

Wdr73
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955416	14,471,421 - 14,485,201 (+)	Ensembl
ChiLan1.0	NW_004955416	14,471,479 - 14,485,416 (+)	NCBI	ChiLan1.0	ChiLan1.0

WDR73
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	16	73,595,848 - 73,610,909 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	15	77,814,222 - 77,827,073 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	15	63,310,497 - 63,322,064 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	15	82,633,080 - 82,645,833 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	15	82,633,080 - 82,645,833 (-)	Ensembl			panPan2	panpan1.1

WDR73
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	3	53,914,048 - 53,927,130 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	3	53,914,619 - 53,927,034 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	3	56,554,244 - 56,566,623 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	3	54,334,301 - 54,347,044 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	3	54,333,081 - 54,347,015 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	3	53,853,220 - 53,865,388 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	3	54,062,528 - 54,074,696 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	3	54,404,026 - 54,416,202 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Wdr73
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	129,622,977 - 129,635,697 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936483	16,697,086 - 16,711,518 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936483	16,698,878 - 16,711,510 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

WDR73
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	52,887,530 - 52,904,146 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	7	52,887,468 - 52,904,147 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

WDR73
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	29	3,707,254 - 3,718,600 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	29	3,707,299 - 3,719,614 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666059	43,342,731 - 43,354,069 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Wdr73
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624768	17,889,907 - 17,901,673 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624768	17,866,043 - 17,902,282 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Wdr73
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	2	119,336,219 - 119,344,395 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Wdr73
80 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	48
Count of miRNA genes:	37
Interacting mature miRNAs:	46
Transcripts:	ENSRNOT00000032294
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61442	Strs1	Sensitivity to stroke QTL 1	7.4		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	1	131179947	176179947	Rat
1578780	Cm52	Cardiac mass QTL 52	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	1	137611478	182611478	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	51940904	168768703	Rat
1554320	Bmd1	Bone mineral density QTL 1	12.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	101228864	146228864	Rat
1598866	Bp287	Blood pressure QTL 287	5.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	130419227	175419227	Rat
1578770	Stresp23	Stress response QTL 23			kidney sympathetic nerve activity (VT:0004050)	stimulated renal sympathetic nerve activity to basal renal sympathetic nerve activity ratio (CMO:0001786)	1	132760429	191848948	Rat
631684	Bp117	Blood pressure QTL 117	8.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	120082258	165082258	Rat
9590300	Scort16	Serum corticosterone level QTL 16	4.39	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	1	112521556	157521556	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	66009857	160501508	Rat
631199	Cm23	Cardiac mass QTL 23	4.6	0.0004	heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	142582336	182383862	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	51511344	153680016	Rat
1598850	Bp297	Blood pressure QTL 297	2.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	130419227	175419227	Rat
631570	Bp94	Blood pressure QTL 94		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	132889797	152403053	Rat
152025235	Bw194	Body weight QTL 194	4.86		body mass (VT:0001259)		1	132966869	252856240	Rat
61341	Bp26	Blood pressure QTL 26			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	139442053	223964440	Rat
152025232	Bw192	Body weight QTL 192	3.93		body mass (VT:0001259)		1	127329268	206393015	Rat
724521	Uae1	Urinary albumin excretion QTL 1	3.8	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	99645382	182701046	Rat
1358902	Bw47	Body weight QTL 47	1.67		body mass (VT:0001259)	body weight (CMO:0000012)	1	99645382	221502378	Rat
61346	Rf2	Renal disease susceptibility QTL 2	3.7		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	1	142582180	153680016	Rat
8655649	Arrd1	Age-related retinal degeneration QTL 1	4.89		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	109493780	193400781	Rat
2317833	Alcrsp19	Alcohol response QTL 19	12.4	0.001	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	1	110389869	155389869	Rat
1300153	Bp171	Blood pressure QTL 171	3.37		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	124975316	152612788	Rat
631202	Gluco13	Glucose level QTL 13		0.0001	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	141173126	169168317	Rat
731168	Bp154	Blood pressure QTL 154	3.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	103779152	223964440	Rat
631205	Bp196	Blood pressure QTL 196	4	0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	98879955	208479939	Rat
631206	Niddm40	Non-insulin dependent diabetes mellitus QTL 40			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	140833106	185833106	Rat
1641897	Alcrsp1	Alcohol response QTL 1			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	1	110389869	155389869	Rat
1331751	Bp199	Blood pressure QTL 199	3.60022		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	116099376	191260518	Rat
2293142	Bp314	Blood pressure QTL 314			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	101594089	146594089	Rat
2293140	Bp313	Blood pressure QTL 313			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	131243790	176243790	Rat
724529	Cm16	Cardiac mass QTL 16	2.7		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	1	96717367	160111531	Rat
737974	Bp161	Blood pressure QTL 161		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	129182274	174182274	Rat
1641895	Bp298	Blood pressure QTL 298			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	132760429	191848948	Rat
631496	Bp97	Blood pressure QTL 97	3.08		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	115183611	176289080	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	51941022	208479811	Rat
1331793	Bp200	Blood pressure QTL 200	3.71601		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	102780511	182384005	Rat
6893347	Bw98	Body weight QTL 98	0.2	0.53	body mass (VT:0001259)	body weight (CMO:0000012)	1	143092939	188092939	Rat
1354591	Cm36	Cardiac mass QTL 36	4.1		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	111949780	210707719	Rat
7421630	Bp362	Blood pressure QTL 362		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	128019551	173019551	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34184556	172281316	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34565911	208798288	Rat
631519	Pia11	Pristane induced arthritis QTL 11	5.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	93903998	191260518	Rat
61399	Tcat1	Tongue tumor resistance QTL 1	3.3		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 5 mm (CMO:0001879)	1	108680016	153680016	Rat
6893361	Bw104	Body weight QTL 104	0.59	0.27	body mass (VT:0001259)	body weight (CMO:0000012)	1	143092939	188092939	Rat
724562	Rends1	Renal damage susceptibility QTL 1		0.05	kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	1	139442053	223964440	Rat
724567	Tcas6	Tongue tumor susceptibility QTL 6	6.85		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	1	102359314	153680016	Rat
738006	Anxrr14	Anxiety related response QTL 14	4	0.00035	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	140048073	185048073	Rat
1558645	Bw55	Body weight QTL 55	3.2	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	1	143092939	188092939	Rat
1354615	Cm32	Cardiac mass QTL 32	5.2		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	111949780	210707719	Rat
634348	Bp138	Blood pressure QTL 138			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	135021436	178317588	Rat
8694370	Bw154	Body weight QTL 154	8.91	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	1	112521556	157521556	Rat
738028	Anxrr12	Anxiety related response QTL 12	4.9	0.00001	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	140048073	185048073	Rat
1354623	Rf46	Renal function QTL 46	3.8		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	1	111949780	160574007	Rat
631654	Bp107	Blood pressure QTL 107			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	135021436	180021436	Rat
631544	Bp84	Blood pressure QTL 84	5.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	132760429	191190115	Rat
152025212	Bw190	Body weight QTL 190	5.7		body mass (VT:0001259)		1	132966869	206393015	Rat
631549	Bp89	Blood pressure QTL 89	5.7		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	132760429	152404087	Rat
631548	Bp88	Blood pressure QTL 88	5	0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	140915717	185915717	Rat
61433	Cia2	Collagen induced arthritis QTL 2	5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	100345976	145345976	Rat
1358189	Cstrr1	Cold stress response QTL 1		0.0001	catecholamine amount (VT:0010543)	urine norepinephrine level (CMO:0001629)	1	132760429	191848948	Rat
1354606	Bp246	Blood pressure QTL 246	3.6		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	111949780	228180370	Rat

Markers in Region

BE110895

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	134,867,892 - 134,868,093 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	142,719,710 - 142,719,910	NCBI	Rnor6.0
Rnor_5.0	1	143,671,881 - 143,672,081	UniSTS	Rnor5.0
RGSC_v3.4	1	137,095,910 - 137,096,110	UniSTS	RGSC3.4
Celera	1	126,920,905 - 126,921,105	UniSTS
RH 3.4 Map	1	1081.1	UniSTS
Cytogenetic Map	1	q31	UniSTS

BI286576

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	134,860,488 - 134,860,675 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	142,712,115 - 142,712,301	NCBI	Rnor6.0
Rnor_5.0	1	143,664,286 - 143,664,472	UniSTS	Rnor5.0
RGSC_v3.4	1	137,088,507 - 137,088,693	UniSTS	RGSC3.4
Celera	1	126,913,490 - 126,913,676	UniSTS
RH 3.4 Map	1	1080.9	UniSTS
Cytogenetic Map	1	q31	UniSTS

BE120163

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	134,860,171 - 134,860,333 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	142,711,798 - 142,711,959	NCBI	Rnor6.0
Rnor_5.0	1	143,663,969 - 143,664,130	UniSTS	Rnor5.0
RGSC_v3.4	1	137,088,190 - 137,088,351	UniSTS	RGSC3.4
Celera	1	126,913,173 - 126,913,334	UniSTS
RH 3.4 Map	1	1080.4	UniSTS
Cytogenetic Map	1	q31	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	160	91	90	59	90	59	6	354	190	11	139	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001107525	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC158658	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473980	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000032294 ⟹ ENSRNOP00000029102

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	144,269,562 - 144,277,840 (-)	Ensembl
mRatBN7.2 Ensembl	1	134,860,180 - 134,868,479 (-)	Ensembl
Rnor_6.0 Ensembl	1	142,711,789 - 142,720,257 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000157461 ⟹ ENSRNOP00000098849

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	144,269,562 - 144,277,460 (-)	Ensembl

RefSeq Acc Id:

NM_001107525 ⟹ NP_001100995

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	144,269,561 - 144,277,707 (-)	NCBI
mRatBN7.2	1	134,860,329 - 134,868,475 (-)	NCBI
Rnor_6.0	1	142,711,955 - 142,720,292 (-)	NCBI
Rnor_5.0	1	143,663,956 - 143,672,463 (-)	NCBI
RGSC_v3.4	1	137,088,347 - 137,096,492 (-)	RGD
Celera	1	126,913,330 - 126,921,487 (-)	RGD

Sequence:

show sequence

CAGGAAGTCTGGCTGGCGGAAGTGAAGCGACGGAAGCCACAGTTGCTATGGAGCTCGCAGAGGA
CTGGCTCGTGGAGTCTTTGCGCTTGTACCAAGACTTCCATGCATTTGACCTCTCAGGAGCCACT
CGAGTTCTTGAATGGGTTGGTGAAAAAGGAGTCTTTGTTGCTGGTTATGAAAGTTTGAAAAAAA
ATGAGATTCTTCATTTGATTCTACCTCTAAGACTCTCTGTAAAGGAAAACCAGGGCTTATACCC
AGAGAGGGACTTCAAAGTACGCCACGGAGGATTCTCAGACAGAGCTGTCTTTGACCTAAAGCAC
GTGCCAGATACCAGGTTGCTGGTGACCAGTGGGCTTCCAGGGTGTTACATACAAGTGTGGCAAA
TTAGAGAAGACAACGATGTCATTGAAGCTGTCAGTACCATTGATGTGCAGGACAAAGAGGAGAG
TCTCTGGCCTCGGGTCTCTATCTTCTGCTCTGCGGCGCCTGGGATCCTCCATGGGGCGCGGCTC
AGCGGCCTGAGGACTGTGGATGTAGAATCCCGGAAGATCACATACAGCTCAGATACAACCGACA
GTGAGTCCCTGAGCAGCCTTCAAGTCCTAGATGCAGATACCTTTGCTTTCTGTGGCACCTCAGG
TCGCCTGGGGCTTGTGGACACCCGCCAGAAGTGGGCGCCATTGGAGACTGTCAGCCCCCGCGCT
GGCTCTAGTGGAGAGAGATGGTGTGCAGAAGTTAGGAGCAAGGGCCAAGGCCCTGGGCCCTGCA
TTGCCAGCCTTGGCTCAGATGGGCAGCTCTGTCTCCTTGACCCCCGGAATCTCCGTGATCCTGT
GAGCTCAGCCCAGTGCCCAGTGTTCAAGTCCAGCCCTGACCCAGAGCTGCTGCGGGTGACCTGG
GCTCCAGGCCTGGACAACTGCTTGGCTATTTCAGGCTTTGATGGGACGGTGCAAATCTATGATG
TCACATCATGGGATGGAAAGAAAACCCAGGTGGAGGCTCTTTTCATCCACAAAGGCCACATCTT
CCTGGATGGGAATGAGGTCGAGTCTGCTCCTCTGGTCACCACCCATACCTGGCACCCAAGCAAA
CCCAGAACTTTGCTGTCAGCAGCAAGCGATGCCGCTCTGCATGTGTGGGACTGGGTTGACCTCC
AGGCCTCCTGACAGCAGCAGCTTCTCTCATCTGACAAGAGGAGCTGCCTGAGAGGCTGATGAGG
ACTCTGAGTGACCACAGGTCTACCACAGCCATTGGCTTCAGGCAAGCTAGCCTGGCCTTCCGTT
GTTCTTATCTGTAAAATGAAGGTGTAGTAACTACCACCTAGTACTGTGGGGAGCGTCACAAGAA
AATTACCTGAGAATAATGGCATAAATGTCTGGAAGCGAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001100995	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI58659	(Get FASTA)	NCBI Sequence Viewer
	EDM08660	(Get FASTA)	NCBI Sequence Viewer
	EDM08661	(Get FASTA)	NCBI Sequence Viewer
	EDM08662	(Get FASTA)	NCBI Sequence Viewer
	EDM08663	(Get FASTA)	NCBI Sequence Viewer
	EDM08664	(Get FASTA)	NCBI Sequence Viewer
	EDM08665	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000029102
	ENSRNOP00000029102.5
	ENSRNOP00000098849.1

RefSeq Acc Id:

NP_001100995 ⟸ NM_001107525

- UniProtKB:

B0BN27 (UniProtKB/TrEMBL), F7EST6 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MELAEDWLVESLRLYQDFHAFDLSGATRVLEWVGEKGVFVAGYESLKKNEILHLILPLRLSVKE
NQGLYPERDFKVRHGGFSDRAVFDLKHVPDTRLLVTSGLPGCYIQVWQIREDNDVIEAVSTIDV
QDKEESLWPRVSIFCSAAPGILHGARLSGLRTVDVESRKITYSSDTTDSESLSSLQVLDADTFA
FCGTSGRLGLVDTRQKWAPLETVSPRAGSSGERWCAEVRSKGQGPGPCIASLGSDGQLCLLDPR
NLRDPVSSAQCPVFKSSPDPELLRVTWAPGLDNCLAISGFDGTVQIYDVTSWDGKKTQVEALFI
HKGHIFLDGNEVESAPLVTTHTWHPSKPRTLLSAASDAALHVWDWVDLQAS

hide sequence

Ensembl Acc Id:

ENSRNOP00000029102 ⟸ ENSRNOT00000032294

Ensembl Acc Id:

ENSRNOP00000098849 ⟸ ENSRNOT00000157461

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B0BN27-F1-model_v2	AlphaFold	B0BN27	1-371	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13690150

Promoter ID:

EPDNEW_R674

Type:

single initiation site

Name:

Wdr73_1

Description:

WD repeat domain 73

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	142,720,254 - 142,720,314	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1306429	AgrOrtholog
BioCyc Gene	G2FUF-58722	BioCyc
Ensembl Genes	ENSRNOG00000010664	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000032294	ENTREZGENE
	ENSRNOT00000032294.6	UniProtKB/TrEMBL
	ENSRNOT00000157461.1	UniProtKB/TrEMBL
Gene3D-CATH	2.130.10.10	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:8369176	IMAGE-MGC_LOAD
InterPro	WD40/YVTN_repeat-like_dom_sf	UniProtKB/TrEMBL
	WD40_repeat	UniProtKB/TrEMBL
	WD40_repeat_dom_sf	UniProtKB/TrEMBL
	Wdr73	UniProtKB/TrEMBL
KEGG Report	rno:308751	UniProtKB/TrEMBL
MGC_CLONE	MGC:187643	IMAGE-MGC_LOAD
NCBI Gene	308751	ENTREZGENE
PANTHER	PTHR46947	UniProtKB/TrEMBL
	WD REPEAT-CONTAINING PROTEIN 73	UniProtKB/TrEMBL
PhenoGen	Wdr73	PhenoGen
RatGTEx	ENSRNOG00000010664	RatGTEx
SMART	WD40	UniProtKB/TrEMBL
Superfamily-SCOP	WD40_like	UniProtKB/TrEMBL
UniProt	A0ABK0LB16_RAT	UniProtKB/TrEMBL
	B0BN27	ENTREZGENE, UniProtKB/TrEMBL
	F7EST6	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	Wdr73	WD repeat domain 73	Wdr73_predicted	WD repeat domain 73 (predicted)	'predicted' is removed	2292626	APPROVED
2007-09-11	Wdr73_predicted	WD repeat domain 73 (predicted)	Nmb_predicted	neuromedin B (predicted)	Symbol and Name updated to reflect Human and Mouse nomenclature	1299863	APPROVED
2005-01-12	Nmb_predicted	neuromedin B (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM