Gnat1 (G protein subunit alpha transducin 1)

Gene: Gnat1 (G protein subunit alpha transducin 1) Rattus norvegicus

Analyze

Symbol:

Gnat1

Name:

G protein subunit alpha transducin 1

RGD ID:

1304683

Description:

Enables GTP binding activity. Involved in detection of chemical stimulus involved in sensory perception of bitter taste; response to light intensity; and rhodopsin mediated signaling pathway. Located in several cellular components, including apical plasma membrane; photoreceptor inner segment; and photoreceptor outer segment. Part of heterotrimeric G-protein complex. Human ortholog(s) of this gene implicated in congenital stationary night blindness 1G; congenital stationary night blindness autosomal dominant 3; and night blindness. Orthologous to human GNAT1 (G protein subunit alpha transducin 1); PARTICIPATES IN visual phototransduction pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

guanine nucleotide binding protein (G protein), alpha transducing 1; guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 1; guanine nucleotide binding protein, alpha transducing 1; guanine nucleotide-binding protein G(t) subunit alpha-1; heterotrimeric guanine nucleotide-binding protein 1f; Hg1f; LOC363143; rod-type transducin alpha subunit

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GNAT1 (G protein subunit alpha transducin 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Gnat1 (G protein subunit alpha transducin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Gnat1 (G protein subunit alpha transducin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GNAT1 (G protein subunit alpha transducin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GNAT1 (G protein subunit alpha transducin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Gnat1 (G protein subunit alpha transducin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GNAT1 (G protein subunit alpha transducin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GNAT1 (G protein subunit alpha transducin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Gnat1 (G protein subunit alpha transducin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	GNAT2 (G protein subunit alpha transducin 2)	HGNC	OrthoDB
Alliance orthologs ³
Homo sapiens (human):	GNAT1 (G protein subunit alpha transducin 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Gnat1 (G protein subunit alpha transducin 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gnat1 (guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	GPA2	Alliance	DIOPT (Ensembl Compara\|OrthoInspector\|PANTHER)
Saccharomyces cerevisiae (baker's yeast):	GPA1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Galphai	Alliance	DIOPT (Ensembl Compara\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	gpa-16	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	gpa-4	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	gnat1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	117,229,575 - 117,234,311 (-)	NCBI		GRCr8
mRatBN7.2	8	108,350,935 - 108,355,671 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	108,350,935 - 108,355,671 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	113,977,879 - 113,982,613 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	112,177,039 - 112,181,773 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	110,019,821 - 110,024,555 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	116,433,302 - 116,438,038 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	116,433,302 - 116,438,038 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	115,788,412 - 115,793,148 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	112,925,418 - 112,930,154 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	112,946,358 - 112,949,575 (-)	NCBI
Celera	8	107,657,176 - 107,661,912 (-)	NCBI		Celera
Cytogenetic Map	8	q32	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Aicardi-Goutieres Syndrome 1 (ISO)

congenital stationary night blindness (ISO)

congenital stationary night blindness 1G (ISO)

congenital stationary night blindness autosomal dominant 3 (ISO)

developmental and epileptic encephalopathy (ISO)

early infantile epileptic encephalopathy (ISO)

Experimental Diabetes Mellitus (IEP)

fundus dystrophy (ISO)

genetic disease (ISO)

night blindness (ISO)

primary ciliary dyskinesia (ISO)

retinitis pigmentosa (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

1-naphthyl isothiocyanate (EXP)

17beta-estradiol (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-hydroxypropanoic acid (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

amitrole (EXP)

aristolochic acid A (ISO)

atrazine (EXP,ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

bisphenol A (EXP,ISO)

bromobenzene (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

cocaine (EXP)

Cuprizon (EXP)

diazinon (EXP)

dibenz[a,h]anthracene (ISO)

dichloroacetic acid (ISO)

diclofenac (ISO)

dimethylarsinic acid (ISO)

diquat (ISO)

endosulfan (EXP)

fulvestrant (ISO)

furan (EXP,ISO)

gentamycin (EXP)

glafenine (EXP)

Heliotrine (EXP)

inulin (ISO)

lead(0) (ISO)

MeIQx (ISO)

methimazole (EXP)

methotrexate (ISO)

methylarsonic acid (ISO)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

phenobarbital (ISO)

PhIP (ISO)

pirinixic acid (ISO)

Platyphylline (EXP)

rac-lactic acid (ISO)

silicon dioxide (ISO)

sodium arsenate (ISO)

sodium arsenite (EXP,ISO)

sodium dichromate (EXP)

sulfadimethoxine (EXP)

tamoxifen (ISO)

testosterone (ISO)

Theaflavin 3,3'-digallate (ISO)

titanium dioxide (EXP)

trichloroethene (EXP)

triptonide (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adenylate cyclase-modulating G protein-coupled receptor signaling pathway (IBA)

background adaptation (ISO)

cell population proliferation (ISO)

cellular response to electrical stimulus (ISO)

detection of chemical stimulus involved in sensory perception of bitter taste (IDA)

detection of light stimulus (ISO)

detection of light stimulus involved in visual perception (IBA,ISO)

dopamine secretion (ISO)

eye photoreceptor cell development (ISO)

G protein-coupled receptor signaling pathway (ISO)

neural tissue regeneration (ISO)

phototransduction (ISO)

phototransduction, visible light (IBA,ISO)

positive regulation of cyclic-nucleotide phosphodiesterase activity (IDA)

response to light intensity (IDA,ISO)

response to light stimulus (ISO)

response to organic cyclic compound (ISO)

retina development in camera-type eye (ISO)

retinal cone cell differentiation (ISO)

retinal rod cell differentiation (ISO)

rhodopsin mediated signaling pathway (IMP)

sensory perception of umami taste (ISO)

visual behavior (ISO)

visual perception (ISO)

Cellular Component

apical plasma membrane (IDA)

cytoplasm (IBA)

heterotrimeric G-protein complex (IBA,IDA)

neuronal cell body (IDA)

photoreceptor connecting cilium (ISO)

photoreceptor inner segment (IDA,ISO)

photoreceptor outer segment (IDA,ISO)

Molecular Function

G protein-coupled receptor binding (IBA)

G-protein beta/gamma-subunit complex binding (IBA,ISO)

GTP binding (IDA)

GTPase activity (IBA,ISO)

protein binding (IPI,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

visual phototransduction pathway (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Photoreceptor signaling: supporting vision across a wide range of light intensities.	Arshavsky VY and Burns ME, J Biol Chem. 2012 Jan 13;287(3):1620-6. Epub 2011 Nov 10.
2.	Interaction of glyceraldehyde-3-phosphate dehydrogenase in the light-induced rod alpha-transducin translocation.	Chen J, etal., J Neurochem. 2008 Mar;104(5):1280-92. Epub 2007 Nov 17.
3.	Missense mutation in the gene encoding the alpha subunit of rod transducin in the Nougaret form of congenital stationary night blindness.	Dryja TP, etal., Nat Genet. 1996 Jul;13(3):358-60.
4.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
6.	Changes in rhodopsin kinase and transducin in the rat retina in early-stage diabetes.	Kim YH, etal., Exp Eye Res. 2005 Jun;80(6):753-60.
7.	Sweet taste receptors in rat small intestine stimulate glucose absorption through apical GLUT2.	Mace OJ, etal., J Physiol. 2007 Jul 1;582(Pt 1):379-92. Epub 2007 May 10.
8.	Molecular cloning of G proteins and phosphodiesterases from rat taste cells.	McLaughlin SK, etal., Physiol Behav. 1994 Dec;56(6):1157-64.
9.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
10.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
11.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
12.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
13.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
14.	Coupling of bitter receptor to phosphodiesterase through transducin in taste receptor cells.	Ruiz-Avila L, etal., Nature. 1995 Jul 6;376(6535):80-5.
15.	Photoreceptor function of retinal transplants implicated by light-dark shift of S-antigen and rod transducin.	Seiler MJ, etal., Vision Res. 1999 Jul;39(15):2589-96.
16.	Massive light-driven translocation of transducin between the two major compartments of rod cells: a novel mechanism of light adaptation.	Sokolov M, etal., Neuron. 2002 Mar 28;34(1):95-106.

Additional References at PubMed

PMID:2534964	PMID:11095744	PMID:11853756	PMID:14712229	PMID:15073279	PMID:15342734	PMID:16249514	PMID:16603466	PMID:17584859	PMID:17881533	PMID:18171936	PMID:18367617
PMID:20592197	PMID:21052544	PMID:31696965

Genomics

Comparative Map Data

Gnat1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	117,229,575 - 117,234,311 (-)	NCBI		GRCr8
mRatBN7.2	8	108,350,935 - 108,355,671 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	108,350,935 - 108,355,671 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	113,977,879 - 113,982,613 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	112,177,039 - 112,181,773 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	110,019,821 - 110,024,555 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	116,433,302 - 116,438,038 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	116,433,302 - 116,438,038 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	115,788,412 - 115,793,148 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	112,925,418 - 112,930,154 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	112,946,358 - 112,949,575 (-)	NCBI
Celera	8	107,657,176 - 107,661,912 (-)	NCBI		Celera
Cytogenetic Map	8	q32	NCBI

GNAT1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	50,191,610 - 50,197,696 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	50,191,610 - 50,197,696 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	3	50,229,043 - 50,235,129 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	50,204,047 - 50,208,953 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	3	50,204,046 - 50,208,953	NCBI
Celera	3	50,201,873 - 50,207,959 (+)	NCBI		Celera
Cytogenetic Map	3	p21.31	NCBI
HuRef	3	50,284,730 - 50,290,816 (+)	NCBI		HuRef
CHM1_1	3	50,181,318 - 50,187,404 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	3	50,220,942 - 50,227,028 (+)	NCBI		T2T-CHM13v2.0

Gnat1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	107,551,636 - 107,556,833 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	107,551,673 - 107,556,911 (-)	Ensembl		GRCm39 Ensembl
GRCm38	9	107,674,437 - 107,679,634 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	107,674,474 - 107,679,712 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	107,576,805 - 107,581,923 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	9	107,532,575 - 107,537,693 (-)	NCBI		MGSCv36	mm8
Celera	9	107,280,328 - 107,285,236 (-)	NCBI		Celera
Cytogenetic Map	9	F1	NCBI
cM Map	9	58.86	NCBI

Gnat1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955532	2,018,850 - 2,023,603 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955532	2,018,850 - 2,023,603 (+)	NCBI	ChiLan1.0	ChiLan1.0

GNAT1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	50,173,527 - 50,184,173 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	50,176,906 - 50,188,922 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	50,119,267 - 50,126,131 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	51,354,472 - 51,360,568 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	51,354,472 - 51,360,568 (+)	Ensembl	panpan1.1		panPan2

GNAT1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	39,128,244 - 39,133,280 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	39,128,244 - 39,133,280 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	39,049,301 - 39,054,337 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	39,484,539 - 39,489,576 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	39,484,539 - 39,489,576 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	38,852,095 - 38,857,127 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	39,256,217 - 39,261,236 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	39,535,935 - 39,540,969 (-)	NCBI		UU_Cfam_GSD_1.0

Gnat1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	64,974,791 - 64,978,295 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936529	1,735,440 - 1,742,567 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936529	1,735,258 - 1,740,297 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GNAT1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	32,671,432 - 32,678,391 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	32,671,377 - 32,678,394 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	35,849,946 - 35,856,994 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GNAT1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	22	11,577,192 - 11,582,789 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	22	11,577,997 - 11,581,223 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666041	155,402,786 - 155,409,001 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gnat1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624730	4,066,222 - 4,071,316 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624730	4,064,982 - 4,072,172 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Gnat1
19 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	421
Count of miRNA genes:	208
Interacting mature miRNAs:	247
Transcripts:	ENSRNOT00000023791
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1581557	Eae16	Experimental allergic encephalomyelitis QTL 16	3.8		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	8	8462195	110921472	Rat
631650	Stl6	Serum triglyceride level QTL 6	4	0.0019	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	10378157	112202585	Rat
1554321	Bmd3	Bone mineral density QTL 3	7.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	40952565	123900184	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	46531639	119088626	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	8	46531639	119088626	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	8	46531639	119088626	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	46531639	119088626	Rat
2303171	Bp331	Blood pressure QTL 331	5.57	0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	61290298	119084929	Rat
631653	Bp125	Blood pressure QTL 125	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	66142385	111142385	Rat
631210	Bw3	Body weight QTL3	5.9		mesenteric fat pad mass (VT:0010427)	mesenteric fat pad weight to body weight ratio (CMO:0000654)	8	69349194	112783834	Rat
1300171	Bp184	Blood pressure QTL 184	3.66		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	8	70513503	118219066	Rat
8694446	Bw170	Body weight QTL 170	12.07	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	8	71888757	116888757	Rat
9590292	Uminl3	Urine mineral level QTL 3	3.62	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	8	71888757	116888757	Rat
8694200	Abfw4	Abdominal fat weight QTL 4	9.07	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	8	71888757	116888757	Rat
8694392	Bw161	Body weight QTL 161	8.06	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	8	71888757	116888757	Rat
1549909	Stresp11	Stress response QTL 11	6.83	0.0019	stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	8	73473045	118473045	Rat
2300181	Bmd55	Bone mineral density QTL 55	5.7	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	76468691	121468691	Rat
61437	Cia6	Collagen induced arthritis QTL 6			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	8	82460758	122812818	Rat
2313400	Anxrr25	Anxiety related response QTL 25			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	8	89265192	114019816	Rat
738011	Anxrr9	Anxiety related response QTL 9	6.1		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	8	93535351	123900184	Rat
1358893	Bp263	Blood pressure QTL 263	5.01		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	93965141	123900184	Rat
1358903	Bp252	Blood pressure QTL 252	7	0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	93965141	123900184	Rat
738014	Anxrr15	Anxiety related response QTL 15	3.6	0.005	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	8	95718998	123900184	Rat
2300182	Bmd56	Bone mineral density QTL 56	5.4		femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	95718998	123900184	Rat
724539	Cm19	Cardiac mass QTL 19	2.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	8	100149864	120994388	Rat
631217	Activ1	Activity QTL 1	15.9		voluntary movement trait (VT:0003491)	number of photobeam interruptions in an experimental apparatus (CMO:0001517)	8	102370617	108923645	Rat

Markers in Region

RH137015

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	108,350,968 - 108,351,175 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	116,433,336 - 116,433,542	NCBI	Rnor6.0
Rnor_5.0	8	115,788,446 - 115,788,652	UniSTS	Rnor5.0
RGSC_v3.4	8	112,925,452 - 112,925,658	UniSTS	RGSC3.4
Celera	8	107,657,210 - 107,657,416	UniSTS
RH 3.4 Map	8	1117.4	UniSTS
Cytogenetic Map	8	q32	UniSTS

PMC17675P1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	108,352,589 - 108,353,124 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	116,434,957 - 116,435,491	NCBI	Rnor6.0
Rnor_5.0	8	115,790,067 - 115,790,601	UniSTS	Rnor5.0
RGSC_v3.4	8	112,927,073 - 112,927,607	UniSTS	RGSC3.4
Celera	8	107,658,831 - 107,659,365	UniSTS
Cytogenetic Map	8	q32	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium
Low		2	41	41		41			59	34	31	11
Below cutoff	2	39	13		14		7	9	14	1	6		7

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001108780	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473954	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	OU667094	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000023791 ⟹ ENSRNOP00000023791

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	108,350,935 - 108,355,671 (-)	Ensembl
Rnor_6.0 Ensembl	8	116,433,302 - 116,438,038 (-)	Ensembl

RefSeq Acc Id:

NM_001108780 ⟹ NP_001102250

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	117,229,575 - 117,234,311 (-)	NCBI
mRatBN7.2	8	108,350,935 - 108,355,671 (-)	NCBI
Rnor_6.0	8	116,433,302 - 116,438,038 (-)	NCBI
Rnor_5.0	8	115,788,412 - 115,793,148 (-)	NCBI
RGSC_v3.4	8	112,925,418 - 112,930,154 (-)	RGD
Celera	8	107,657,176 - 107,661,912 (-)	RGD

Sequence:

show sequence

GAAGGTTGTCTGAGGAGGCCAGAGGCTGCCTACCCTGTCCCTTTGCCTGCTGCTGGGACCATGG
GGGCTGGGGCCAGCGCTGAGGAGAAGCACTCCAGAGAGCTGGAAAAGAAGCTGAAAGAAGACGC
TGAGAAGGACGCACGGACCGTGAAGCTGCTGCTTCTGGGTGCGGGTGAATCCGGGAAAAGCACT
ATTGTCAAGCAGATGAAGATTATCCACCAGGACGGGTATTCGCTGGAAGAATGCCTCGAGTTCA
TCGCCATCATCTATGGCAACACTCTGCAGTCCATCCTGGCCATCGTGAGGGCTATGACCACGCT
CAACATTCAGTATGGAGATTCGGCTCGGCAGGACGATGCCCGGAAGCTGATGCACATGGCGGAT
ACTATTGAGGAAGGCACAATGCCCAAGGAGATGTCAGACATCATTCAGCGCCTGTGGAAGGACT
CCGGTATCCAAGCTTGCTTTGACCGAGCCTCAGAATACCAACTCAATGACTCTGCTGGCTACTA
CCTTTCAGACCTAGAGCGTCTGGTGACTCCAGGATACGTGCCCACTGAGCAGGATGTGTTGCGT
TCTCGTGTCAAAACCACTGGTATTATCGAGACTCAATTTTCCTTCAAGGACCTCAACTTCAGAA
TGTTCGATGTGGGCGGGCAGCGTTCTGAGCGCAAAAAGTGGATCCACTGCTTTGAGGGTGTGAC
GTGCATCATTTTCATCGCTGCGCTGAGCGCTTACGACATGGTGCTGGTGGAGGACGACGAAGTG
AACCGAATGCACGAGAGCCTGCACCTGTTCAACAGCATCTGCAATCACCGCTACTTCGCCACGA
CGTCCATCGTGCTCTTCCTCAACAAGAAGGACGTTTTCTCCGAGAAGATAAAAAAGGCACACCT
CAGCATCTGCTTTCCCGATTACGATGGACCTAACACTTACGACGATGCCGGCAACTACATCAAA
GTGCAGTTCCTGGAGCTTAACATGCGACGTGATGTGAAGGAGATCTATTCCCACATGACCTGCG
CTACCGACACACAGAACGTCAAGTTTGTCTTTGACGCCGTCACCGACATTATCATCAAGGAGAA
CCTCAAAGACTGCGGGCTCTTCTGAGATACCTGAATTCATGTCTGCCCCGTACCCTGAGACTCT
GTATCCCTACAGCCCTGTAGTCCCCTTAAATAACGTCTATTCCTCAAGCTGCCTCTCCCATAGC
CGCACACCCAAAGCTCTGAGGCTTGACGTGCAGACCCTCCCCCAAGTACCCAACTCTACCCTGC
TTTTCACCGCCTGGCTGCACTGGCCTCTTGGACCTACGGCAGCCAGCCTCAGCTAGGACTTGGG
ACAGCTGGAGCTCAGAGTGACTCAGCAGTGCCCTAGTGACCCGTCTCCAGCACCATCGGCCACC
CCCATCAGCAGCAGCTCACCAGCAGATCCCGGTTCACCAAACAGCCCTCCCTCCCCAGTTTCCA
CGAAGGGCTTGAGGTCTCCCTCCCTCAAGAAGTAGGCCGGTCCAGCCTGCTGCCTGCATATGAC
AACTCCAACACCTGTCTACCCAGTGGTCAGTGGCTGTCCCTCCCAGTAGCCTGAGGAGTCCAAA
GTCCAAGCTCTGGTCTTTGAAGCCTCGCACAGAGAAATTAGTGACTTTGACTTGGGTGCCAGGA
AAAGATTCAAGCCAAACCCATTCCCAAATACTGGGCTCAGGGTTTCTCCTAGTCCCTTCTCCCT
CTGGGTCTTGCCCCTCTGTCCTTGGACACTTCCACACCACACCTCGTCCACCCACACACAATAC
GCAGGGCTTGCTGGTTAAGGTATGCTGTATCGAAGGACAGTGTTATTGACATAGGGATGACCAA
TAATGAAGCCACACTGAGGGGTGGCTCAGAGCAGAGTCCAGCCCCTATTGATCAACCATGGGTA
AAGAATATCCCGTGTAAGGTTACAGGCAATTCCATGTGACCACGTCGTCCCTTCTGATTCAGGC
CCTATAGCTTGGGAGGGAGGACTGAAAAACCATGCCTAAACCATTAGAGACAATGCCCCACATC
TCCCAGCCACTTCTCCTGCCACCTTTGCTTAAGCCTGCAGACCAGAGACAGTGTTGCTGGTAGA
GGCAAGCTCTCCTTCCCTTAGCTAACTACAGATTCAGCAATAAATCTTTGCACCAGG

hide sequence

Protein Sequences


Protein RefSeqs	NP_001102250	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	CAG9553612	(Get FASTA)	NCBI Sequence Viewer
	EDL77220	(Get FASTA)	NCBI Sequence Viewer
	EDL77223	(Get FASTA)	NCBI Sequence Viewer
	EDL77224	(Get FASTA)	NCBI Sequence Viewer
	EDL77225	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000023791
	ENSRNOP00000023791.5

RefSeq Acc Id:

NP_001102250 ⟸ NM_001108780

- UniProtKB:

D3ZSS5 (UniProtKB/TrEMBL), A6I307 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGAGASAEEKHSRELEKKLKEDAEKDARTVKLLLLGAGESGKSTIVKQMKIIHQDGYSLEECLE
FIAIIYGNTLQSILAIVRAMTTLNIQYGDSARQDDARKLMHMADTIEEGTMPKEMSDIIQRLWK
DSGIQACFDRASEYQLNDSAGYYLSDLERLVTPGYVPTEQDVLRSRVKTTGIIETQFSFKDLNF
RMFDVGGQRSERKKWIHCFEGVTCIIFIAALSAYDMVLVEDDEVNRMHESLHLFNSICNHRYFA
TTSIVLFLNKKDVFSEKIKKAHLSICFPDYDGPNTYDDAGNYIKVQFLELNMRRDVKEIYSHMT
CATDTQNVKFVFDAVTDIIIKENLKDCGLF

hide sequence

RefSeq Acc Id:

ENSRNOP00000023791 ⟸ ENSRNOT00000023791

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZSS5-F1-model_v2	AlphaFold	D3ZSS5	1-350	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1304683	AgrOrtholog
BioCyc Gene	G2FUF-29178	BioCyc
Ensembl Genes	ENSRNOG00000017589	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000023791	ENTREZGENE
	ENSRNOT00000023791.6	UniProtKB/TrEMBL
Gene3D-CATH	1.10.400.10	UniProtKB/TrEMBL
	3.40.50.300	UniProtKB/TrEMBL
InterPro	Gprotein_alpha_I	UniProtKB/TrEMBL
	Gprotein_alpha_su	UniProtKB/TrEMBL
	GproteinA_insert	UniProtKB/TrEMBL
	P-loop_NTPase	UniProtKB/TrEMBL
KEGG Report	rno:363143	UniProtKB/TrEMBL
NCBI Gene	363143	ENTREZGENE
PANTHER	Gprotein_alph_bd	UniProtKB/TrEMBL
	GUANINE NUCLEOTIDE-BINDING PROTEIN G(T) SUBUNIT ALPHA-1	UniProtKB/TrEMBL
Pfam	G-alpha	UniProtKB/TrEMBL
PhenoGen	Gnat1	PhenoGen
PRINTS	GPROTEINA	UniProtKB/TrEMBL
	GPROTEINAI	UniProtKB/TrEMBL
PROSITE	G_ALPHA	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000017589	RatGTEx
SMART	G_alpha	UniProtKB/TrEMBL
Superfamily-SCOP	SSF52540	UniProtKB/TrEMBL
	Transducn_insert	UniProtKB/TrEMBL
UniProt	A6I307	ENTREZGENE, UniProtKB/TrEMBL
	D3ZSS5	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-03-15	Gnat1	G protein subunit alpha transducin 1	Gnat1	guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2011-05-25	Gnat1	guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 1	Gnat1	guanine nucleotide binding protein (G protein), alpha transducing 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2011-04-29	Gnat1	guanine nucleotide binding protein (G protein), alpha transducing 1	Gnat1	guanine nucleotide binding protein, alpha transducing 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Gnat1	guanine nucleotide binding protein, alpha transducing 1	Gnat1_predicted	guanine nucleotide binding protein, alpha transducing 1 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Gnat1_predicted	guanine nucleotide binding protein, alpha transducing 1 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)