Symbol:
Nanog
Name:
Nanog homeobox
RGD ID:
1303178
Description:
Predicted to enable several functions, including DNA-binding transcription factor activity, RNA polymerase II-specific; RNA polymerase II sequence-specific DNA-binding transcription factor recruiting activity; and lysine-acetylated histone binding activity. Involved in several processes, including cellular response to erythropoietin; cellular response to rapamycin; and multidimensional cell growth. Predicted to be located in nucleolus and nucleoplasm. Predicted to be active in chromatin and nucleus. Used to study colon cancer. Orthologous to several human genes including NANOG (Nanog homeobox); PARTICIPATES IN DNA modification pathway; INTERACTS WITH 1,2-dimethylhydrazine; 2,3,7,8-tetrachlorodibenzodioxine; acrylamide.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
homeobox protein NANOG
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
NANOG (Nanog homeobox) HGNC
EggNOG, Ensembl, HomoloGene, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):
Nanog (Nanog homeobox) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Nanog (Nanog homeobox) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
NANOG (Nanog homeobox) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
NANOG (Nanog homeobox) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Nanog (Nanog homeobox) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
NANOG (Nanog homeobox) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
NANOG (Nanog homeobox) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Nanog (Nanog homeobox) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
NANOGP8 (Nanog homeobox retrogene P8) HGNC
Ensembl, OrthoDB, Panther
Homo sapiens (human):
NANOGP1 (Nanog homeobox pseudogene 1) HGNC
Inparanoid, Panther
Alliance orthologs 3
Homo sapiens (human):
NANOG (Nanog homeobox)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
NANOGP1 (Nanog homeobox pseudogene 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Nanog (Nanog homeobox)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
NANOGP8 (Nanog homeobox retrogene P8)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
nanog (nanog homeobox)
Alliance
DIOPT (Ensembl Compara|OrthoInspector|PhylomeDB)
Is Marker For:
Strains:
WIC-Tg(Nanog-YFP*)1Utr
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 157,615,687 - 157,623,061 (+) NCBI GRCr8 mRatBN7.2 4 155,943,737 - 155,951,116 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 155,943,737 - 155,951,116 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 162,211,480 - 162,218,867 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 186,563,349 - 186,570,736 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 156,639,759 - 156,647,147 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 155,531,906 - 155,539,268 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 155,531,906 - 155,539,268 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 222,552,995 - 222,560,653 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 159,190,786 - 159,198,160 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 159,438,699 - 159,441,754 (+) NCBI Celera 4 144,763,722 - 144,771,060 (+) NCBI Celera Cytogenetic Map 4 q42 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Nanog Rat (+)-catechin multiple interactions ISO NANOG (Homo sapiens) 6480464 [Catechin co-treated with Grape Seed Proanthocyanidins] results in decreased expression of NANOG mRNA CTD PMID:24763279 Nanog Rat (20S)-ginsenoside Rg3 decreases expression ISO NANOG (Homo sapiens) 6480464 ginsenoside Rg3 results in decreased expression of NANOG mRNA CTD PMID:31916386 Nanog Rat (S)-naringenin decreases expression ISO NANOG (Homo sapiens) 6480464 naringenin results in decreased expression of NANOG protein CTD PMID:27468969 Nanog Rat (S)-nicotine increases expression ISO NANOG (Homo sapiens) 6480464 Nicotine results in increased expression of NANOG mRNA and Nicotine results in increased expression of NANOG protein CTD PMID:23219715 Nanog Rat (S)-nicotine increases expression ISO Nanog (Mus musculus) 6480464 Nicotine results in increased expression of NANOG protein CTD PMID:31507073 Nanog Rat (S)-nicotine multiple interactions ISO NANOG (Homo sapiens) 6480464 [Nicotine co-treated with 4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone] results in increased expression of NANOG protein and SNAI1 mutant form inhibits the reaction [Nicotine results in increased expression of NANOG mRNA] CTD PMID:23219715 and PMID:30259641 Nanog Rat (S)-ropivacaine decreases expression ISO NANOG (Homo sapiens) 6480464 Ropivacaine results in decreased expression of NANOG protein CTD PMID:36124980 Nanog Rat 1,2-dichloroethane decreases expression ISO Nanog (Mus musculus) 6480464 ethylene dichloride results in decreased expression of NANOG mRNA CTD PMID:28189721 and PMID:28960355 Nanog Rat 1,2-dimethylhydrazine multiple interactions EXP 6480464 [APC protein affects the susceptibility to 1 and 2-Dimethylhydrazine] which results in decreased expression of NANOG mRNA CTD PMID:27840820 Nanog Rat 17beta-estradiol increases expression ISO NANOG (Homo sapiens) 6480464 Estradiol results in increased expression of NANOG mRNA and Estradiol results in increased expression of NANOG protein CTD PMID:23391485 and PMID:34719554 Nanog Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Nanog (Mus musculus) 6480464 2 more ... CTD PMID:34547414 Nanog Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Nanog (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of NANOG mRNA CTD PMID:24058054 Nanog Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of NANOG mRNA CTD PMID:33387578 Nanog Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO NANOG (Homo sapiens) 6480464 N-(2-(3H-indol-3-yl)ethyl)-9-isopropyl-2-(5-methyl-3-pyridyl)purin-6-amine inhibits the reaction [Tetrachlorodibenzodioxin results in increased expression of NANOG mRNA] CTD PMID:30203000 Nanog Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO NANOG (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of NANOG mRNA CTD PMID:30203000 Nanog Rat 2,4-di-tert-butylphenol multiple interactions ISO NANOG (Homo sapiens) 6480464 [Chir 99021 co-treated with 2 and 4-di-tert-butylphenol] results in increased expression of NANOG mRNA CTD PMID:36682590 Nanog Rat 2-(3,4-dimethoxyphenyl)-5-\{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino\}-2-(propan-2-yl)pentanenitrile multiple interactions ISO NANOG (Homo sapiens) 6480464 [Verapamil co-treated with kaempferol] results in decreased expression of NANOG mRNA and [Verapamil co-treated with kaempferol] results in decreased expression of NANOG protein CTD PMID:35063459 Nanog Rat 2-methoxy-17beta-estradiol multiple interactions ISO Nanog (Mus musculus) 6480464 2-Methoxyestradiol inhibits the reaction [Curcumin results in increased expression of NANOG mRNA] CTD PMID:25822711 Nanog Rat 3,5,6-trichloro-2-pyridinol decreases expression ISO Nanog (Mus musculus) 6480464 3 more ... CTD PMID:23220036 Nanog Rat 3,5,6-trichloropyridine-2-one decreases expression ISO Nanog (Mus musculus) 6480464 3 more ... CTD PMID:23220036 Nanog Rat 3-methyladenine increases expression ISO Nanog (Mus musculus) 6480464 3-methyladenine results in increased expression of NANOG mRNA CTD PMID:21681844 Nanog Rat 4,4'-sulfonyldiphenol increases expression ISO NANOG (Homo sapiens) 6480464 bisphenol S results in increased expression of NANOG mRNA CTD PMID:36565802 Nanog Rat 4,4'-sulfonyldiphenol multiple interactions ISO NANOG (Homo sapiens) 6480464 [bisphenol A co-treated with perfluorooctanoic acid co-treated with bisphenol S co-treated with perfluorooctane sulfonic acid] results in decreased expression of NANOG mRNA and [bisphenol S co-treated with perfluorooctane sulfonic acid] results in decreased expression of NANOG mRNA CTD PMID:37834465 Nanog Rat 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one multiple interactions ISO NANOG (Homo sapiens) 6480464 [Nicotine co-treated with 4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone] results in increased expression of NANOG protein CTD PMID:30259641 Nanog Rat 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one increases expression ISO NANOG (Homo sapiens) 6480464 4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone results in increased expression of NANOG protein CTD PMID:30259641 Nanog Rat 5-aza-2'-deoxycytidine decreases expression ISO NANOG (Homo sapiens) 6480464 Decitabine results in decreased expression of NANOG mRNA CTD PMID:23300844 Nanog Rat 5-fluorouracil affects expression ISO Nanog (Mus musculus) 6480464 Fluorouracil affects the expression of NANOG protein CTD PMID:21296659 Nanog Rat 5-fluorouracil decreases expression ISO NANOG (Homo sapiens) 6480464 Fluorouracil results in decreased expression of NANOG mRNA CTD PMID:24737281 Nanog Rat 5-hydroxytryptophan decreases expression ISO Nanog (Mus musculus) 6480464 5-Hydroxytryptophan results in decreased expression of NANOG mRNA CTD PMID:32926198 Nanog Rat 6-bromoindirubin-3'-oxime multiple interactions ISO NANOG (Homo sapiens) 6480464 [trametinib co-treated with 6-bromoindirubin-3'-oxime] results in increased expression of NANOG protein and XAV939 inhibits the reaction [[trametinib co-treated with 6-bromoindirubin-3'-oxime] results in increased expression of NANOG protein] CTD PMID:37116855 Nanog Rat ABT-737 decreases expression ISO NANOG (Homo sapiens) 6480464 ABT-737 results in decreased expression of NANOG protein CTD PMID:23918355 Nanog Rat acetic acid decreases expression ISO Nanog (Mus musculus) 6480464 Acetic Acid results in decreased expression of NANOG protein CTD PMID:21296659 Nanog Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of NANOG mRNA CTD PMID:28959563 Nanog Rat afimoxifene increases expression ISO NANOG (Homo sapiens) 6480464 afimoxifene results in increased expression of NANOG protein CTD PMID:27581495 Nanog Rat all-trans-retinoic acid multiple interactions ISO Nanog (Mus musculus) 6480464 NR6A1 protein affects the reaction [Tretinoin results in decreased expression of NANOG mRNA] CTD PMID:16166633 Nanog Rat all-trans-retinoic acid multiple interactions ISO NANOG (Homo sapiens) 6480464 [Arsenic Trioxide co-treated with Tretinoin] results in decreased expression of NANOG protein CTD PMID:30093655 Nanog Rat all-trans-retinoic acid affects expression ISO NANOG (Homo sapiens) 6480464 Tretinoin affects the expression of NANOG mRNA CTD PMID:31600526 Nanog Rat all-trans-retinoic acid increases expression ISO Nanog (Mus musculus) 6480464 Tretinoin results in increased expression of NANOG protein CTD PMID:30442713 Nanog Rat all-trans-retinoic acid increases cleavage ISO Nanog (Mus musculus) 6480464 Tretinoin results in increased cleavage of NANOG protein CTD PMID:29767511 Nanog Rat all-trans-retinoic acid decreases expression ISO Nanog (Mus musculus) 6480464 Tretinoin results in decreased expression of NANOG mRNA CTD PMID:22466603 Nanog Rat all-trans-retinoic acid decreases expression ISO NANOG (Homo sapiens) 6480464 Tretinoin results in decreased expression of NANOG mRNA CTD PMID:16168501 more ... Nanog Rat Antrocin decreases expression ISO NANOG (Homo sapiens) 6480464 antrocin analog results in decreased expression of NANOG protein CTD PMID:36565974 Nanog Rat apigenin decreases expression ISO NANOG (Homo sapiens) 6480464 Apigenin results in decreased expression of NANOG protein CTD PMID:27468969 Nanog Rat arsenous acid multiple interactions ISO NANOG (Homo sapiens) 6480464 [Arsenic Trioxide co-treated with Tretinoin] results in decreased expression of NANOG protein more ... CTD PMID:29396848 and PMID:30093655 Nanog Rat arsenous acid decreases expression ISO NANOG (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of NANOG mRNA CTD PMID:33634982 Nanog Rat arsenous acid increases expression ISO NANOG (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of NANOG mRNA and Arsenic Trioxide results in increased expression of NANOG protein CTD PMID:29396848 Nanog Rat arsenous acid decreases expression ISO Nanog (Mus musculus) 6480464 Arsenic Trioxide results in decreased expression of NANOG mRNA CTD PMID:29767511 Nanog Rat arsenous acid increases cleavage ISO Nanog (Mus musculus) 6480464 Arsenic Trioxide results in increased cleavage of NANOG protein CTD PMID:29767511 Nanog Rat belinostat increases expression ISO NANOG (Homo sapiens) 6480464 belinostat results in increased expression of NANOG mRNA CTD PMID:26272509 Nanog Rat belinostat multiple interactions ISO NANOG (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of NANOG mRNA CTD PMID:27188386 Nanog Rat benzo[a]pyrene decreases expression ISO NANOG (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of NANOG mRNA CTD PMID:22316170 Nanog Rat benzo[a]pyrene decreases methylation ISO NANOG (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of NANOG 3' UTR CTD PMID:27901495 Nanog Rat benzo[a]pyrene affects methylation ISO NANOG (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of NANOG promoter CTD PMID:27901495 Nanog Rat benzo[a]pyrene multiple interactions ISO NANOG (Homo sapiens) 6480464 [sodium arsenite co-treated with Benzo(a)pyrene] results in increased expression of NANOG protein and METTL3 protein promotes the reaction [[sodium arsenite co-treated with Benzo(a)pyrene] results in increased expression of NANOG protein] CTD PMID:37972769 Nanog Rat bis(2-ethylhexyl) phthalate decreases expression ISO Nanog (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of NANOG mRNA CTD PMID:28286118 Nanog Rat bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of NANOG protein CTD PMID:37364752 Nanog Rat bis(2-ethylhexyl) phthalate decreases expression ISO NANOG (Homo sapiens) 6480464 Diethylhexyl Phthalate results in decreased expression of NANOG mRNA CTD PMID:31163220 Nanog Rat bisphenol A increases expression ISO Nanog (Mus musculus) 6480464 bisphenol A results in increased expression of NANOG mRNA and bisphenol A results in increased expression of NANOG protein CTD PMID:24090592 and PMID:31288075 Nanog Rat bisphenol A multiple interactions ISO NANOG (Homo sapiens) 6480464 [bisphenol A co-treated with perfluorooctane sulfonic acid] results in decreased expression of NANOG mRNA and [bisphenol A co-treated with perfluorooctanoic acid co-treated with bisphenol S co-treated with perfluorooctane sulfonic acid] results in decreased expression of NANOG mRNA CTD PMID:37834465 Nanog Rat bisphenol A multiple interactions ISO Nanog (Mus musculus) 6480464 [bisphenol A co-treated with Stigmasterol] results in decreased expression of NANOG mRNA and bisphenol A inhibits the reaction [GW 4064 results in decreased expression of NANOG mRNA] CTD PMID:30245210 Nanog Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of NANOG mRNA and bisphenol A results in decreased expression of NANOG protein CTD PMID:24134786 and PMID:25181051 Nanog Rat bisphenol A increases expression ISO NANOG (Homo sapiens) 6480464 bisphenol A results in increased expression of NANOG mRNA and bisphenol A results in increased expression of NANOG protein CTD PMID:23391485 more ... Nanog Rat bromochloroacetic acid increases expression ISO Nanog (Mus musculus) 6480464 bromochloroacetic acid results in increased expression of NANOG protein CTD PMID:21296659 Nanog Rat butanal decreases expression ISO NANOG (Homo sapiens) 6480464 butyraldehyde results in decreased expression of NANOG mRNA CTD PMID:26079696 Nanog Rat cadmium atom decreases expression ISO NANOG (Homo sapiens) 6480464 Cadmium results in decreased expression of NANOG mRNA CTD PMID:24376830 Nanog Rat cadmium atom multiple interactions ISO NANOG (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of NANOG mRNA CTD PMID:36602393 Nanog Rat cadmium dichloride multiple interactions ISO NANOG (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of NANOG mRNA CTD PMID:36602393 Nanog Rat carboplatin increases expression ISO NANOG (Homo sapiens) 6480464 Carboplatin results in increased expression of NANOG mRNA CTD PMID:25605917 Nanog Rat casticin decreases expression ISO NANOG (Homo sapiens) 6480464 casticin results in decreased expression of NANOG mRNA CTD PMID:32268151 Nanog Rat casticin multiple interactions ISO NANOG (Homo sapiens) 6480464 casticin promotes the reaction [MIR148A mRNA results in decreased expression of NANOG mRNA] more ... CTD PMID:32268151 Nanog Rat CHIR 99021 multiple interactions ISO NANOG (Homo sapiens) 6480464 [Chir 99021 co-treated with 2 and 4-di-tert-butylphenol] results in increased expression of NANOG mRNA CTD PMID:36682590 Nanog Rat CHIR 99021 decreases expression ISO NANOG (Homo sapiens) 6480464 Chir 99021 results in decreased expression of NANOG mRNA CTD PMID:31711903 Nanog Rat CHIR-98014 decreases expression ISO NANOG (Homo sapiens) 6480464 Chir 98014 results in decreased expression of NANOG mRNA CTD PMID:22723015 Nanog Rat chlordecone increases expression ISO Nanog (Mus musculus) 6480464 Chlordecone results in increased expression of NANOG mRNA CTD PMID:33711761 Nanog Rat chlorpromazine decreases expression ISO NANOG (Homo sapiens) 6480464 Chlorpromazine results in decreased expression of NANOG mRNA CTD PMID:30703373 Nanog Rat chlorpyrifos decreases expression ISO Nanog (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of NANOG mRNA CTD PMID:23220036 Nanog Rat chromium(6+) increases expression ISO Nanog (Mus musculus) 6480464 chromium hexavalent ion results in increased expression of NANOG mRNA CTD PMID:19654923 Nanog Rat chromium(6+) multiple interactions ISO Nanog (Mus musculus) 6480464 MAP2K7 protein promotes the reaction [chromium hexavalent ion results in increased expression of NANOG mRNA] CTD PMID:19654923 Nanog Rat ciprofloxacin increases expression ISO NANOG (Homo sapiens) 6480464 Ciprofloxacin results in increased expression of NANOG protein CTD PMID:26947806 Nanog Rat cisplatin multiple interactions ISO NANOG (Homo sapiens) 6480464 [Cisplatin co-treated with Paclitaxel] results in increased expression of NANOG mRNA more ... CTD PMID:20705681 more ... Nanog Rat cisplatin decreases expression ISO NANOG (Homo sapiens) 6480464 Cisplatin results in decreased expression of NANOG mRNA CTD PMID:23300844 Nanog Rat cisplatin increases expression ISO NANOG (Homo sapiens) 6480464 Cisplatin results in increased expression of NANOG mRNA and Cisplatin results in increased expression of NANOG protein CTD PMID:21618587 Nanog Rat cobalt dichloride multiple interactions ISO NANOG (Homo sapiens) 6480464 [EPAS1 protein results in increased susceptibility to cobaltous chloride] which results in increased expression of NANOG mRNA and [HIF1A protein results in increased susceptibility to cobaltous chloride] which results in increased expression of NANOG mRNA CTD PMID:25805230 Nanog Rat cordycepin affects expression ISO NANOG (Homo sapiens) 6480464 cordycepin affects the expression of NANOG mRNA CTD PMID:36881089 Nanog Rat cordycepin multiple interactions ISO Nanog (Mus musculus) 6480464 alpha-cyano-(3 and 4-dihydroxy)-N-benzylcinnamide inhibits the reaction [cordycepin results in increased expression of NANOG protein] CTD PMID:32042022 Nanog Rat cordycepin multiple interactions ISO NANOG (Homo sapiens) 6480464 sirtinol inhibits the reaction [cordycepin results in increased expression of NANOG mRNA] CTD PMID:36881089 Nanog Rat cordycepin increases expression ISO Nanog (Mus musculus) 6480464 cordycepin results in increased expression of NANOG protein CTD PMID:32042022 Nanog Rat crocidolite asbestos increases expression ISO Nanog (Mus musculus) 6480464 Asbestos and Crocidolite results in increased expression of NANOG mRNA CTD PMID:29279043 Nanog Rat curcumin multiple interactions ISO Nanog (Mus musculus) 6480464 2-methoxyestradiol inhibits the reaction [Curcumin results in increased expression of NANOG mRNA] CTD PMID:25822711 Nanog Rat curcumin increases expression ISO Nanog (Mus musculus) 6480464 Curcumin results in increased expression of NANOG mRNA and Curcumin results in increased expression of NANOG protein CTD PMID:25822711 and PMID:27237783 Nanog Rat cypermethrin increases expression ISO Nanog (Mus musculus) 6480464 cypermethrin results in increased expression of NANOG mRNA CTD PMID:32214279 Nanog Rat decabromodiphenyl ether decreases expression ISO NANOG (Homo sapiens) 6480464 decabromobiphenyl ether results in decreased expression of NANOG mRNA CTD PMID:26206603 Nanog Rat deoxycholic acid increases expression ISO Nanog (Mus musculus) 6480464 Deoxycholic Acid results in increased expression of NANOG mRNA CTD PMID:27151938 Nanog Rat diallyl trisulfide decreases expression ISO NANOG (Homo sapiens) 6480464 diallyl trisulfide results in decreased expression of NANOG mRNA and diallyl trisulfide results in decreased expression of NANOG protein CTD PMID:29626521 more ... Nanog Rat diallyl trisulfide increases expression ISO NANOG (Homo sapiens) 6480464 diallyl trisulfide results in increased expression of NANOG protein CTD PMID:33751676 Nanog Rat diallyl trisulfide multiple interactions ISO NANOG (Homo sapiens) 6480464 diallyl trisulfide inhibits the reaction [CTNNB1 protein results in increased expression of NANOG protein] CTD PMID:29626521 Nanog Rat diarsenic trioxide multiple interactions ISO NANOG (Homo sapiens) 6480464 [Arsenic Trioxide co-treated with Tretinoin] results in decreased expression of NANOG protein more ... CTD PMID:29396848 and PMID:30093655 Nanog Rat diarsenic trioxide decreases expression ISO NANOG (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of NANOG mRNA CTD PMID:33634982 Nanog Rat diarsenic trioxide increases cleavage ISO Nanog (Mus musculus) 6480464 Arsenic Trioxide results in increased cleavage of NANOG protein CTD PMID:29767511 Nanog Rat diarsenic trioxide decreases expression ISO Nanog (Mus musculus) 6480464 Arsenic Trioxide results in decreased expression of NANOG mRNA CTD PMID:29767511 Nanog Rat diarsenic trioxide increases expression ISO NANOG (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of NANOG mRNA and Arsenic Trioxide results in increased expression of NANOG protein CTD PMID:29396848 Nanog Rat dieldrin multiple interactions ISO NANOG (Homo sapiens) 6480464 Dieldrin inhibits the reaction [[4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with LDN 193189] results in decreased expression of NANOG mRNA] CTD PMID:32949729 Nanog Rat dimethyl sulfoxide decreases expression ISO NANOG (Homo sapiens) 6480464 Dimethyl Sulfoxide results in decreased expression of NANOG mRNA CTD PMID:22105179 Nanog Rat dioxygen multiple interactions ISO Nanog (Mus musculus) 6480464 Oxygen deficiency promotes the reaction [LIF protein affects the reaction NANOG mRNA] CTD PMID:26723917 Nanog Rat dioxygen decreases expression ISO NANOG (Homo sapiens) 6480464 Oxygen deficiency results in decreased expression of NANOG protein CTD PMID:38909692 Nanog Rat disodium selenite decreases expression ISO NANOG (Homo sapiens) 6480464 Sodium Selenite results in decreased expression of NANOG mRNA CTD PMID:18175754 Nanog Rat dorsomorphin multiple interactions ISO NANOG (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Nanog Rat entinostat increases expression ISO NANOG (Homo sapiens) 6480464 entinostat results in increased expression of NANOG mRNA CTD PMID:26272509 Nanog Rat entinostat multiple interactions ISO NANOG (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of NANOG mRNA CTD PMID:27188386 Nanog Rat ethanol increases expression EXP 6480464 Ethanol results in increased expression of NANOG mRNA CTD PMID:29769550 Nanog Rat ethanol increases expression ISO NANOG (Homo sapiens) 6480464 Ethanol results in increased expression of NANOG mRNA CTD PMID:23378141 Nanog Rat Evodiamine increases expression ISO NANOG (Homo sapiens) 6480464 evodiamine results in increased expression of NANOG mRNA CTD PMID:31835579 Nanog Rat fluoxetine affects expression ISO Nanog (Mus musculus) 6480464 Fluoxetine affects the expression of NANOG mRNA CTD PMID:29893963 Nanog Rat folic acid increases expression ISO Nanog (Mus musculus) 6480464 Folic Acid results in increased expression of NANOG mRNA CTD PMID:25629700 Nanog Rat formaldehyde increases expression ISO Nanog (Mus musculus) 6480464 Formaldehyde results in increased expression of NANOG mRNA CTD PMID:33233951 Nanog Rat fulvestrant increases expression ISO NANOG (Homo sapiens) 6480464 fulvestrant results in increased expression of NANOG protein CTD PMID:27581495 Nanog Rat furan decreases expression EXP 6480464 furan results in decreased expression of NANOG mRNA CTD PMID:25539665 Nanog Rat gemcitabine decreases expression ISO NANOG (Homo sapiens) 6480464 Gemcitabine results in decreased expression of NANOG mRNA CTD PMID:25605917 and PMID:35063459 Nanog Rat GS-441524 increases expression ISO Nanog (Mus musculus) 6480464 GS-441524 results in increased expression of NANOG mRNA CTD PMID:35605700 Nanog Rat GW 4064 decreases expression ISO Nanog (Mus musculus) 6480464 GW 4064 results in decreased expression of NANOG mRNA CTD PMID:30245210 Nanog Rat GW 4064 multiple interactions ISO Nanog (Mus musculus) 6480464 bisphenol A inhibits the reaction [GW 4064 results in decreased expression of NANOG mRNA] and Stigmasterol inhibits the reaction [GW 4064 results in decreased expression of NANOG mRNA] CTD PMID:30245210 Nanog Rat heptachlor multiple interactions ISO NANOG (Homo sapiens) 6480464 Heptachlor inhibits the reaction [[4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with LDN 193189] results in decreased expression of NANOG mRNA] CTD PMID:32949729 Nanog Rat hexachlorophene multiple interactions ISO NANOG (Homo sapiens) 6480464 Hexachlorophene inhibits the reaction [[4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with LDN 193189] results in decreased expression of NANOG mRNA] CTD PMID:32949729 Nanog Rat Indeno[1,2,3-cd]pyrene increases expression ISO NANOG (Homo sapiens) 6480464 indeno(1 more ... CTD PMID:35687267 Nanog Rat indometacin decreases expression ISO NANOG (Homo sapiens) 6480464 Indomethacin results in decreased expression of NANOG mRNA CTD PMID:24737281 Nanog Rat ivermectin decreases expression ISO NANOG (Homo sapiens) 6480464 Ivermectin results in decreased expression of NANOG mRNA and Ivermectin results in decreased expression of NANOG protein CTD PMID:29257278 Nanog Rat kaempferol increases expression ISO Nanog (Mus musculus) 6480464 kaempferol results in increased expression of NANOG protein CTD PMID:26683311 Nanog Rat kaempferol multiple interactions ISO NANOG (Homo sapiens) 6480464 [Verapamil co-treated with kaempferol] results in decreased expression of NANOG mRNA and [Verapamil co-treated with kaempferol] results in decreased expression of NANOG protein CTD PMID:35063459 Nanog Rat kaempferol decreases expression ISO NANOG (Homo sapiens) 6480464 kaempferol results in decreased expression of NANOG mRNA and kaempferol results in decreased expression of NANOG protein CTD PMID:35063459 Nanog Rat lead diacetate decreases expression ISO Nanog (Mus musculus) 6480464 lead acetate results in decreased expression of NANOG mRNA CTD PMID:25270620 Nanog Rat lead diacetate increases expression ISO Nanog (Mus musculus) 6480464 lead acetate results in increased expression of NANOG mRNA CTD PMID:31715224 Nanog Rat limonin decreases expression ISO NANOG (Homo sapiens) 6480464 limonin results in decreased expression of NANOG mRNA and limonin results in decreased expression of NANOG protein CTD PMID:30738134 Nanog Rat lipopolysaccharide multiple interactions EXP 6480464 NANOG inhibits the reaction [Lipopolysaccharides results in increased expression of IL1B mRNA] more ... CTD PMID:22200792 Nanog Rat lithium chloride increases expression ISO NANOG (Homo sapiens) 6480464 Lithium Chloride results in increased expression of NANOG mRNA CTD PMID:20069066 Nanog Rat lithium chloride multiple interactions ISO NANOG (Homo sapiens) 6480464 Lithium Chloride inhibits the reaction [Proanthocyanidins results in decreased expression of NANOG protein] and SFRP2 protein affects the reaction [Lithium Chloride results in increased expression of NANOG mRNA] CTD PMID:20069066 and PMID:37551626 Nanog Rat lupeol decreases expression ISO Nanog (Mus musculus) 6480464 lupeol results in decreased expression of NANOG protein CTD PMID:20979057 Nanog Rat LY294002 multiple interactions ISO Nanog (Mus musculus) 6480464 [2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one co-treated with sodium arsenite] results in decreased expression of NANOG protein CTD PMID:23143138 Nanog Rat LY294002 decreases expression ISO Nanog (Mus musculus) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one results in decreased expression of NANOG protein CTD PMID:23143138 Nanog Rat methylmercury chloride increases expression ISO NANOG (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of NANOG mRNA and methylmercuric chloride results in increased expression of NANOG protein CTD PMID:22555245 more ... Nanog Rat methylparaben increases expression ISO NANOG (Homo sapiens) 6480464 methylparaben results in increased expression of NANOG mRNA and methylparaben results in increased expression of NANOG protein CTD PMID:27581495 Nanog Rat mono(2-ethylhexyl) phthalate decreases expression ISO Nanog (Mus musculus) 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of NANOG protein CTD PMID:37364752 Nanog Rat N-acetyl-L-cysteine multiple interactions ISO NANOG (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [ovatodiolide results in decreased expression of NANOG protein] and Acetylcysteine inhibits the reaction [Particulate Matter results in decreased expression of NANOG protein] CTD PMID:32745510 and PMID:39276908 Nanog Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions ISO NANOG (Homo sapiens) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [resveratrol results in decreased expression of NANOG protein] CTD PMID:23651583 Nanog Rat nicotine increases expression ISO NANOG (Homo sapiens) 6480464 Nicotine results in increased expression of NANOG mRNA and Nicotine results in increased expression of NANOG protein CTD PMID:23219715 Nanog Rat nicotine increases expression ISO Nanog (Mus musculus) 6480464 Nicotine results in increased expression of NANOG protein CTD PMID:31507073 Nanog Rat nicotine multiple interactions ISO NANOG (Homo sapiens) 6480464 [Nicotine co-treated with 4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone] results in increased expression of NANOG protein and SNAI1 mutant form inhibits the reaction [Nicotine results in increased expression of NANOG mRNA] CTD PMID:23219715 and PMID:30259641 Nanog Rat nocodazole decreases expression ISO NANOG (Homo sapiens) 6480464 Nocodazole results in decreased expression of NANOG protein CTD PMID:21559451 Nanog Rat Nonylphenol increases expression ISO Nanog (Mus musculus) 6480464 nonylphenol results in increased expression of NANOG mRNA CTD PMID:31288075 Nanog Rat paclitaxel multiple interactions ISO NANOG (Homo sapiens) 6480464 [Cisplatin co-treated with Paclitaxel] results in increased expression of NANOG mRNA and [Cisplatin co-treated with Paclitaxel] results in increased expression of NANOG protein CTD PMID:20705681 Nanog Rat panobinostat increases expression ISO NANOG (Homo sapiens) 6480464 panobinostat results in increased expression of NANOG mRNA CTD PMID:26272509 Nanog Rat panobinostat multiple interactions ISO NANOG (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of NANOG mRNA CTD PMID:27188386 Nanog Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of NANOG mRNA CTD PMID:33387578 Nanog Rat perfluorooctane-1-sulfonic acid decreases expression ISO Nanog (Mus musculus) 6480464 perfluorooctane sulfonic acid results in decreased expression of NANOG mRNA and perfluorooctane sulfonic acid results in decreased expression of NANOG protein CTD PMID:24098361 Nanog Rat perfluorooctane-1-sulfonic acid multiple interactions ISO NANOG (Homo sapiens) 6480464 [bisphenol A co-treated with perfluorooctane sulfonic acid] results in decreased expression of NANOG mRNA more ... CTD PMID:37834465 Nanog Rat perfluorooctane-1-sulfonic acid decreases expression ISO NANOG (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in decreased expression of NANOG mRNA CTD PMID:37834465 Nanog Rat perfluorooctane-1-sulfonic acid increases expression ISO NANOG (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in increased expression of NANOG protein CTD PMID:27153767 Nanog Rat perfluorooctane-1-sulfonic acid increases expression ISO Nanog (Mus musculus) 6480464 perfluorooctane sulfonic acid results in increased expression of NANOG mRNA and perfluorooctane sulfonic acid results in increased expression of NANOG protein CTD PMID:25510869 Nanog Rat perfluorooctanoic acid increases expression ISO NANOG (Homo sapiens) 6480464 perfluorooctanoic acid results in increased expression of NANOG protein CTD PMID:27153767 Nanog Rat perfluorooctanoic acid multiple interactions ISO NANOG (Homo sapiens) 6480464 [bisphenol A co-treated with perfluorooctanoic acid co-treated with bisphenol S co-treated with perfluorooctane sulfonic acid] results in decreased expression of NANOG mRNA CTD PMID:37834465 Nanog Rat permethrin multiple interactions ISO NANOG (Homo sapiens) 6480464 Permethrin promotes the reaction [[4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with LDN 193189] results in decreased expression of NANOG mRNA] CTD PMID:32949729 Nanog Rat pirinixic acid decreases expression ISO Nanog (Mus musculus) 6480464 pirinixic acid results in decreased expression of NANOG mRNA CTD PMID:25270620 Nanog Rat proanthocyanidin multiple interactions ISO NANOG (Homo sapiens) 6480464 Lithium Chloride inhibits the reaction [Proanthocyanidins results in decreased expression of NANOG protein] CTD PMID:37551626 Nanog Rat proanthocyanidin decreases expression ISO NANOG (Homo sapiens) 6480464 Proanthocyanidins results in decreased expression of NANOG protein CTD PMID:37551626 Nanog Rat quercetin decreases expression ISO NANOG (Homo sapiens) 6480464 Quercetin results in decreased expression of NANOG protein CTD PMID:22422628 more ... Nanog Rat remdesivir decreases expression ISO Nanog (Mus musculus) 6480464 remdesivir results in decreased expression of NANOG mRNA CTD PMID:35605700 Nanog Rat resveratrol decreases expression ISO NANOG (Homo sapiens) 6480464 resveratrol results in decreased expression of NANOG mRNA and resveratrol results in decreased expression of NANOG protein CTD PMID:21304978 more ... Nanog Rat resveratrol decreases response to substance ISO NANOG (Homo sapiens) 6480464 NANOG protein results in decreased susceptibility to resveratrol CTD PMID:21304978 Nanog Rat resveratrol multiple interactions ISO NANOG (Homo sapiens) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [resveratrol results in decreased expression of NANOG protein] and TP53 mutant form inhibits the reaction [resveratrol results in decreased expression of NANOG protein] CTD PMID:23651583 Nanog Rat rotenone multiple interactions ISO NANOG (Homo sapiens) 6480464 Rotenone inhibits the reaction [[4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with LDN 193189] results in decreased expression of NANOG mRNA] CTD PMID:32949729 Nanog Rat rotenone decreases expression ISO NANOG (Homo sapiens) 6480464 Rotenone results in decreased expression of NANOG mRNA CTD PMID:33512557 Nanog Rat SB 431542 multiple interactions ISO NANOG (Homo sapiens) 6480464 [4-(5-benzo(1 more ... CTD PMID:27188386 and PMID:32949729 Nanog Rat sirolimus increases expression ISO Nanog (Mus musculus) 6480464 Sirolimus results in increased expression of NANOG mRNA CTD PMID:21681844 Nanog Rat sirtinol multiple interactions ISO NANOG (Homo sapiens) 6480464 sirtinol inhibits the reaction [cordycepin results in increased expression of NANOG mRNA] CTD PMID:36881089 Nanog Rat sodium arsenite multiple interactions ISO NANOG (Homo sapiens) 6480464 [sodium arsenite co-treated with Benzo(a)pyrene] results in increased expression of NANOG protein more ... CTD PMID:19615344 and PMID:37972769 Nanog Rat sodium arsenite affects expression ISO Nanog (Mus musculus) 6480464 sodium arsenite affects the expression of NANOG mRNA CTD PMID:28370166 Nanog Rat sodium arsenite affects expression ISO NANOG (Homo sapiens) 6480464 sodium arsenite affects the expression of NANOG mRNA CTD PMID:29301061 Nanog Rat sodium arsenite increases expression ISO Nanog (Mus musculus) 6480464 sodium arsenite results in increased expression of NANOG mRNA and sodium arsenite results in increased expression of NANOG protein CTD PMID:22641621 and PMID:26438402 Nanog Rat sodium arsenite decreases expression ISO Nanog (Mus musculus) 6480464 sodium arsenite results in decreased expression of NANOG protein CTD PMID:23143138 and PMID:23219847 Nanog Rat sodium arsenite multiple interactions ISO Nanog (Mus musculus) 6480464 [2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one co-treated with sodium arsenite] results in decreased expression of NANOG protein and [OGG1 gene mutant form results in increased susceptibility to sodium arsenite] which affects the expression of NANOG mRNA CTD PMID:23143138 and PMID:26438402 Nanog Rat sodium arsenite increases expression ISO NANOG (Homo sapiens) 6480464 sodium arsenite results in increased expression of NANOG mRNA CTD PMID:24431212 and PMID:31120745 Nanog Rat sodium arsenite decreases expression ISO NANOG (Homo sapiens) 6480464 sodium arsenite results in decreased expression of NANOG mRNA and sodium arsenite results in decreased expression of NANOG protein CTD PMID:19615344 more ... Nanog Rat sodium chlorate increases expression ISO Nanog (Mus musculus) 6480464 sodium chlorate results in increased expression of NANOG mRNA CTD PMID:19937756 Nanog Rat stigmasterol decreases expression ISO Nanog (Mus musculus) 6480464 Stigmasterol results in decreased expression of NANOG mRNA CTD PMID:30245210 Nanog Rat stigmasterol multiple interactions ISO Nanog (Mus musculus) 6480464 [bisphenol A co-treated with Stigmasterol] results in decreased expression of NANOG mRNA and Stigmasterol inhibits the reaction [GW 4064 results in decreased expression of NANOG mRNA] CTD PMID:30245210 Nanog Rat sunitinib increases expression ISO NANOG (Homo sapiens) 6480464 sunitinib results in increased expression of NANOG mRNA CTD PMID:25605917 Nanog Rat sunitinib decreases expression ISO NANOG (Homo sapiens) 6480464 Sunitinib results in decreased expression of NANOG mRNA CTD PMID:31533062 Nanog Rat Tanshinone I increases expression ISO Nanog (Mus musculus) 6480464 tanshinone results in increased expression of NANOG mRNA CTD PMID:25186638 Nanog Rat Tanshinone I multiple interactions EXP 6480464 tanshinone inhibits the reaction [Estrogens deficiency results in decreased expression of NANOG protein] CTD PMID:31108107 Nanog Rat taurocholic acid increases expression ISO Nanog (Mus musculus) 6480464 Taurocholic Acid results in increased expression of NANOG mRNA CTD PMID:27151938 Nanog Rat testosterone increases expression ISO NANOG (Homo sapiens) 6480464 Testosterone results in increased expression of NANOG mRNA CTD PMID:34719554 Nanog Rat thalidomide decreases expression ISO Nanog (Mus musculus) 6480464 Thalidomide results in decreased expression of NANOG mRNA CTD PMID:26217789 Nanog Rat thymoquinone decreases expression ISO NANOG (Homo sapiens) 6480464 thymoquinone results in decreased expression of NANOG protein CTD PMID:31298468 Nanog Rat titanium dioxide increases expression ISO Nanog (Mus musculus) 6480464 titanium dioxide results in increased expression of NANOG mRNA CTD PMID:29264374 Nanog Rat trametinib multiple interactions ISO NANOG (Homo sapiens) 6480464 [trametinib co-treated with 6-bromoindirubin-3'-oxime] results in increased expression of NANOG protein and XAV939 inhibits the reaction [[trametinib co-treated with 6-bromoindirubin-3'-oxime] results in increased expression of NANOG protein] CTD PMID:37116855 Nanog Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of NANOG mRNA CTD PMID:33387578 Nanog Rat trichostatin A increases expression ISO NANOG (Homo sapiens) 6480464 trichostatin A results in increased expression of NANOG mRNA CTD PMID:22723015 more ... Nanog Rat trichostatin A multiple interactions ISO NANOG (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of NANOG mRNA CTD PMID:27188386 Nanog Rat triclosan decreases expression ISO Nanog (Mus musculus) 6480464 Triclosan results in decreased expression of NANOG mRNA and Triclosan results in decreased expression of NANOG protein CTD PMID:24879426 and PMID:36243240 Nanog Rat urethane decreases expression ISO NANOG (Homo sapiens) 6480464 Urethane results in decreased expression of NANOG mRNA CTD PMID:28818685 Nanog Rat valproic acid increases expression ISO NANOG (Homo sapiens) 6480464 Valproic Acid results in increased expression of NANOG mRNA CTD PMID:22723015 more ... Nanog Rat valproic acid decreases expression ISO NANOG (Homo sapiens) 6480464 Valproic Acid results in decreased expression of NANOG mRNA CTD PMID:23179753 more ... Nanog Rat valproic acid multiple interactions ISO NANOG (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 and PMID:32949729 Nanog Rat verapamil multiple interactions ISO NANOG (Homo sapiens) 6480464 [Verapamil co-treated with kaempferol] results in decreased expression of NANOG mRNA and [Verapamil co-treated with kaempferol] results in decreased expression of NANOG protein CTD PMID:35063459 Nanog Rat vorinostat decreases expression ISO NANOG (Homo sapiens) 6480464 vorinostat results in decreased expression of NANOG mRNA CTD PMID:27188386 Nanog Rat vorinostat multiple interactions ISO NANOG (Homo sapiens) 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of NANOG mRNA CTD PMID:27188386 Nanog Rat vorinostat increases expression ISO NANOG (Homo sapiens) 6480464 vorinostat results in increased expression of NANOG mRNA CTD PMID:26272509 Nanog Rat XAV939 multiple interactions ISO NANOG (Homo sapiens) 6480464 XAV939 inhibits the reaction [[trametinib co-treated with 6-bromoindirubin-3'-oxime] results in increased expression of NANOG protein] CTD PMID:37116855
(+)-catechin (ISO) (20S)-ginsenoside Rg3 (ISO) (S)-naringenin (ISO) (S)-nicotine (ISO) (S)-ropivacaine (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (EXP) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-di-tert-butylphenol (ISO) 2-(3,4-dimethoxyphenyl)-5-\{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino\}-2-(propan-2-yl)pentanenitrile (ISO) 2-methoxy-17beta-estradiol (ISO) 3,5,6-trichloro-2-pyridinol (ISO) 3,5,6-trichloropyridine-2-one (ISO) 3-methyladenine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one (ISO) 5-aza-2'-deoxycytidine (ISO) 5-fluorouracil (ISO) 5-hydroxytryptophan (ISO) 6-bromoindirubin-3'-oxime (ISO) ABT-737 (ISO) acetic acid (ISO) acrylamide (EXP) afimoxifene (ISO) all-trans-retinoic acid (ISO) Antrocin (ISO) apigenin (ISO) arsenous acid (ISO) belinostat (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) bromochloroacetic acid (ISO) butanal (ISO) cadmium atom (ISO) cadmium dichloride (ISO) carboplatin (ISO) casticin (ISO) CHIR 99021 (ISO) CHIR-98014 (ISO) chlordecone (ISO) chlorpromazine (ISO) chlorpyrifos (ISO) chromium(6+) (ISO) ciprofloxacin (ISO) cisplatin (ISO) cobalt dichloride (ISO) cordycepin (ISO) crocidolite asbestos (ISO) curcumin (ISO) cypermethrin (ISO) decabromodiphenyl ether (ISO) deoxycholic acid (ISO) diallyl trisulfide (ISO) diarsenic trioxide (ISO) dieldrin (ISO) dimethyl sulfoxide (ISO) dioxygen (ISO) disodium selenite (ISO) dorsomorphin (ISO) entinostat (ISO) ethanol (EXP,ISO) Evodiamine (ISO) fluoxetine (ISO) folic acid (ISO) formaldehyde (ISO) fulvestrant (ISO) furan (EXP) gemcitabine (ISO) GS-441524 (ISO) GW 4064 (ISO) heptachlor (ISO) hexachlorophene (ISO) Indeno[1,2,3-cd]pyrene (ISO) indometacin (ISO) ivermectin (ISO) kaempferol (ISO) lead diacetate (ISO) limonin (ISO) lipopolysaccharide (EXP) lithium chloride (ISO) lupeol (ISO) LY294002 (ISO) methylmercury chloride (ISO) methylparaben (ISO) mono(2-ethylhexyl) phthalate (ISO) N-acetyl-L-cysteine (ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) nicotine (ISO) nocodazole (ISO) Nonylphenol (ISO) paclitaxel (ISO) panobinostat (ISO) paracetamol (EXP) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) permethrin (ISO) pirinixic acid (ISO) proanthocyanidin (ISO) quercetin (ISO) remdesivir (ISO) resveratrol (ISO) rotenone (ISO) SB 431542 (ISO) sirolimus (ISO) sirtinol (ISO) sodium arsenite (ISO) sodium chlorate (ISO) stigmasterol (ISO) sunitinib (ISO) Tanshinone I (EXP,ISO) taurocholic acid (ISO) testosterone (ISO) thalidomide (ISO) thymoquinone (ISO) titanium dioxide (ISO) trametinib (ISO) trichloroethene (EXP) trichostatin A (ISO) triclosan (ISO) urethane (ISO) valproic acid (ISO) verapamil (ISO) vorinostat (ISO) XAV939 (ISO)
Biological Process
BMP signaling pathway (IEA,ISO) cell dedifferentiation (IEA,ISO) cell differentiation (IBA,ISO) cellular response to erythropoietin (IEP) cellular response to rapamycin (IEP) embryonic pattern specification (IEA,ISO) endodermal cell fate specification (ISO) gene expression (IEA,ISO) gonad development (IEA,ISO) mesodermal cell fate commitment (IEA,ISO) multidimensional cell growth (IEP) negative regulation of BMP signaling pathway (IEA,ISO) negative regulation of cell fate commitment (IEA,ISO) negative regulation of stem cell differentiation (IEA,ISO) negative regulation of transcription by RNA polymerase II (IDA,IEA,ISO) positive regulation of cell population proliferation (IEA,ISO) positive regulation of DNA-templated transcription (IEA,ISO) positive regulation of mitotic cell cycle (IEA,ISO) positive regulation of stem cell proliferation (ISO) positive regulation of transcription by RNA polymerase II (IEA,ISO) regulation of cell differentiation (ISO) regulation of DNA-templated transcription (IEA,ISO) regulation of gene expression (ISO) regulation of stem cell division (IEA,ISO) regulation of transcription by RNA polymerase II (IBA) response to bisphenol A (IEP) response to retinoic acid (IEA,ISO) somatic stem cell population maintenance (IEA,ISO) stem cell differentiation (IEA,IEP,ISO) stem cell division (IEA,ISO) stem cell population maintenance (IBA,IEA,IEP,ISO) tissue regeneration (IEP)
Molecular Function
chromatin binding (IEA,ISO) DNA binding (IEA,ISO) DNA-binding transcription activator activity, RNA polymerase II-specific (IEA,ISO) DNA-binding transcription factor activity (IEA,ISO) DNA-binding transcription factor activity, RNA polymerase II-specific (IBA,IEA) DNA-binding transcription repressor activity, RNA polymerase II-specific (IEA,ISO) identical protein binding (ISO) lysine-acetylated histone binding (IEA,ISO) protein binding (ISO) RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA,IEA,ISO) RNA polymerase II sequence-specific DNA-binding transcription factor recruiting activity (IEA,ISO) RNA polymerase II transcription regulatory region sequence-specific DNA binding (ISO) sequence-specific DNA binding (IEA,ISO) sequence-specific double-stranded DNA binding (ISO) transcription cis-regulatory region binding (IEA,ISO)
1.
Direct reprogramming of rat neural precursor cells and fibroblasts into pluripotent stem cells.
Chang MY, etal., PLoS One. 2010 Mar 24;5(3):e9838. doi: 10.1371/journal.pone.0009838.
2.
Playing TETris with DNA modifications.
Delatte B, etal., EMBO J. 2014 Jun 2;33(11):1198-211. doi: 10.15252/embj.201488290. Epub 2014 May 13.
3.
Nanog attenuates lipopolysaccharide-induced inflammatory responses by blocking nuclear factor-kappaB transcriptional activity in BV-2 cells.
Duan Z, etal., Neuroreport. 2013 Sep 11;24(13):718-23. doi: 10.1097/WNR.0b013e328363fd67.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
The three-dimensional collagen scaffold improves the stemness of rat bone marrow mesenchymal stem cells.
Han S, etal., J Genet Genomics. 2012 Dec 20;39(12):633-41. doi: 10.1016/j.jgg.2012.08.006. Epub 2012 Nov 21.
6.
Identification, cloning and expression analysis of the pluripotency promoting Nanog genes in mouse and human.
Hart AH, etal., Dev Dyn 2004 May;230(1):187-98.
7.
Chronic high dose intraperitoneal bisphenol A (BPA) induces substantial histological and gene expression alterations in rat penile tissue without impairing erectile function.
Kovanecz I, etal., J Sex Med. 2013 Dec;10(12):2952-66. doi: 10.1111/jsm.12336. Epub 2013 Oct 17.
8.
Tumourigenesis in the infarcted rat heart is eliminated through differentiation and enrichment of the transplanted embryonic stem cells.
Lin Q, etal., Eur J Heart Fail. 2010 Nov;12(11):1179-85. doi: 10.1093/eurjhf/hfq144. Epub 2010 Sep 3.
9.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
10.
MicroRNA profiling of carcinogen-induced rat colon tumors and the influence of dietary spinach.
Parasramka MA, etal., Mol Nutr Food Res. 2012 Aug;56(8):1259-69. doi: 10.1002/mnfr.201200117. Epub 2012 May 29.
11.
Rapamycin induces pluripotent genes associated with avoidance of replicative senescence.
Pospelova TV, etal., Cell Cycle. 2013 Dec 15;12(24):3841-51. doi: 10.4161/cc.27396. Epub 2013 Dec 2.
12.
GOA pipeline
RGD automated data pipeline
13.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
14.
Comprehensive gene review and curation
RGD comprehensive gene curation
15.
Stromal cells cultured from omentum express pluripotent markers, produce high amounts of VEGF, and engraft to injured sites.
Singh AK, etal., Cell Tissue Res. 2008 Jan 15;.
16.
Expression and role of Oct3/4, Nanog and Sox2 in regeneration of rat tracheal epithelium.
Song N, etal., Cell Prolif. 2010 Feb;43(1):49-55. doi: 10.1111/j.1365-2184.2009.00653.x. Epub 2009 Oct 21.
17.
Increased expression of the pluripotency markers sex-determining region Y-box 2 and Nanog homeobox in ovarian endometriosis.
Song Y, etal., Reprod Biol Endocrinol. 2014 May 18;12:42. doi: 10.1186/1477-7827-12-42.
18.
Regenerative therapy in experimental parkinsonism: mixed population of differentiated mouse embryonic stem cells, rather than magnetically sorted and enriched dopaminergic cells provide neuroprotection.
Tripathy D, etal., CNS Neurosci Ther. 2014 Aug;20(8):717-27. doi: 10.1111/cns.12295. Epub 2014 Jun 21.
19.
Effect of Recombinant Human Erythropoietin On the Stemness of Bone Marrow-derived Mesenchymal Stem Cells in vitro.
Ye L, etal., Int J Stem Cells. 2010 May;3(2):175-82.
20.
Nanog and beta-catenin: a new convergence point in EpSC proliferation and differentiation.
Yin D, etal., Int J Mol Med. 2012 Apr;29(4):587-92. doi: 10.3892/ijmm.2011.871. Epub 2011 Dec 29.
Nanog Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 157,615,687 - 157,623,061 (+) NCBI GRCr8 mRatBN7.2 4 155,943,737 - 155,951,116 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 155,943,737 - 155,951,116 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 162,211,480 - 162,218,867 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 186,563,349 - 186,570,736 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 156,639,759 - 156,647,147 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 155,531,906 - 155,539,268 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 155,531,906 - 155,539,268 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 222,552,995 - 222,560,653 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 159,190,786 - 159,198,160 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 159,438,699 - 159,441,754 (+) NCBI Celera 4 144,763,722 - 144,771,060 (+) NCBI Celera Cytogenetic Map 4 q42 NCBI
NANOG Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 7,789,402 - 7,799,146 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 7,787,794 - 7,799,146 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 7,941,998 - 7,951,742 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 7,833,262 - 7,839,922 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 7,833,261 - 7,839,922 NCBI Celera 12 9,520,085 - 9,526,744 (+) NCBI Celera Cytogenetic Map 12 p13.31 NCBI HuRef 12 7,755,619 - 7,762,294 (+) NCBI HuRef CHM1_1 12 7,941,303 - 7,947,961 (+) NCBI CHM1_1 T2T-CHM13v2.0 12 7,803,995 - 7,813,735 (+) NCBI T2T-CHM13v2.0
Nanog Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 122,684,448 - 122,691,592 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 122,684,448 - 122,691,592 (+) Ensembl GRCm39 Ensembl GRCm38 6 122,707,489 - 122,714,633 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 122,707,489 - 122,714,633 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 122,657,586 - 122,663,796 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 122,673,114 - 122,680,252 (+) NCBI MGSCv36 mm8 Celera 6 124,507,792 - 124,514,310 (+) NCBI Celera Cytogenetic Map 6 F1 NCBI cM Map 6 57.8 NCBI
Nanog Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955413 6,561,323 - 6,565,770 (+) NCBI ChiLan1.0 ChiLan1.0
NANOG Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 13,347,790 - 13,354,739 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 13,344,549 - 13,351,498 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 7,913,037 - 7,919,715 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 8,070,877 - 8,077,556 (+) NCBI panpan1.1 PanPan1.1 panPan2
NANOG Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 27 37,262,558 - 37,266,449 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 27 9,348,312 - 9,354,207 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 27 37,614,640 - 37,620,732 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 27 37,614,640 - 37,620,302 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 27 37,494,510 - 37,500,598 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 27 37,530,317 - 37,536,638 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 27 8,831,817 - 8,837,819 (-) NCBI UU_Cfam_GSD_1.0
Nanog
NANOG Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 5 62,932,382 - 62,939,082 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 5 62,931,642 - 62,939,086 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 5 65,798,046 - 65,843,373 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
NANOG
Nanog
.
Predicted Target Of
Count of predictions: 119 Count of miRNA genes: 98 Interacting mature miRNAs: 101 Transcripts: ENSRNOT00000060937 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
6478754 Anxrr43 Anxiety related response QTL 43 0.14035 locomotor behavior trait (VT:0001392) distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493) 4 144639524 182687754 Rat 724558 Plsm2 Polydactyly-luxate syndrome (PLS) morphotypes QTL 2 0.0003 hindlimb integrity trait (VT:0010563) hind foot phalanges count (CMO:0001949) 4 132422778 177422778 Rat 1582237 Kidm34 Kidney mass QTL 34 4 0.0001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 4 148090542 168069246 Rat 61446 Coreg2 Compensatory renal growth QTL 2 3.5 kidney mass (VT:0002707) compensatory renal growth score (CMO:0001894) 4 148423102 157580971 Rat 6478693 Anxrr32 Anxiety related response QTL 32 0.00092 locomotor behavior trait (VT:0001392) measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957) 4 144639524 182687754 Rat 10755501 Bp390 Blood pressure QTL 390 2.5 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 4 26775591 168368347 Rat 631683 Bp116 Blood pressure QTL 116 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 124303370 169303370 Rat 61451 Ciaa4 CIA Autoantibody QTL 4 3.1 blood autoantibody amount (VT:0003725) calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281) 4 126395976 167139601 Rat 1331802 Srn5 Serum renin concentration QTL 5 3.045 renin activity (VT:0005581) plasma renin activity level (CMO:0000116) 4 119428175 157578333 Rat 1331738 Bp209 Blood pressure QTL 209 2.979 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 138503169 179293946 Rat 6478700 Anxrr33 Anxiety related response QTL 33 0.00896 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 144639524 182687754 Rat 1298524 Oia8 Oil induced arthritis QTL 8 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 138503169 173369699 Rat 10053718 Scort25 Serum corticosterone level QTL 25 2.15 0.0097 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 155561574 182687754 Rat 1549827 Scl46 Serum cholesterol level QTL 46 3.5 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 4 132396220 177396220 Rat 634335 Anxrr16 Anxiety related response QTL 16 7.22 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 4 93308457 167139447 Rat 737821 Hcar9 Hepatocarcinoma resistance QTL 9 3.7 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 4 109866907 167139601 Rat 7411558 Bw133 Body weight QTL 133 13.84 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 4 125590636 170590636 Rat 6478778 Anxrr51 Anxiety related response QTL 51 0.25384 locomotor behavior trait (VT:0001392) measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957) 4 124778595 169778595 Rat 10401796 Kidm48 Kidney mass QTL 48 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 4 145568712 182687754 Rat 6478718 Anxrr34 Anxiety related response QTL 34 0.00896 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 144639524 182687754 Rat 631511 Pia7 Pristane induced arthritis QTL 7 4.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 131730738 167139601 Rat 1581574 Eae20 Experimental allergic encephalomyelitis QTL 20 7.8 nervous system integrity trait (VT:0010566) percentage of study population developing experimental autoimmune encephalomyelitis during a period of time (CMO:0001047) 4 153031106 158841762 Rat 634347 Hcar8 Hepatocarcinoma resistance QTL 8 5.8 liver integrity trait (VT:0010547) liver tumorous lesion area to total liver area ratio (CMO:0001075) 4 123143783 168143783 Rat 1576316 Ept5 Estrogen-induced pituitary tumorigenesis QTL 5 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 4 83428419 177635233 Rat 2303623 Vencon2 Ventilatory control QTL 2 3.8 respiration trait (VT:0001943) minute ventilation (CMO:0000132) 4 135204660 180204660 Rat 1578674 Bmd12 Bone mineral density QTL 12 3.8 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 4 135699135 180699135 Rat 1358202 Gluco11 Glucose level QTL 11 2.4 0.02 adipocyte glucose uptake trait (VT:0004185) absolute change in adipocyte glucose uptake (CMO:0000873) 4 85379421 167139601 Rat 61422 Cia13 Collagen induced arthritis QTL 13 4.5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 132642577 167139601 Rat 634342 Cia24 Collagen induced arthritis QTL 24 4.5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 146565735 175236377 Rat 737978 Pia23 Pristane induced arthritis QTL 23 5.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 131730738 167139601 Rat 61362 Oia2 Oil induced arthritis QTL 2 0.001 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 138503169 173369699 Rat 631674 Iddm14 Insulin dependent diabetes mellitus QTL 14 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 4 64528739 157573521 Rat 12798519 Anxrr54 Anxiety related response QTL 54 2.54 0.05 locomotor behavior trait (VT:0001392) distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493) 4 114627026 159627026 Rat 2293659 Bmd35 Bone mineral density QTL 35 4.5 0.0001 femur strength trait (VT:0010010) femoral neck ultimate force (CMO:0001703) 4 137755016 181392681 Rat 1331759 Hrtrt13 Heart rate QTL 13 3.54628 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 110275411 168266883 Rat 724535 Cm18 Cardiac mass QTL 18 2.6 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 4 118856416 163856416 Rat 2316958 Gluco58 Glucose level QTL 58 10 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 11320076 180699135 Rat 6478748 Anxrr42 Anxiety related response QTL 42 0.28008 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 144639524 182687754 Rat 12798525 Anxrr57 Anxiety related response QTL 57 3.21 0.05 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 147278504 167139601 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
10
16
40
52
51
20
25
20
6
113
63
20
13
48
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000060937 ⟹ ENSRNOP00000063016
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 155,943,737 - 155,951,116 (+) Ensembl Rnor_6.0 Ensembl 4 155,531,906 - 155,539,268 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000077245 ⟹ ENSRNOP00000071020
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 4 155,532,109 - 155,538,052 (+) Ensembl
RefSeq Acc Id:
NM_001100781 ⟹ NP_001094251
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 157,615,687 - 157,623,061 (+) NCBI mRatBN7.2 4 155,943,737 - 155,951,116 (+) NCBI Rnor_6.0 4 155,531,906 - 155,539,268 (+) NCBI Rnor_5.0 4 222,552,995 - 222,560,653 (+) NCBI RGSC_v3.4 4 159,190,786 - 159,198,160 (+) RGD Celera 4 144,763,722 - 144,771,060 (+) RGD
Sequence:
TCAGATAGGCTGATTTCGAGTCTTTCTCTTTTGTGGGAAGACCGAGGCTCGCTTCTTTTTGGCTTGTTGACTCTTTTACATCTGGACATTTAACTCTTACTTTTAAGATCTTTCCCTCTAGACACTGA
hide sequence
RefSeq Acc Id:
XM_006237310 ⟹ XP_006237372
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 157,615,781 - 157,622,022 (+) NCBI mRatBN7.2 4 155,943,906 - 155,950,010 (+) NCBI Rnor_6.0 4 155,532,109 - 155,538,091 (+) NCBI Rnor_5.0 4 222,552,995 - 222,560,653 (+) NCBI
Sequence:
ATGAGCGTGGATCTTTCTGGTCCCCACAGTCTGCCTAGTTGTGAGGAAGCATCGAACTCTGGGG
hide sequence
RefSeq Acc Id:
NP_001094251 ⟸ NM_001100781
- UniProtKB:
D3ZS29 (UniProtKB/TrEMBL), A6ILF7 (UniProtKB/TrEMBL), A8QWW8 (UniProtKB/TrEMBL)
- Sequence:
MSVDLSGPHSLPSCEEASNSGDSSPMPAVHLPEENYSCLQVSATEMLCTETASPPPSSGDLPLQDSPDSSSNPKLKLSGPEADEGPEKKEENKVLTKKQKMRTVFSQAQLCALKDRFQRQRYLSLQQM
hide sequence
RefSeq Acc Id:
XP_006237372 ⟸ XM_006237310
- Peptide Label:
isoform X1
- UniProtKB:
A8QWW8 (UniProtKB/TrEMBL)
- Sequence:
MSVDLSGPHSLPSCEEASNSGDSSPMPAVHLPEENYSCLQVSATEMLCTETASPPPSSGDLPLQ
hide sequence
Ensembl Acc Id:
ENSRNOP00000071020 ⟸ ENSRNOT00000077245
Ensembl Acc Id:
ENSRNOP00000063016 ⟸ ENSRNOT00000060937
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2005-11-17
Nanog
Nanog homeobox
Symbol and Name status set to approved
1299863 APPROVED
2005-07-14
Nanog
Nanog homeobox
Symbol and Name status set to provisional
70820 PROVISIONAL
