Advanced Search (OLGA)

Gene: Sh2d2a (SH2 domain containing 2A) Rattus norvegicus

Analyze

Symbol:

Sh2d2a

Name:

SH2 domain containing 2A

RGD ID:

1303076

Description:

Predicted to act upstream of or within T cell proliferation. Predicted to be active in cytoplasm. Human ortholog(s) of this gene implicated in juvenile rheumatoid arthritis and multiple sclerosis. Orthologous to human SH2D2A (SH2 domain containing 2A); PARTICIPATES IN Erk5 MAPK signaling pathway; vascular endothelial growth factor signaling pathway; INTERACTS WITH 17beta-estradiol 3-benzoate; 2,2',5,5'-tetrachlorobiphenyl; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

SH2 domain protein 2A; SH2 domain-containing protein 2A

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SH2D2A (SH2 domain containing 2A)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Sh2d2a (SH2 domain containing 2A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Sh2d2a (SH2 domain containing 2A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SH2D2A (SH2 domain containing 2A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SH2D2A (SH2 domain containing 2A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Sh2d2a (SH2 domain containing 2A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SH2D2A (SH2 domain containing 2A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SH2D2A (SH2 domain containing 2A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Sh2d2a (SH2 domain containing 2A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Sh2d2a (SH2 domain containing 2A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	SH2D2A (SH2 domain containing 2A)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	SH2D2A (SH2 domain containing 2A)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Mus musculus (house mouse):	Sh2d2a (SH2 domain containing 2A)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	si:ch73-109i22.2	Alliance	DIOPT (OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	sh2d2a	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	175,610,127 - 175,616,685 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	175,609,874 - 175,616,685 (+)	Ensembl				GRCr8
mRatBN7.2	2	173,312,253 - 173,318,810 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	173,312,253 - 173,318,810 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	180,457,085 - 180,463,488 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	178,479,436 - 178,485,839 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	173,078,849 - 173,085,887 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	187,218,851 - 187,225,000 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	187,218,851 - 187,225,002 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	206,622,869 - 206,629,299 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	179,916,108 - 179,924,623 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	167,261,996 - 167,268,655 (+)	NCBI		Celera
RGSC_v3.1	2	179,866,213 - 179,874,729 (+)	NCBI
Cytogenetic Map	2	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

COVID-19 (ISO)

juvenile rheumatoid arthritis (ISO)

multiple sclerosis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(S)-nicotine (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

17beta-estradiol 3-benzoate (EXP)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

acetamide (EXP)

actinomycin D (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

benzene (ISO)

beta-lapachone (ISO)

bisphenol A (EXP)

Bufotalin (ISO)

butanal (ISO)

Butylbenzyl phthalate (ISO)

cadmium dichloride (ISO)

carbamazepine (ISO)

CGP 52608 (ISO)

cisplatin (ISO)

copper(II) chloride (ISO)

cyclosporin A (ISO)

DDE (ISO)

decabromodiphenyl ether (EXP)

diallyl trisulfide (ISO)

dicrotophos (ISO)

folic acid (ISO)

formaldehyde (ISO)

hydrogen peroxide (ISO)

lead diacetate (ISO)

methotrexate (ISO)

mono(2-ethylhexyl) phthalate (ISO)

N-nitrosodiethylamine (ISO)

nickel atom (ISO)

nicotine (ISO)

Nutlin-3 (ISO)

ozone (ISO)

paclitaxel (ISO)

PCB138 (EXP)

rotenone (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

tebuconazole (ISO)

theophylline (ISO)

thioacetamide (EXP)

thiram (ISO)

tremolite asbestos (ISO)

trichloroethene (EXP)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell population proliferation (ISO)

T cell activation (IBA)

Cellular Component

cytoplasm (IBA)

Molecular Function

protein binding (ISO)

protein-macromolecule adaptor activity (IBA)

Molecular Pathway Annotations Click to see Annotation Detail View

Erk5 MAPK signaling pathway (ISO)

vascular endothelial growth factor signaling pathway (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	The T cell regulator gene SH2D2A contributes to the genetic susceptibility of multiple sclerosis.	Dai KZ, etal., Genes Immun 2001 Aug;2(5):263-8.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Vascular endothelial growth factor receptor-2: structure, function, intracellular signalling and therapeutic inhibition.	Holmes K, etal., Cell Signal. 2007 Oct;19(10):2003-12. Epub 2007 Jun 12.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	cDNA cloning of a rat orthologue of SH2D2A encoding T-cell-specific adaptor protein (TSAd): expression in T and NK cells.	Nejad S, etal., Immunogenetics 2004 Aug;56(5):338-42. Epub 2004 Aug 05.
6.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
7.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
8.	GOA pipeline	RGD automated data pipeline
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
10.	Genetic association between juvenile rheumatoid arthritis and polymorphism in the SH2D2A gene.	Smerdel A, etal., Genes Immun. 2004 Jun;5(4):310-2.
11.	Regulation of cellular functions by the ERK5 signalling pathway.	Wang X and Tournier C, Cell Signal. 2006 Jun;18(6):753-60. Epub 2006 Jan 6.

Additional References at PubMed

PMID:10587356	PMID:12477932

Genomics

Comparative Map Data

Sh2d2a
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	175,610,127 - 175,616,685 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	175,609,874 - 175,616,685 (+)	Ensembl				GRCr8
mRatBN7.2	2	173,312,253 - 173,318,810 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	173,312,253 - 173,318,810 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	180,457,085 - 180,463,488 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	178,479,436 - 178,485,839 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	173,078,849 - 173,085,887 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	187,218,851 - 187,225,000 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	187,218,851 - 187,225,002 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	206,622,869 - 206,629,299 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	179,916,108 - 179,924,623 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	167,261,996 - 167,268,655 (+)	NCBI		Celera
RGSC_v3.1	2	179,866,213 - 179,874,729 (+)	NCBI
Cytogenetic Map	2	q34	NCBI

SH2D2A
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	156,806,243 - 156,816,848 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	156,806,235 - 156,817,014 (-)	Ensembl			hg38	GRCh38
GRCh37	1	156,776,035 - 156,786,640 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	155,042,659 - 155,053,226 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	1	153,589,108 - 153,599,675	NCBI
Celera	1	129,847,281 - 129,857,885 (-)	NCBI		Celera
Cytogenetic Map	1	q23.1	NCBI
HuRef	1	128,134,438 - 128,145,042 (-)	NCBI		HuRef
CHM1_1	1	158,172,230 - 158,182,834 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	155,943,096 - 155,953,700 (-)	NCBI		T2T-CHM13v2.0

Sh2d2a
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	87,754,070 - 87,763,116 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	87,754,062 - 87,763,029 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	3	87,846,755 - 87,855,722 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	87,846,755 - 87,855,722 (+)	Ensembl			mm10	GRCm38
MGSCv37	3	87,650,677 - 87,659,644 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	3	87,932,682 - 87,941,649 (+)	NCBI		MGSCv36	mm8
Celera	3	87,884,659 - 87,893,630 (+)	NCBI		Celera
Cytogenetic Map	3	F1	NCBI
cM Map	3	38.78	NCBI

Sh2d2a
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955545	2,881,563 - 2,891,509 (-)	Ensembl
ChiLan1.0	NW_004955545	2,881,954 - 2,891,021 (-)	NCBI	ChiLan1.0	ChiLan1.0

SH2D2A
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	93,027,857 - 93,039,540 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	92,762,325 - 92,774,014 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	132,149,450 - 132,160,280 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	135,971,890 - 135,982,397 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	135,972,824 - 135,981,754 (-)	Ensembl			panPan2	panpan1.1

SH2D2A
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	7	41,186,721 - 41,195,987 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	7	41,186,252 - 41,195,122 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	7	40,673,749 - 40,683,087 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	7	41,049,182 - 41,058,518 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	7	41,049,235 - 41,058,512 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	7	40,831,204 - 40,840,537 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	7	40,884,238 - 40,893,772 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	7	41,167,749 - 41,177,088 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Sh2d2a
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	26,929,765 - 26,936,931 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936580	5,961,000 - 5,966,677 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936580	5,959,971 - 5,967,250 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SH2D2A
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	93,282,413 - 93,293,205 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	4	93,282,383 - 93,293,214 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	101,854,517 - 101,864,860 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SH2D2A
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	7,052,170 - 7,063,262 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	7,052,797 - 7,062,324 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666038	6,341,230 - 6,352,247 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Sh2d2a
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624885	1,952,387 - 1,960,424 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624885	1,951,442 - 1,960,292 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Sh2d2a
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	3	65,705,905 - 65,712,515 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Sh2d2a
42 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	277
Count of miRNA genes:	179
Interacting mature miRNAs:	193
Transcripts:	ENSRNOT00000017798
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1358356	Srcrt1	Stress Responsive Cort QTL1	3.66		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	2	163997722	225110681	Rat
1578648	Bss11	Bone structure and strength QTL 11	4.7		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	2	169358774	214358774	Rat
1331734	Bp204	Blood pressure QTL 204	3.61192		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	170656145	239614549	Rat
631566	Bp90	Blood pressure QTL 90		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	149957381	221199885	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	44537979	205135428	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	67845370	229470703	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	83465462	229820014	Rat
10755499	Bp389	Blood pressure QTL 389	2.61		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	20695736	231474293	Rat
1298076	Bp166	Blood pressure QTL 166		0.0009	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	138595962	205135428	Rat
1581576	Pur7	Proteinuria QTL 7		0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	2	80396178	220931218	Rat
152025245	Scl81	Serum cholesterol level QTL 81	3.49		blood cholesterol amount (VT:0000180)		2	124537199	209621565	Rat
1581578	Cm49	Cardiac mass QTL 49	4.9	0.01	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	145807215	220931416	Rat
631198	Cm22	Cardiac mass QTL 22	4.3	0.0008	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	78269809	208420281	Rat
1554319	Bmd2	Bone mineral density QTL 2	13.4	0.0001	lumbar vertebra area (VT:0010570)	lumbar vertebra cross-sectional area (CMO:0001689)	2	122597372	215234002	Rat
12879836	Kidm61	Kidney mass QTL 61		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	154723085	199723085	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	80396178	220931218	Rat
10043136	Iddm54	Insulin dependent diabetes mellitus QTL 54	3.4	0.0001	blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	2	145807215	190807215	Rat
12879837	Am2	Aortic mass QTL 2		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	2	154723085	199723085	Rat
10043139	Iddm55	Insulin dependent diabetes mellitus QTL 55	3.1	0.0001	blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	2	150313808	195313808	Rat
12879838	Cm86	Cardiac mass QTL 86		0.002	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	154723085	199723085	Rat
1302793	Bw16	Body weight QTL 16	5	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	2	159440891	205135267	Rat
12879839	Cm85	Cardiac mass QTL 85		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	2	154723085	199723085	Rat
1549833	Bp257	Blood pressure QTL 257		0.003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	170652929	215652929	Rat
1358900	Bw48	Body weight QTL 48	4.88		body mass (VT:0001259)	body weight (CMO:0000012)	2	159440891	220931218	Rat
4889834	Pur24	Proteinuria QTL 24	5.8	0.014	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	2	171994826	205135428	Rat
12879845	Cm89	Cardiac mass QTL 89		0.008	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	154723085	178247591	Rat
61473	Bp19	Blood pressure QTL 19	6.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	175008837	178247591	Rat
1359030	Bp277	Blood pressure QTL 277			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	143565208	188565208	Rat
12879846	Cm90	Cardiac mass QTL 90		0.011	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	2	154723085	178247591	Rat
12879847	Am4	Aortic mass QTL 4		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	2	154723085	178247591	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	4265106	205135428	Rat
12879840	Bw179	Body weight QTL 179		0.005	body mass (VT:0001259)	body weight (CMO:0000012)	2	154723085	199723085	Rat
1581502	Esta3	Estrogen-induced thymic atrophy QTL 3			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	2	139067258	192287892	Rat
1359032	Hrtrt18	Heart rate QTL 18			heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	2	159440760	195313808	Rat
2301966	Bp322	Blood pressure QTL 322	3.58		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	144882354	205135428	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	67845182	205135428	Rat
1357991	Ael2	Aortic elastin QTL 2	4.2	0.000071	aorta elastin amount (VT:0003905)	aortic elastin	2	169227906	214227906	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	83400752	223709938	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	44537979	205135428	Rat
1359022	Ppulsi1	Prepulse inhibition QTL 1	3.63		prepulse inhibition trait (VT:0003088)	acoustic startle response measurement (CMO:0001519)	2	139067258	184067258	Rat
1641891	Alcrsp17	Alcohol response QTL 17			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	151869660	251712708	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	80396034	220931416	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	78269809	205135428	Rat
8662843	Vetf9	Vascular elastic tissue fragility QTL 9	2.05		thoracic aorta molecular composition trait (VT:0010568)	aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003)	2	159440760	228950743	Rat
2301415	Cm67	Cardiac mass QTL 67		0.003	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	2	154723085	178247591	Rat
1331794	Bp202	Blood pressure QTL 202	3.66819		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	143344967	251712708	Rat
71113	Cari2	Carrageenan-induced inflammation QTL 2	2.7	0.009	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	2	143746578	205135428	Rat
1331805	Cm29	Cardiac mass QTL 29	3.50746		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	2	143344967	251712708	Rat
11565180	Kidm56	Kidney mass QTL 56		0.003	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	154723085	178247591	Rat
634308	Sach6	Saccharin preference QTL 6	4.9		taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	2	114384617	215381366	Rat
1598805	Memor8	Memory QTL 8	3		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	2	150096616	195096616	Rat
11565181	Bw176	Body weight QTL 176		0.002	body mass (VT:0001259)	body weight (CMO:0000012)	2	154723085	178247591	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
724568	Uae13	Urinary albumin excretion QTL 13	4.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	2	145306936	212705578	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
1300165	Rf9	Renal function QTL 9	3.28		kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	2	113746222	205135428	Rat
61401	Niddm2	Non-insulin dependent diabetes mellitus QTL 2	4.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	147287892	192287892	Rat
631507	Bp105	Blood pressure QTL 105		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	114384617	215381366	Rat
1641925	Alcrsp2	Alcohol response QTL 2			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	151869660	223841096	Rat
1354609	Niddm62	Non-insulin dependent diabetes mellitus QTL 62	4.72	0.000006	insulin secretion trait (VT:0003564)	plasma insulin level (CMO:0000342)	2	117415288	205135428	Rat
1598833	Bp295	Blood pressure QTL 295	3.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	150096616	195096616	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	83465462	225110681	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	47856345	205135428	Rat
631522	Bp74	Blood pressure QTL 74		0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	175008837	220008837	Rat
7488927	Bp365	Blood pressure QTL 365		0.008	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	165453811	210453811	Rat
7488925	Bp364	Blood pressure QTL 364		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	163253030	208253030	Rat
2293843	Kiddil6	Kidney dilation QTL 6	3.1		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	44537979	184731399	Rat
2306901	Bp337	Blood pressure QTL 337		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	166372086	229820014	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	76328396	209350714	Rat
7488904	Bp363	Blood pressure QTL 363		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	175279960	178247591	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	55	79	89	88	57	92	57	6	340	180	11	50	79	90	31	4	4

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_207605	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC119000	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF468787	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC088087	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473976	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000017798 ⟹ ENSRNOP00000017798

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	175,609,874 - 175,616,677 (+)	Ensembl
mRatBN7.2 Ensembl	2	173,312,253 - 173,318,810 (+)	Ensembl
Rnor_6.0 Ensembl	2	187,218,851 - 187,225,002 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000171050 ⟹ ENSRNOP00000106548

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	175,610,985 - 175,616,685 (+)	Ensembl

RefSeq Acc Id:

NM_207605 ⟹ NP_997488

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	175,610,127 - 175,616,685 (+)	NCBI
mRatBN7.2	2	173,312,253 - 173,318,810 (+)	NCBI
Rnor_6.0	2	187,218,851 - 187,225,000 (+)	NCBI
Rnor_5.0	2	206,622,869 - 206,629,299 (+)	NCBI
RGSC_v3.4	2	179,916,108 - 179,924,623 (+)	RGD
Celera	2	167,261,996 - 167,268,655 (+)	RGD

Sequence:

show sequence

CCTCTTTTGAGAGCACACACACCTGCTTCTATGGAGTTCTGCTTGGCCCAGACATGTCCCCAAG
GGAATCATGAAGCCACCTCCCCAACCTTCAGCACCTTCCAGCCCATGAACCTGACCCAGGGGAG
ATGCCAGGACTTGGGTTGTGGGGGCAAGCCCAGCATGCAGGCTCTGAGGGAACAGGAGGTTCAG
CTCAGCCCCAGGGTCACCCACACGGTGGCCTCTGCCTCAGCCCCAGGAGCTGCCTGGGTCCTAG
AGAGTGTCAACAGGGAGGAAGAGGAACCTGGGAAAGGTGAACTGTCATTGCAAGCTGAGACCAG
AGCATGGGTTCAGAAGACCCAGGCCCACTGGCTCTTGCTCAGGACTGCCCCGCTTTGGTTCCAT
GGCTTCATTACCAGAAGGGAAGCTGAGAGGCTACTGCAGTCCCAACCTCTAGGATGCTATCTGG
TGCGCTTCAGCGAGAGCGCTGTGACCTTCGTGCTGTCCTACAGGAGCCGAACCTGCTGCCGTCA
CTTCCTCCTTGCTCAGCTAGGGGATGGGCGCCACGTGGTGCTGGGTGAAGACAGTGCCCACTCG
CAGCTTCAGGACCTGCTTCAACACTACACAGAGTGCCCCCTCAGCCCCTACGGGGAGATGCTCA
CCCAACCCCTTGCTCGCCAGACAGCTGAGCCTGCCGGTCTTTCCCTAAGGGGTGAATCAGACTC
TGGAAGCAGAAGACAGGACCCAGACACCCAGCACAGCCTGTTCATCCAACAGGGGCAGGCCCAT
GCCCAGGCCCCAGGACATAAAGAGAAAGTGAGGGCCTCCCAACAGAAGAAGACTTCCCAGGCAT
CCAGACCCAGGCCCCCCATTCCTGCCAAGCCTCAGCTACCTCTTGAAGTCTACACAAGTCCTGC
TCCACGACCTCATCAGGCCCTACCCATTAACCCCGTCTACCAGGAGCCTGATGAACCCATAGCC
TTCTATGCCATGGGGCGGGGCAGCCCTGGGGATGCTCCTAGTAATATCTATGCTGAGGTGGATG
GCCCACGGGAAATGCTACCCATTGGGCACCCCACCCTCCATAAGTGCTGGTCCAGGCCTATCTC
AGGAGGCCAGGGAAAGGGGGTACAGGGAAAGAAAAGCTCAAGAAGGCCAGCAGGAAGAGGGAGC
CCCTCCTGAACGGCAGGCAAGGCGAAGGAAGAAGCAGGCTGAACCAAAATGGAATGGACCATGC
TACTGAAAACCTTTGCCCAGCCCCAGGCCTGAGGTTGTTCCTGGACATGCACATGGACTCAGCT
TTGTCAAGCTCTACCTGCCCCTACTCCTGAGAACATTAAAGGTGATGGGTTTCCTTCAACCTTT
CTCCATCCCAGGCTGCCTCTTGTCAGTCAGGCCTTCCTCAGATACATGTGGCACTGATCCAGTT
CCTCGGAGAAGAGCGCTTAGGAGCCCATGCATTGCCACCAGTGGGCTCAGAGGAGGAGGCCACC
CATTGTGTGCTTGCCCTCACAGTTTCCCCCACAGATAGTTTCATGTCTGAATGTGGTATTAATA
TTAAATGAGTTGGACTCTTGCCCCTGAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_997488	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH88087	(Get FASTA)	NCBI Sequence Viewer
	AAQ05035	(Get FASTA)	NCBI Sequence Viewer
	EDM00767	(Get FASTA)	NCBI Sequence Viewer
	EDM00768	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000017798
	ENSRNOP00000017798.4
	ENSRNOP00000106548.1

RefSeq Acc Id:

NP_997488 ⟸ NM_207605

- UniProtKB:

Q5I0Q2 (UniProtKB/TrEMBL), F7FF77 (UniProtKB/TrEMBL), Q71LH9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEFCLAQTCPQGNHEATSPTFSTFQPMNLTQGRCQDLGCGGKPSMQALREQEVQLSPRVTHTVA
SASAPGAAWVLESVNREEEEPGKGELSLQAETRAWVQKTQAHWLLLRTAPLWFHGFITRREAER
LLQSQPLGCYLVRFSESAVTFVLSYRSRTCCRHFLLAQLGDGRHVVLGEDSAHSQLQDLLQHYT
ECPLSPYGEMLTQPLARQTAEPAGLSLRGESDSGSRRQDPDTQHSLFIQQGQAHAQAPGHKEKV
RASQQKKTSQASRPRPPIPAKPQLPLEVYTSPAPRPHQALPINPVYQEPDEPIAFYAMGRGSPG
DAPSNIYAEVDGPREMLPIGHPTLHKCWSRPISGGQGKGVQGKKSSRRPAGRGSPS

hide sequence

Ensembl Acc Id:

ENSRNOP00000017798 ⟸ ENSRNOT00000017798

Ensembl Acc Id:

ENSRNOP00000106548 ⟸ ENSRNOT00000171050

Protein Domains

SH2

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5I0Q2-F1-model_v2	AlphaFold	Q5I0Q2	1-376	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13691421

Promoter ID:

EPDNEW_R1944

Type:

initiation region

Name:

Sh2d2a_1

Description:

SH2 domain containing 2A

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	2	187,218,867 - 187,218,927	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1303076	AgrOrtholog
BioCyc Gene	G2FUF-52533	BioCyc
Ensembl Genes	ENSRNOG00000013294	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000017798	ENTREZGENE
	ENSRNOT00000017798.9	UniProtKB/TrEMBL
	ENSRNOT00000171050.1	UniProtKB/TrEMBL
Gene3D-CATH	3.30.505.10	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7379832	IMAGE-MGC_LOAD
InterPro	SH2	UniProtKB/TrEMBL
	SH2_dom_sf	UniProtKB/TrEMBL
KEGG Report	rno:310688	UniProtKB/TrEMBL
MGC_CLONE	MGC:108514	IMAGE-MGC_LOAD
NCBI Gene	310688	ENTREZGENE
PANTHER	SH2 DOMAIN-CONTAINING PROTEIN 2A	UniProtKB/TrEMBL
	T CELL-SPECIFIC ADAPTER PROTEIN TSAD	UniProtKB/TrEMBL
Pfam	SH2	UniProtKB/TrEMBL
PhenoGen	Sh2d2a	PhenoGen
PRINTS	SH2DOMAIN	UniProtKB/TrEMBL
PROSITE	SH2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000013294	RatGTEx
SMART	SH2	UniProtKB/TrEMBL
Superfamily-SCOP	SSF55550	UniProtKB/TrEMBL
UniProt	A0ABK0LNN0_RAT	UniProtKB/TrEMBL
	A6J622_RAT	UniProtKB/TrEMBL
	F7FF77	ENTREZGENE, UniProtKB/TrEMBL
	Q5I0Q2	ENTREZGENE, UniProtKB/TrEMBL
	Q71LH9	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2011-08-01	Sh2d2a	SH2 domain containing 2A	Sh2d2a	SH2 domain protein 2A	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Sh2d2a	SH2 domain protein 2A			Symbol and Name status set to approved	1299863	APPROVED
2005-02-14	Sh2d2a	SH2 domain protein 2A			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Send us a Message

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)