Symbol:
Tomm70
Name:
translocase of outer mitochondrial membrane 70
RGD ID:
1303049
Description:
Predicted to enable mitochondrion targeting sequence binding activity and molecular adaptor activity. Predicted to contribute to protein transmembrane transporter activity. Involved in several processes, including negative regulation of cell growth involved in cardiac muscle cell development; positive regulation of protein targeting to mitochondrion; and response to thyroxine. Located in mitochondrial outer membrane. Used to study congestive heart failure. Biomarker of hypothyroidism. Orthologous to human TOMM70 (translocase of outer mitochondrial membrane 70); PARTICIPATES IN alpha-helical insertion pathway of mitochondrial protein import; beta-barrel pathway of mitochondrial protein import; carrier pathway of mitochondrial protein import; INTERACTS WITH 2,4-dinitrotoluene; 2,6-dinitrotoluene; 3-chloropropane-1,2-diol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
MGC112570; mitochondrial import receptor subunit TOM70; mitochondrial precursor proteins import receptor; TOM70; Tomm70a; translocase of outer membrane 70 kDa subunit; translocase of outer mitochondrial membrane 70 homolog A; translocase of outer mitochondrial membrane 70 homolog A (S. cerevisiae); translocase of outer mitochondrial membrane 70 homolog A (yeast); translocase of outer mitochondrial membrane protein 70
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Related Pseudogenes:
Tomm70-ps1
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 11 56,847,837 - 56,886,302 (-) NCBI GRCr8 mRatBN7.2 11 43,378,719 - 43,417,166 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 11 43,377,216 - 43,417,202 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 11 52,153,913 - 52,192,339 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 11 44,815,517 - 44,853,943 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 11 43,939,611 - 43,978,037 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 11 45,477,053 - 45,511,409 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 11 45,480,250 - 45,510,961 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 11 48,669,804 - 48,706,365 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 11 44,302,535 - 44,341,250 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 11 44,360,417 - 44,398,702 (-) NCBI Celera 11 43,168,344 - 43,206,551 (-) NCBI Celera Cytogenetic Map 11 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Tomm70 Rat (1->4)-beta-D-glucan multiple interactions ISO Tomm70a (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of TOMM70A mRNA CTD PMID:36331819 Tomm70 Rat (S)-nicotine increases expression ISO Tomm70a (Mus musculus) 6480464 Nicotine results in increased expression of TOMM70A mRNA CTD PMID:21955143 Tomm70 Rat 1,2-dichloroethane decreases expression ISO Tomm70a (Mus musculus) 6480464 ethylene dichloride results in decreased expression of TOMM70A mRNA CTD PMID:28960355 Tomm70 Rat 1,2-dimethylhydrazine multiple interactions ISO Tomm70a (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of TOMM70A mRNA CTD PMID:22206623 Tomm70 Rat 1,2-dimethylhydrazine decreases expression ISO Tomm70a (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of TOMM70A mRNA CTD PMID:22206623 Tomm70 Rat 17alpha-ethynylestradiol increases expression ISO Tomm70a (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of TOMM70A mRNA CTD PMID:17942748 Tomm70 Rat 17alpha-ethynylestradiol multiple interactions ISO Tomm70a (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of TOMM70A mRNA CTD PMID:17942748 Tomm70 Rat 17beta-estradiol multiple interactions ISO TOMM70 (Homo sapiens) 6480464 Estradiol promotes the reaction [TOMM70A protein binds to ESR1 protein] CTD PMID:27156127 Tomm70 Rat 17beta-estradiol increases expression ISO Tomm70a (Mus musculus) 6480464 Estradiol results in increased expression of TOMM70A mRNA CTD PMID:39298647 Tomm70 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Tomm70a (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of TOMM70A mRNA CTD PMID:17942748 Tomm70 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Tomm70a (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of TOMM70A mRNA CTD PMID:17942748 Tomm70 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of TOMM70 mRNA CTD PMID:21346803 Tomm70 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of TOMM70 mRNA CTD PMID:21346803 Tomm70 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of TOMM70 protein CTD PMID:34915118 Tomm70 Rat 4,4'-sulfonyldiphenol increases expression ISO Tomm70a (Mus musculus) 6480464 bisphenol S results in increased expression of TOMM70A mRNA CTD PMID:39298647 Tomm70 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of TOMM70 mRNA CTD PMID:31881176 Tomm70 Rat aflatoxin B1 decreases expression ISO Tomm70a (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of TOMM70A mRNA CTD PMID:19770486 Tomm70 Rat aflatoxin B1 decreases methylation ISO TOMM70 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of TOMM70A gene CTD PMID:27153756 Tomm70 Rat all-trans-retinoic acid decreases expression ISO Tomm70a (Mus musculus) 6480464 Tretinoin results in decreased expression of TOMM70A mRNA CTD PMID:16169686 Tomm70 Rat all-trans-retinoic acid decreases expression ISO TOMM70 (Homo sapiens) 6480464 Tretinoin results in decreased expression of TOMM70A mRNA CTD PMID:33167477 Tomm70 Rat arsane multiple interactions ISO TOMM70 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of TOMM70 mRNA CTD PMID:39836092 Tomm70 Rat arsenic atom multiple interactions ISO TOMM70 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of TOMM70 mRNA CTD PMID:39836092 Tomm70 Rat atrazine increases expression ISO TOMM70 (Homo sapiens) 6480464 Atrazine results in increased expression of TOMM70 mRNA CTD PMID:22378314 Tomm70 Rat benzo[a]pyrene multiple interactions ISO Tomm70a (Mus musculus) 6480464 Benzo(a)pyrene promotes the reaction [AHR protein binds to TOMM70A promoter] CTD PMID:19654925 Tomm70 Rat benzo[a]pyrene affects methylation ISO TOMM70 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of TOMM70A intron CTD PMID:30157460 Tomm70 Rat benzo[a]pyrene increases expression ISO Tomm70a (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of TOMM70A mRNA CTD PMID:19770486 and PMID:22228805 Tomm70 Rat benzo[a]pyrene diol epoxide I decreases expression ISO TOMM70 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Tomm70 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of TOMM70 mRNA and bisphenol A results in increased expression of TOMM70A mRNA CTD PMID:25181051 and PMID:32145629 Tomm70 Rat bisphenol A increases expression ISO TOMM70 (Homo sapiens) 6480464 bisphenol A results in increased expression of TOMM70 protein CTD PMID:37567409 Tomm70 Rat bisphenol A decreases expression ISO Tomm70a (Mus musculus) 6480464 bisphenol A results in decreased expression of TOMM70A mRNA CTD PMID:33221593 Tomm70 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of TOMM70 mRNA CTD PMID:30816183 and PMID:34947998 Tomm70 Rat bisphenol A affects methylation ISO Tomm70a (Mus musculus) 6480464 bisphenol A affects the methylation of TOMM70A promoter CTD PMID:27334623 Tomm70 Rat bisphenol AF increases expression ISO TOMM70 (Homo sapiens) 6480464 bisphenol AF results in increased expression of TOMM70 protein CTD PMID:34186270 Tomm70 Rat Bisphenol B increases expression ISO TOMM70 (Homo sapiens) 6480464 bisphenol B results in increased expression of TOMM70 protein CTD PMID:34186270 Tomm70 Rat cadmium atom multiple interactions ISO TOMM70 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of TOMM70 mRNA CTD PMID:35301059 Tomm70 Rat cadmium atom multiple interactions ISO Tomm70a (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of TOMM70A mRNA CTD PMID:37325564 Tomm70 Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of TOMM70 mRNA CTD PMID:33453195 Tomm70 Rat cadmium dichloride multiple interactions ISO Tomm70a (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of TOMM70A mRNA CTD PMID:37325564 Tomm70 Rat cadmium dichloride multiple interactions ISO TOMM70 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of TOMM70 mRNA CTD PMID:35301059 Tomm70 Rat cadmium dichloride decreases expression ISO TOMM70 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of TOMM70 mRNA CTD PMID:38568856 Tomm70 Rat caffeine affects phosphorylation ISO TOMM70 (Homo sapiens) 6480464 Caffeine affects the phosphorylation of TOMM70 protein CTD PMID:35688186 Tomm70 Rat CGP 52608 multiple interactions ISO TOMM70 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to TOMM70A gene] CTD PMID:28238834 Tomm70 Rat chlorpyrifos decreases expression ISO Tomm70a (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of TOMM70A mRNA CTD PMID:37019170 Tomm70 Rat chromium(6+) multiple interactions ISO TOMM70 (Homo sapiens) 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in increased expression of TOMM70 mRNA CTD PMID:38479592 Tomm70 Rat clofibrate multiple interactions ISO Tomm70a (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of TOMM70A mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of TOMM70A mRNA] CTD PMID:17585979 Tomm70 Rat clofibrate increases expression ISO Tomm70a (Mus musculus) 6480464 Clofibrate results in increased expression of TOMM70A mRNA CTD PMID:17585979 Tomm70 Rat cobalt dichloride increases expression ISO TOMM70 (Homo sapiens) 6480464 cobaltous chloride results in increased expression of TOMM70 mRNA CTD PMID:19376846 Tomm70 Rat copper(II) sulfate decreases expression ISO TOMM70 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of TOMM70 mRNA CTD PMID:19549813 Tomm70 Rat coumarin increases phosphorylation ISO TOMM70 (Homo sapiens) 6480464 coumarin results in increased phosphorylation of TOMM70 protein CTD PMID:35688186 Tomm70 Rat deoxynivalenol increases phosphorylation ISO Tomm70a (Mus musculus) 6480464 deoxynivalenol results in increased phosphorylation of TOMM70A protein CTD PMID:23352502 Tomm70 Rat deoxynivalenol decreases expression ISO TOMM70 (Homo sapiens) 6480464 deoxynivalenol results in decreased expression of TOMM70A protein CTD PMID:33890134 Tomm70 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of TOMM70 mRNA CTD PMID:21266533 Tomm70 Rat dicrotophos decreases expression ISO TOMM70 (Homo sapiens) 6480464 dicrotophos results in decreased expression of TOMM70A mRNA CTD PMID:28302478 Tomm70 Rat dioxygen multiple interactions ISO Tomm70a (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of TOMM70A mRNA CTD PMID:30529165 Tomm70 Rat enzyme inhibitor multiple interactions ISO TOMM70 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of TOMM70 protein CTD PMID:23301498 Tomm70 Rat ethanol decreases expression ISO Tomm70a (Mus musculus) 6480464 Ethanol results in decreased expression of TOMM70A mRNA CTD PMID:21955143 Tomm70 Rat ethanol affects splicing ISO Tomm70a (Mus musculus) 6480464 Ethanol affects the splicing of TOMM70A mRNA CTD PMID:30319688 Tomm70 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of TOMM70A mRNA CTD PMID:24136188 Tomm70 Rat folic acid decreases expression ISO Tomm70a (Mus musculus) 6480464 Folic Acid results in decreased expression of TOMM70A mRNA CTD PMID:25629700 Tomm70 Rat folic acid multiple interactions ISO Tomm70a (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of TOMM70A mRNA CTD PMID:22206623 Tomm70 Rat FR900359 affects phosphorylation ISO TOMM70 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of TOMM70 protein CTD PMID:37730182 Tomm70 Rat furfural multiple interactions ISO TOMM70 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of TOMM70 protein CTD PMID:38598786 Tomm70 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of TOM70 mRNA CTD PMID:22061828 Tomm70 Rat isotretinoin decreases expression ISO TOMM70 (Homo sapiens) 6480464 Isotretinoin results in decreased expression of TOMM70 mRNA CTD PMID:20436886 Tomm70 Rat ivermectin decreases expression ISO TOMM70 (Homo sapiens) 6480464 Ivermectin results in decreased expression of TOMM70 protein CTD PMID:32959892 Tomm70 Rat manganese atom multiple interactions ISO TOMM70 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of TOMM70 mRNA CTD PMID:39836092 Tomm70 Rat manganese(0) multiple interactions ISO TOMM70 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of TOMM70 mRNA CTD PMID:39836092 Tomm70 Rat manganese(II) chloride multiple interactions ISO TOMM70 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of TOMM70 mRNA CTD PMID:39836092 Tomm70 Rat morphine decreases expression ISO Tomm70a (Mus musculus) 6480464 Morphine results in decreased expression of TOMM70A mRNA CTD PMID:21955143 Tomm70 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of TOMM70A mRNA CTD PMID:24136188 Tomm70 Rat nicotine increases expression ISO Tomm70a (Mus musculus) 6480464 Nicotine results in increased expression of TOMM70A mRNA CTD PMID:21955143 Tomm70 Rat nitrates multiple interactions ISO Tomm70a (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of TOMM70A mRNA CTD PMID:35964746 Tomm70 Rat ochratoxin A decreases expression ISO TOMM70 (Homo sapiens) 6480464 ochratoxin A results in decreased expression of TOMM70 protein CTD PMID:26861962 Tomm70 Rat paracetamol affects expression ISO Tomm70a (Mus musculus) 6480464 Acetaminophen affects the expression of TOMM70A mRNA CTD PMID:17562736 Tomm70 Rat paracetamol decreases expression ISO TOMM70 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of TOMM70 mRNA CTD PMID:25704631 Tomm70 Rat paracetamol multiple interactions ISO Tomm70a (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of TOMM70A mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of TOMM70A mRNA] CTD PMID:17585979 Tomm70 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of TOMM70 mRNA CTD PMID:32680482 Tomm70 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Tomm70a (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of TOMM70A mRNA CTD PMID:36331819 Tomm70 Rat phenobarbital decreases expression ISO Tomm70a (Mus musculus) 6480464 Phenobarbital results in decreased expression of TOMM70A mRNA and Phenobarbital results in decreased expression of TOMM70A protein CTD PMID:19363144 and PMID:35881160 Tomm70 Rat phenobarbital increases expression ISO TOMM70 (Homo sapiens) 6480464 Phenobarbital results in increased expression of TOMM70 protein CTD PMID:35881160 Tomm70 Rat pirinixic acid increases expression ISO Tomm70a (Mus musculus) 6480464 pirinixic acid results in increased expression of TOMM70A mRNA CTD PMID:17426115 more ... Tomm70 Rat resveratrol increases expression ISO Tomm70a (Mus musculus) 6480464 resveratrol results in increased expression of TOMM70A protein CTD PMID:25505154 Tomm70 Rat resveratrol multiple interactions ISO TOMM70 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of TOMM70 mRNA CTD PMID:23557933 Tomm70 Rat rotenone decreases expression ISO Tomm70a (Mus musculus) 6480464 Rotenone results in decreased expression of TOMM70A mRNA CTD PMID:23186747 Tomm70 Rat rotenone decreases expression ISO TOMM70 (Homo sapiens) 6480464 Rotenone results in decreased expression of TOMM70 mRNA CTD PMID:33512557 Tomm70 Rat SB 431542 multiple interactions ISO TOMM70 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in decreased expression of TOMM70 protein CTD PMID:37664457 Tomm70 Rat sodium arsenite multiple interactions ISO TOMM70 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of TOMM70 mRNA CTD PMID:39836092 Tomm70 Rat sodium chloride multiple interactions ISO TOMM70 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of TOMM70 protein CTD PMID:38598786 Tomm70 Rat Soman increases expression EXP 6480464 Soman results in increased expression of TOMM70 mRNA CTD PMID:19281266 Tomm70 Rat tebufenpyrad decreases expression ISO TOMM70 (Homo sapiens) 6480464 4-chloro-N-((4-(1 and 1-dimethylethyl)phenyl)methyl)-3-ethyl-1-methyl-1H-pyrazole-5-carboxamide results in decreased expression of TOMM70 mRNA CTD PMID:33512557 Tomm70 Rat tetrachloromethane increases expression ISO Tomm70a (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of TOMM70A mRNA CTD PMID:31919559 Tomm70 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of TOMM70 mRNA CTD PMID:34492290 Tomm70 Rat titanium dioxide increases methylation ISO Tomm70a (Mus musculus) 6480464 titanium dioxide results in increased methylation of TOMM70A gene CTD PMID:35295148 Tomm70 Rat trimellitic anhydride increases expression ISO Tomm70a (Mus musculus) 6480464 trimellitic anhydride results in increased expression of TOMM70A mRNA CTD PMID:19042947 Tomm70 Rat triphenyl phosphate affects expression EXP 6480464 triphenyl phosphate affects the expression of TOMM70A mRNA CTD PMID:30589522 Tomm70 Rat triphenyl phosphate affects expression ISO TOMM70 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of TOMM70 mRNA CTD PMID:37042841 Tomm70 Rat trovafloxacin decreases expression EXP 6480464 trovafloxacin results in decreased expression of TOMM70A mRNA CTD PMID:24136188 Tomm70 Rat valproic acid decreases expression ISO TOMM70 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of TOMM70 mRNA and Valproic Acid results in decreased expression of TOMM70A mRNA CTD PMID:23179753 and PMID:27188386 Tomm70 Rat valproic acid affects splicing EXP 6480464 Valproic Acid affects the splicing of TOMM70A mRNA CTD PMID:29427782 Tomm70 Rat vincristine decreases expression ISO TOMM70 (Homo sapiens) 6480464 Vincristine results in decreased expression of TOMM70 mRNA CTD PMID:23649840 Tomm70 Rat zearalenone increases expression ISO Tomm70a (Mus musculus) 6480464 Zearalenone results in increased expression of TOMM70A protein CTD PMID:25058043
(1->4)-beta-D-glucan (ISO) (S)-nicotine (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 3-chloropropane-1,2-diol (EXP) 4,4'-sulfonyldiphenol (ISO) acetamide (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) arsane (ISO) arsenic atom (ISO) atrazine (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) caffeine (ISO) CGP 52608 (ISO) chlorpyrifos (ISO) chromium(6+) (ISO) clofibrate (ISO) cobalt dichloride (ISO) copper(II) sulfate (ISO) coumarin (ISO) deoxynivalenol (ISO) dibutyl phthalate (EXP) dicrotophos (ISO) dioxygen (ISO) enzyme inhibitor (ISO) ethanol (ISO) flutamide (EXP) folic acid (ISO) FR900359 (ISO) furfural (ISO) gentamycin (EXP) isotretinoin (ISO) ivermectin (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) morphine (ISO) nefazodone (EXP) nicotine (ISO) nitrates (ISO) ochratoxin A (ISO) paracetamol (ISO) paraquat (EXP) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) pirinixic acid (ISO) resveratrol (ISO) rotenone (ISO) SB 431542 (ISO) sodium arsenite (ISO) sodium chloride (ISO) Soman (EXP) tebufenpyrad (ISO) tetrachloromethane (ISO) thioacetamide (EXP) titanium dioxide (ISO) trimellitic anhydride (ISO) triphenyl phosphate (EXP,ISO) trovafloxacin (EXP) valproic acid (EXP,ISO) vincristine (ISO) zearalenone (ISO)
Biological Process
activation of innate immune response (IEA,ISO,ISS) cellular response to virus (IEA,ISO,ISS) negative regulation of cell growth involved in cardiac muscle cell development (IMP) positive regulation of defense response to virus by host (IEA,ISO,ISS) positive regulation of interferon-beta production (IEA,ISO,ISS) positive regulation of protein targeting to mitochondrion (IMP) protein import into mitochondrial matrix (IBA) protein insertion into mitochondrial inner membrane (IBA) protein targeting to mitochondrion (IMP) regulation of apoptotic process (IEA,ISO,ISS) response to thyroxine (IEP)
1.
Identification of a mammalian homologue of the fungal Tom70 mitochondrial precursor protein import receptor as a thyroid hormone-regulated gene in specific brain regions.
Alvarez-Dolado M, etal., J Neurochem. 1999 Dec;73(6):2240-9.
2.
Mitochondrial targeting of cytochrome P450 proteins containing NH2-terminal chimeric signals involves an unusual TOM20/TOM22 bypass mechanism.
Anandatheerthavarada HK, etal., J Biol Chem. 2009 Jun 19;284(25):17352-63. doi: 10.1074/jbc.M109.007492. Epub 2009 Apr 28.
3.
Biogenesis of mitochondrial outer membrane proteins, problems and diseases.
Ellenrieder L, etal., Biol Chem. 2015 Oct 1;396(11):1199-213. doi: 10.1515/hsz-2015-0170.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
Phosphoproteome mapping of cardiomyocyte mitochondria in a rat model of heart failure.
Giorgianni F, etal., Mol Cell Biochem. 2014 Apr;389(1-2):159-67. doi: 10.1007/s11010-013-1937-7. Epub 2014 Jan 7.
6.
Assembly of beta-barrel proteins in the mitochondrial outer membrane.
Hohr AI, etal., Biochim Biophys Acta. 2015 Jan;1853(1):74-88. doi: 10.1016/j.bbamcr.2014.10.006. Epub 2014 Oct 8.
7.
Tom70 serves as a molecular switch to determine pathological cardiac hypertrophy.
Li J, etal., Cell Res. 2014 Aug;24(8):977-93. doi: 10.1038/cr.2014.94. Epub 2014 Jul 15.
8.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
9.
GOA pipeline
RGD automated data pipeline
10.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
11.
Impaired transport of mitochondrial transcription factor A (TFAM) and the metabolic memory phenomenon associated with the progression of diabetic retinopathy.
Santos JM and Kowluru RA, Diabetes Metab Res Rev. 2013 Mar;29(3):204-13. doi: 10.1002/dmrr.2384.
12.
Unlocking the presequence import pathway.
Schulz C, etal., Trends Cell Biol. 2015 May;25(5):265-75. doi: 10.1016/j.tcb.2014.12.001. Epub 2014 Dec 23.
13.
Characterization of rat TOM70 as a receptor of the preprotein translocase of the mitochondrial outer membrane.
Suzuki H, etal., J Cell Sci 2002 May 1;115(Pt 9):1895-905.
14.
Cooperation of protein machineries in mitochondrial protein sorting.
Wenz LS, etal., Biochim Biophys Acta. 2015 May;1853(5):1119-29. doi: 10.1016/j.bbamcr.2015.01.012. Epub 2015 Jan 26.
Tomm70 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 11 56,847,837 - 56,886,302 (-) NCBI GRCr8 mRatBN7.2 11 43,378,719 - 43,417,166 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 11 43,377,216 - 43,417,202 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 11 52,153,913 - 52,192,339 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 11 44,815,517 - 44,853,943 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 11 43,939,611 - 43,978,037 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 11 45,477,053 - 45,511,409 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 11 45,480,250 - 45,510,961 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 11 48,669,804 - 48,706,365 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 11 44,302,535 - 44,341,250 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 11 44,360,417 - 44,398,702 (-) NCBI Celera 11 43,168,344 - 43,206,551 (-) NCBI Celera Cytogenetic Map 11 q12 NCBI
TOMM70 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 100,363,431 - 100,401,089 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 100,363,431 - 100,401,089 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 100,082,275 - 100,119,933 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 101,564,997 - 101,602,915 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 101,564,998 - 101,602,915 NCBI Celera 3 98,473,164 - 98,511,084 (-) NCBI Celera Cytogenetic Map 3 q12.2 NCBI HuRef 3 97,450,096 - 97,488,049 (-) NCBI HuRef CHM1_1 3 100,045,331 - 100,083,272 (-) NCBI CHM1_1 T2T-CHM13v2.0 3 103,068,774 - 103,106,448 (-) NCBI T2T-CHM13v2.0
Tomm70a Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 16 56,942,077 - 56,974,893 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 16 56,942,066 - 56,977,068 (+) Ensembl GRCm39 Ensembl GRCm38 16 57,121,714 - 57,154,530 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 16 57,121,703 - 57,156,705 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 16 57,121,827 - 57,154,643 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 16 57,043,073 - 57,075,889 (+) NCBI MGSCv36 mm8 Celera 16 57,455,013 - 57,487,868 (+) NCBI Celera Cytogenetic Map 16 C1.1 NCBI cM Map 16 34.22 NCBI
Tomm70 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955427 1,876,222 - 1,908,737 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955427 1,874,277 - 1,908,245 (-) NCBI ChiLan1.0 ChiLan1.0
TOMM70 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 98,306,633 - 98,344,497 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 98,311,415 - 98,348,981 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 97,459,180 - 97,497,175 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 104,139,473 - 104,177,061 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 104,139,473 - 104,178,074 (-) Ensembl panpan1.1 panPan2
TOMM70 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 33 6,976,322 - 7,009,618 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 33 6,976,934 - 7,009,594 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 33 7,130,612 - 7,165,083 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 33 7,114,093 - 7,148,576 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 33 7,114,753 - 7,148,568 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 33 7,001,694 - 7,036,139 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 33 7,050,040 - 7,084,498 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 33 7,379,916 - 7,414,382 (-) NCBI UU_Cfam_GSD_1.0
Tomm70 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 150,008,687 - 150,042,592 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936630 2,906,581 - 2,940,608 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936630 2,906,573 - 2,938,837 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
TOMM70 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 158,577,379 - 158,628,262 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 158,577,026 - 158,629,878 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 168,193,917 - 168,218,856 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TOMM70 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 22 80,477,429 - 80,516,536 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 22 80,477,872 - 80,516,670 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666041 86,056,352 - 86,094,501 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Tomm70
.
Predicted Target Of
Count of predictions: 167 Count of miRNA genes: 119 Interacting mature miRNAs: 127 Transcripts: ENSRNOT00000002238 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1300147 Bp187 Blood pressure QTL 187 3.67 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 11 1 69446234 Rat 724554 Iddm17 Insulin dependent diabetes mellitus QTL 17 0.001 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 11 18976208 86241447 Rat 70180 BpQTLcluster10 Blood pressure QTL cluster 10 3.19 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 11 34918041 79918041 Rat 8694376 Bw156 Body weight QTL 156 2.25 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 11 23280456 68280456 Rat 10755497 Bp388 Blood pressure QTL 388 2.76 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 11 19456205 76331918 Rat 724517 Uae18 Urinary albumin excretion QTL 18 3.7 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 11 16472047 44285911 Rat 10058952 Gmadr6 Adrenal mass QTL 6 2.29 0.0072 adrenal gland mass (VT:0010420) both adrenal glands wet weight to body weight ratio (CMO:0002411) 11 22959403 67959403 Rat 1300130 Rf20 Renal function QTL 20 4.44 kidney glomerulus integrity trait (VT:0010546) kidney glomerulus diameter (CMO:0001166) 11 29528418 60324829 Rat 1558659 Tescar1 Testicular tumor resistance QTL 1 3.9 testis integrity trait (VT:0010572) percentage of study population developing testis tumors during a period of time (CMO:0001261) 11 1041931 66113562 Rat 2298551 Neuinf10 Neuroinflammation QTL 10 3.7 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 11 31239134 78851519 Rat 1300135 Rf19 Renal function QTL 19 3.38 blood creatinine amount (VT:0005328) creatinine clearance (CMO:0000765) 11 40946188 82566702 Rat 724563 Uae10 Urinary albumin excretion QTL 10 6 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 11 27672410 82846715 Rat 9589032 Epfw10 Epididymal fat weight QTL 10 9.29 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 11 23280456 68280456 Rat 9590313 Scort20 Serum corticosterone level QTL 20 6.51 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 11 23280456 68280456 Rat 8694424 Bw162 Body weight QTL 162 3.8 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 11 23280456 68280456 Rat 1300110 Stl7 Serum triglyceride level QTL 7 4.64 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 11 29528418 82566702 Rat 1641927 Alcrsp10 Alcohol response QTL 10 alcohol metabolism trait (VT:0015089) blood ethanol level (CMO:0000535) 11 8436674 53436674 Rat
BF410432
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 11 43,417,853 - 43,418,071 (+) MAPPER mRatBN7.2 Rnor_6.0 11 45,511,794 - 45,512,011 NCBI Rnor6.0 Rnor_5.0 11 48,707,061 - 48,707,278 UniSTS Rnor5.0 RGSC_v3.4 11 44,341,946 - 44,342,163 UniSTS RGSC3.4 Celera 11 43,207,247 - 43,207,464 UniSTS RH 3.4 Map 11 325.3 UniSTS Cytogenetic Map 11 q12 UniSTS
RH125842
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 50,124,978 - 50,125,223 (+) MAPPER mRatBN7.2 mRatBN7.2 11 43,378,778 - 43,379,023 (+) MAPPER mRatBN7.2 Rnor_6.0 6 52,822,334 - 52,822,578 NCBI Rnor6.0 Rnor_6.0 11 45,477,113 - 45,477,358 NCBI Rnor6.0 Rnor_5.0 6 62,442,457 - 62,442,701 UniSTS Rnor5.0 RGSC_v3.4 11 44,302,595 - 44,302,839 UniSTS RGSC3.4 Celera 6 49,307,483 - 49,307,727 UniSTS Celera 11 43,168,404 - 43,168,648 UniSTS Cytogenetic Map 6 q16 UniSTS Cytogenetic Map 11 q12 UniSTS
AI029154
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 11 43,377,273 - 43,377,477 (+) MAPPER mRatBN7.2 Rnor_6.0 11 45,475,608 - 45,475,811 NCBI Rnor6.0 Rnor_5.0 11 48,668,359 - 48,668,562 UniSTS Rnor5.0 RGSC_v3.4 11 44,301,090 - 44,301,293 UniSTS RGSC3.4 Celera 11 43,166,899 - 43,167,102 UniSTS RH 3.4 Map 11 325.3 UniSTS Cytogenetic Map 11 q12 UniSTS
Tomm70a
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 50,125,428 - 50,126,335 (+) MAPPER mRatBN7.2 Rnor_6.0 6 52,822,784 - 52,823,690 NCBI Rnor6.0 Rnor_5.0 6 62,442,907 - 62,443,813 UniSTS Rnor5.0 RGSC_v3.4 6 51,873,209 - 51,874,115 UniSTS RGSC3.4 Celera 6 49,307,933 - 49,308,839 UniSTS Cytogenetic Map 6 q16 UniSTS Cytogenetic Map 11 q12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000002238 ⟹ ENSRNOP00000002238
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 43,377,216 - 43,417,202 (-) Ensembl Rnor_6.0 Ensembl 11 45,480,250 - 45,510,961 (-) Ensembl
RefSeq Acc Id:
NM_212519 ⟹ NP_997684
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 56,847,837 - 56,886,276 (-) NCBI mRatBN7.2 11 43,378,719 - 43,417,158 (-) NCBI Rnor_6.0 11 45,477,053 - 45,511,098 (-) NCBI Rnor_5.0 11 48,669,804 - 48,706,365 (-) NCBI RGSC_v3.4 11 44,302,535 - 44,341,250 (-) RGD Celera 11 43,168,344 - 43,206,551 (-) RGD
Sequence:
CCTTTTCTGTCGTCCGCTCCTGCTGCTTAGCGTGCTCGCTCGCGCGTTGCTTTCCTCCACGCTCCCGGCTTCCTCTCCACGCTGCCCGGTGACCGTGGCGCCCGCGACCGGCGCGGCGGCGGCGGAGG
hide sequence
RefSeq Acc Id:
XM_008768645 ⟹ XP_008766867
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 56,854,467 - 56,886,302 (-) NCBI mRatBN7.2 11 43,385,372 - 43,417,166 (-) NCBI Rnor_6.0 11 45,483,825 - 45,511,408 (-) NCBI
Sequence:
GCCTACTCACAAAGCTACTGGGAGCTGTCCCTCTGCACTCGCTGTATACAACAACCCCGTCCACGCTGCACTGGCAACAGTGCCACCGGCCCTTCCATCCTGGAGAAGAGGTCTACTATCACGCAAGG
hide sequence
RefSeq Acc Id:
NP_997684 ⟸ NM_212519
- UniProtKB:
Q75Q39 (UniProtKB/Swiss-Prot), A6IQN3 (UniProtKB/TrEMBL)
- Sequence:
MAASKPVEAAMAAAAAPASGNGVGSSGGTAAPGSGAGTLPRWHVALAIGAPLLLGAGAMYLWSRRRRRREAGGRGDASGLKRNSERKTPEGRASPALGSGPDGSGDSLEMSSLDRAQAAKNKGNKYFK
hide sequence
RefSeq Acc Id:
XP_008766867 ⟸ XM_008768645
- Peptide Label:
isoform X1
- Sequence:
MAASKPVEAAMAAAAAPASGNGVGSSGGTAAPGSGAGTLPRWHVALAIGAPLLLGAGAMYLWSRRRRRREAGGRGDASGLKRNSERKTPEGRASPALGSGPDGSGDSLEMSSLDRAQAAKNKGNKYFK
hide sequence
Ensembl Acc Id:
ENSRNOP00000002238 ⟸ ENSRNOT00000002238
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-03-01
Tomm70
translocase of outer mitochondrial membrane 70
Tomm70a
translocase of outer mitochondrial membrane 70 homolog A (S. cerevisiae)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-12-15
Tomm70a
translocase of outer mitochondrial membrane 70 homolog A (S. cerevisiae)
Tomm70a
translocase of outer mitochondrial membrane 70 homolog A (yeast)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-30
Tomm70a
translocase of outer mitochondrial membrane 70 homolog A (yeast)
translocase of outer mitochondrial membrane 70 homolog A
Name updated
1299863 APPROVED
2005-01-06
Tomm70a
translocase of outer mitochondrial membrane 70 homolog A
TOM70
TOM70 protein
Symbol and Name updated
1299863 APPROVED
