Advanced Search (OLGA)

Gene: Tcf19 (transcription factor 19) Rattus norvegicus

Analyze

Symbol:

Tcf19

Name:

transcription factor 19

RGD ID:

1302974

Description:

Predicted to be involved in regulation of gene expression. Predicted to act upstream of or within G1/S transition of mitotic cell cycle and type B pancreatic cell proliferation. Predicted to be active in nucleus. Orthologous to human TCF19 (transcription factor 19); INTERACTS WITH 1-naphthyl isothiocyanate; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TCF19 (transcription factor 19)	HGNC	Ensembl, HomoloGene, NCBI, Panther
Mus musculus (house mouse):	Tcf19 (transcription factor 19)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Tcf19 (transcription factor 19)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TCF19 (transcription factor 19)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TCF19 (transcription factor 19)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Tcf19 (transcription factor 19)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TCF19 (transcription factor 19)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	TCF19 (transcription factor 19)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Tcf19 (transcription factor 19)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Tcf19 (transcription factor 19)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	NEIL3 (nei like DNA glycosylase 3)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	TCF19 (transcription factor 19)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	TCF19 (transcription factor 19)	Alliance	DIOPT (Ensembl Compara\|HGNC\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Tcf19 (transcription factor 19)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Tcf19 (transcription factor 19)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	tcf19l (transcription factor 19 (SC1), like)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	tcf19l (transcription factor 19 (SC1), like)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PhylomeDB)
Caenorhabditis elegans (roundworm):	C01G6.5	Alliance	DIOPT (Ensembl Compara\|OrthoFinder)
Caenorhabditis elegans (roundworm):	C01G6.5	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	tcf19	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	3,223,464 - 3,227,569 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	20	3,223,324 - 3,230,060 (+)	Ensembl				GRCr8
mRatBN7.2	20	3,218,756 - 3,222,861 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	3,218,693 - 3,223,271 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	20	3,280,083 - 3,284,200 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	3,285,054 - 3,289,173 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	3,309,260 - 3,313,380 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	3,740,454 - 3,746,964 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	3,744,395 - 3,746,964 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	20	5,831,137 - 5,833,706 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Celera	20	645,956 - 650,058 (+)	NCBI		Celera
Cytogenetic Map	20	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Colonic Neoplasms (ISO)

hepatocellular carcinoma (ISO)

sensorineural hearing loss (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-demecolcine (ISO)

1,1-dichloroethene (ISO)

1-naphthyl isothiocyanate (EXP)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-hydroxypropanoic acid (ISO)

3-methylcholanthrene (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

5-fluorouracil (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

acrolein (ISO)

acrylamide (ISO)

aflatoxin B1 (EXP,ISO)

aldehydo-D-glucose (ISO)

alpha-pinene (ISO)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

azathioprine (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

benzo[b]fluoranthene (ISO)

beta-naphthoflavone (EXP)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

bortezomib (ISO)

buta-1,3-diene (ISO)

Butylbenzyl phthalate (EXP)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

calcitriol (ISO)

carbon nanotube (ISO)

cefaloridine (EXP)

CGP 52608 (ISO)

chromium(6+) (ISO)

chrysene (ISO)

cisplatin (ISO)

cobalt dichloride (EXP,ISO)

cocaine (EXP)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

coumestrol (ISO)

cyclosporin A (ISO)

D-glucose (ISO)

DDE (ISO)

dexamethasone (ISO)

diarsenic trioxide (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (ISO)

dieldrin (EXP)

dioxygen (ISO)

dorsomorphin (ISO)

Enterolactone (ISO)

ethyl methanesulfonate (ISO)

formaldehyde (ISO)

FR900359 (ISO)

fulvestrant (ISO)

furan (EXP)

glucose (ISO)

glycerol 2-phosphate (ISO)

glycidol (EXP)

GSK-J4 (ISO)

L-ascorbic acid (ISO)

Lasiocarpine (ISO)

leflunomide (ISO)

lidocaine (EXP)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

N-methyl-4-phenylpyridinium (EXP)

N-nitrosodiethylamine (EXP,ISO)

naphthalene (ISO)

nickel dichloride (EXP)

nitrofen (EXP)

okadaic acid (ISO)

oxaliplatin (EXP)

ozone (ISO)

paracetamol (ISO)

paraquat (EXP)

perfluorohexanesulfonic acid (ISO)

phenobarbital (ISO)

PhIP (EXP)

phytoestrogen (ISO)

pirinixic acid (ISO)

pregnenolone 16alpha-carbonitrile (ISO)

quercetin (ISO)

rac-lactic acid (ISO)

resveratrol (ISO)

rotenone (EXP)

SB 431542 (ISO)

senecionine (EXP)

silicon dioxide (ISO)

sirolimus (ISO)

sodium arsenite (ISO)

sodium fluoride (ISO)

Soman (EXP)

sulforaphane (ISO)

sunitinib (ISO)

testosterone (ISO)

tetrachloromethane (ISO)

tetraphene (ISO)

thapsigargin (ISO)

thiram (ISO)

titanium dioxide (ISO)

topotecan (EXP)

trimellitic anhydride (ISO)

triphenyl phosphate (EXP,ISO)

trovafloxacin (ISO)

valproic acid (ISO)

vancomycin (ISO)

vincristine (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

G1/S transition of mitotic cell cycle (ISO)

regulation of gene expression (IBA,IEA,ISO)

type B pancreatic cell proliferation (ISO)

Cellular Component

nucleus (IBA,IEA,ISO)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	A new growth-regulated complementary DNA with the sequence of a putative trans-activating factor.	Ku DH, etal., Cell Growth Differ 1991 Apr;2(4):179-86.
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:23860123

Genomics

Comparative Map Data

Tcf19
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	3,223,464 - 3,227,569 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	20	3,223,324 - 3,230,060 (+)	Ensembl				GRCr8
mRatBN7.2	20	3,218,756 - 3,222,861 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	3,218,693 - 3,223,271 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	20	3,280,083 - 3,284,200 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	3,285,054 - 3,289,173 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	3,309,260 - 3,313,380 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	3,740,454 - 3,746,964 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	3,744,395 - 3,746,964 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	20	5,831,137 - 5,833,706 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Celera	20	645,956 - 650,058 (+)	NCBI		Celera
Cytogenetic Map	20	p12	NCBI

TCF19
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	31,158,589 - 31,164,215 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	31,158,331 - 31,167,159 (+)	Ensembl			hg38	GRCh38
GRCh37	6	31,126,366 - 31,131,992 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	31,234,282 - 31,239,971 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	6	31,235,225 - 31,238,517	NCBI
Celera	6	32,726,529 - 32,732,214 (+)	NCBI		Celera
Cytogenetic Map	6	p21.33	NCBI
HuRef	6	30,928,725 - 30,934,410 (+)	NCBI		HuRef
CHM1_1	6	31,128,403 - 31,134,092 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	6	31,026,273 - 31,031,895 (+)	NCBI		T2T-CHM13v2.0

Tcf19
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	35,823,627 - 35,827,730 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	35,823,631 - 35,827,721 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	17	35,512,730 - 35,516,837 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	35,512,734 - 35,516,824 (-)	Ensembl			mm10	GRCm38
MGSCv37	17	35,649,680 - 35,653,769 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	17	35,120,787 - 35,124,807 (-)	NCBI		MGSCv36	mm8
Celera	17	39,027,683 - 39,031,767 (-)	NCBI		Celera
Cytogenetic Map	17	B1	NCBI
cM Map	17	18.69	NCBI

Tcf19
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955583	989,388 - 994,908 (+)	Ensembl
ChiLan1.0	NW_004955583	989,388 - 994,180 (+)	NCBI	ChiLan1.0	ChiLan1.0

TCF19
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	45,720,267 - 45,725,700 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	41,684,681 - 41,688,874 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	30,904,470 - 30,909,912 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	31,769,855 - 31,775,236 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	31,769,893 - 31,775,236 (+)	Ensembl			panPan2	panpan1.1

TCF19
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	12	855,321 - 859,109 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	12	854,611 - 858,582 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	12	992,755 - 996,522 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	12	93,320 - 97,092 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	12	93,336 - 97,059 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	12	858,936 - 862,700 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	12	927,196 - 930,963 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	12	994,786 - 998,552 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Tcf19
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	34,456,593 - 34,460,560 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936837	821,861 - 826,088 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936837	821,884 - 825,766 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TCF19
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	23,558,353 - 23,562,072 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	7	23,558,326 - 23,562,074 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	27,271,544 - 27,275,261 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TCF19
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	17	41,310,999 - 41,319,268 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	17	41,311,005 - 41,319,042 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666044	30,848,956 - 30,854,387 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tcf19
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624754	24,765,742 - 24,770,135 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624754	24,766,212 - 24,770,136 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Tcf19
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	18	8,720,760 - 8,724,932 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Tcf19
31 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	71
Count of miRNA genes:	65
Interacting mature miRNAs:	70
Transcripts:	ENSRNOT00000070928
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2306850	Pia40	Pristane induced arthritis QTL 40		0.0001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	20	1533200	5306452	Rat
61474	Eae1	Experimental allergic encephalomyelitis QTL 1	3		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	20	1	6693431	Rat
2317057	Aia27	Adjuvant induced arthritis QTL 27	2.83		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	20	1	26925056	Rat
1641915	Colcr9	Colorectal carcinoma resistance QTL 9	2.97	0.0024	intestine integrity trait (VT:0010554)	benign colorectal tumor number (CMO:0001795)	20	1	33724594	Rat
7387283	Uae44	Urinary albumin excretion QTL 44		0.1712	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	20	1	26128279	Rat
7411668	Foco32	Food consumption QTL 32	8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	36600300	Rat
2305926	Iddm37	Insulin dependent diabetes mellitus QTL 37	6		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	20	1533083	46533083	Rat
1354642	Despr15	Despair related QTL 15		0.0027	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	20	1	24164241	Rat
1558640	Prcs2	Prostate cancer susceptibility QTL 2	3.3		prostate integrity trait (VT:0010571)	percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943)	20	1	34066551	Rat
8694189	Bw153	Body weight QTL 153	3.13	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	20	1	29193376	Rat
70154	Insul2	Insulin level QTL 2	3.75		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	20	1	6693431	Rat
4889857	Pur27	Proteinuria QTL 27	12.2	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	20	1	27341128	Rat
724519	Bp144	Blood pressure QTL 144		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	20	1	3629303	Rat
9590109	Sffal8	Serum free fatty acids level QTL 8	5.32	0.01	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	20	1	29193376	Rat
9589155	Insul32	Insulin level QTL 32	6.38	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	20	1	29193376	Rat
9590275	Scort15	Serum corticosterone level QTL 15	3.48	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	29193376	Rat
7411650	Foco23	Food consumption QTL 23	20.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	29193376	Rat
61432	Cia1	Collagen induced arthritis QTL 1			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	20	1	14100378	Rat
2317851	Alcrsp22	Alcohol response QTL 22	3.2	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27341128	Rat
1641893	Alcrsp7	Alcohol response QTL 7			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27341128	Rat
6893685	Bw111	Body weight QTL 111	2.7	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	20	1	32578510	Rat
9590252	Scort12	Serum corticosterone level QTL 12	20.46	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	36600300	Rat

Markers in Region

RH128540

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	3,222,572 - 3,222,781 (+)	MAPPER	mRatBN7.2
Rnor_6.0	20	3,746,676 - 3,746,884	NCBI	Rnor6.0
Rnor_5.0	20	5,833,418 - 5,833,626	UniSTS	Rnor5.0
Celera	20	649,770 - 649,978	UniSTS
RH 3.4 Map	20	53.23	UniSTS
Cytogenetic Map	20	p12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	162	91	90	59	92	59	6	356	192	11	141	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_213561	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC093374	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BX883047	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB746547	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474118	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221774	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000020	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000086065 ⟹ ENSRNOP00000071278

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	20	3,223,397 - 3,227,986 (+)	Ensembl
mRatBN7.2 Ensembl	20	3,218,693 - 3,223,271 (+)	Ensembl
Rnor_6.0 Ensembl	20	3,744,395 - 3,746,964 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000150828 ⟹ ENSRNOP00000109844

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	20	3,223,324 - 3,230,060 (+)	Ensembl

RefSeq Acc Id:

NM_213561 ⟹ NP_998726

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	3,223,464 - 3,227,569 (+)	NCBI
mRatBN7.2	20	3,218,756 - 3,222,861 (+)	NCBI
Rnor_6.0	20	3,740,454 - 3,746,964 (+)	NCBI
Rnor_5.0	20	5,831,137 - 5,833,706 (+)	NCBI
Celera	20	645,956 - 650,058 (+)	RGD

Sequence:

show sequence

GGCGGGAGCGCGGCGCCCAGGGTGCTGAGTCTCTTTCCTCAGTTTACCCCGCGAGCGAAAAAAG
GAAAGGATTGTCAAAGGCTCCCGGATGTTGAGCGGCCTGGGGATCCGGCTTCACTGTGTTGCCG
TAGGACGTCTTCCTGGTTTTGCATCGCATCAGGACTTTGCTAGAGTTTTTTCTTAAAACCTCAT
CTTGACAACCTCTGCTGTGGTGCATGTCCAGGCCTTGGGCGCTCTGAATCTGCACTTCCTAAGT
TGGCATCGGAGAGAACTGAACCGAAGCCCACGGCGCATGACCCAGGAGTAGAAGAGGGGAATGG
ACTGCTAAAGTGGGAGGAGTGGTGCACAGGGGGCACCCCCATGCTGCCCTGCTTCCAGCTGCTG
CGCATAGGGGGCGGCAGGGGCGGTGATCTCTATACCTTCCACCCCCCATCCAAGTCTGGCTGCA
CCTATCGGTTGGGCTGCAGGGCTGACCTGTGTGATGTGGCCCTGCGGCCCCAGCAGGAGCCTGG
CCTCATCTCTGGGGTCCATGCAGAACTGCATGCTGAACTCCAAGGGGACGACTGGAGGGTCAGC
CTGGAGGATCACAGCAGCCAAGGGACTTTGGTCAATAATGTCCGACTCCCAAGGGGACACAGGC
TGGAGTTGAGTGACGGTGACCTCCTGACCTTTGGCCCCGAAGGGCAAGCAGGAACCAGCTCCTC
CGAATTCTACTTCATGTTCCAACAAGTCCGGGTCAAACCTCAGGACTTTGCCGCCATCACGGTC
CCTCGGTCCAAGGGAAAAACTGGGGCCGGTTTCCAGCCCATGCTGCCCCCACAAGGGGCACCTC
AGAGGCCACTCAGCACCCTCTCCTCTGCCCCCAAGGCCACACTGATTCTCAATTCCATCGGCAG
CCTCAGCAAGCTGCAGCCCCAGCCTCTCACCTTCTCCCGTGGCGGTGGCCGGCAGCAGAGCCTG
GCCGTTCCCACTCAGCCAGGGGAAGTGGGAGCTTCACCCGCTCCACCCACAAGAAACCGGAGGA
AATCGGCTCATAAAGTGTTGGCAGAACTGGATGATGAGAGTGAGGCTTCCCCGGGGCACCTTTC
AGTCCTGATGGAGCCCAGGAAGAAGCTGCGTTTGGAGAAAACGGCTCTGATATCCAGTGGGGAA
TGACCACAGGGAGAGGTCCACTGCTAGAGAAGACTGACTCAAGGCTGGAGAGCACTATGGCTGA
AGTGACAGGAAAAAGAGCTGCAGCCTCCAAGTTAAGTAACAAGGAGTAAAGCCCCGTTTCCACA
AACACCAGGATCCTACAGTTAGAGCATCAATCACAGGAACCATCCCTGAAGGCATTAAGAAGGG
GTGCTAAATGTCTTCTTATTTTGCTGAGGCCAGCATACCAGGCAAGTCCCCTGTACTGAGCACC
CACCCTAACCCTAATGTTCTTGAACGGCATCGGCTAACGCACCCTGGACGACCCAGAGCACAGC
CCCAAGGTTTCGCTCATGCCAAGGCTAGCTAATCCTGCCACCAACTAGGTATTTGTGACTGGCT
CTTCGGAGCTTTGCCTTTGATTTCCAAATAAAGAATAAACTGCTTCACCTACAAAAAAAAAAAA
AAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_998726	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH93374	(Get FASTA)	NCBI Sequence Viewer
	CAE84021	(Get FASTA)	NCBI Sequence Viewer
	EDL86770	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000071278
	ENSRNOP00000071278.2
	ENSRNOP00000109844.1

RefSeq Acc Id:

NP_998726 ⟸ NM_213561

- UniProtKB:

Q566R6 (UniProtKB/TrEMBL), M0R9H4 (UniProtKB/TrEMBL), Q6MG26 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MLPCFQLLRIGGGRGGDLYTFHPPSKSGCTYRLGCRADLCDVALRPQQEPGLISGVHAELHAEL
QGDDWRVSLEDHSSQGTLVNNVRLPRGHRLELSDGDLLTFGPEGQAGTSSSEFYFMFQQVRVKP
QDFAAITVPRSKGKTGAGFQPMLPPQGAPQRPLSTLSSAPKATLILNSIGSLSKLQPQPLTFSR
GGGRQQSLAVPTQPGEVGASPAPPTRNRRKSAHKVLAELDDESEASPGHLSVLMEPRKKLRLEK
TALISSGE

hide sequence

Ensembl Acc Id:

ENSRNOP00000071278 ⟸ ENSRNOT00000086065

Ensembl Acc Id:

ENSRNOP00000109844 ⟸ ENSRNOT00000150828

Protein Domains

FHA

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1302974	AgrOrtholog
BioCyc Gene	G2FUF-4743	BioCyc
Ensembl Genes	ENSRNOG00000058288	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000086065	ENTREZGENE
	ENSRNOT00000086065.3	UniProtKB/TrEMBL
	ENSRNOT00000150828.1	UniProtKB/TrEMBL
Gene3D-CATH	2.60.200.20	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7388599	IMAGE-MGC_LOAD
InterPro	FHA_dom	UniProtKB/TrEMBL
	SMAD_FHA_domain	UniProtKB/TrEMBL
	TCF19	UniProtKB/TrEMBL
KEGG Report	rno:406195	UniProtKB/TrEMBL
MGC_CLONE	MGC:112566	IMAGE-MGC_LOAD
NCBI Gene	406195	ENTREZGENE
PANTHER	PTHR15464	UniProtKB/TrEMBL
	TRANSCRIPTION FACTOR 19	UniProtKB/TrEMBL
Pfam	FHA	UniProtKB/TrEMBL
PhenoGen	Tcf19	PhenoGen
PROSITE	FHA_DOMAIN	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000058288	RatGTEx
SMART	FHA	UniProtKB/TrEMBL
Superfamily-SCOP	SMAD_FHA	UniProtKB/TrEMBL
UniProt	A6KTB6_RAT	UniProtKB/TrEMBL
	M0R9H4	ENTREZGENE
	Q566R6	ENTREZGENE, UniProtKB/TrEMBL
	Q6MG26	ENTREZGENE, UniProtKB/TrEMBL
UniProt Secondary	M0R9H4	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-11-17	Tcf19	transcription factor 19			Symbol and Name status set to approved	1299863	APPROVED
2005-02-14	Tcf19	transcription factor 19			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD