Symbol:
Ppp1cb
Name:
protein phosphatase 1 catalytic subunit beta
RGD ID:
3376
Description:
Enables phosphoprotein phosphatase activity. Involved in protein dephosphorylation; regulation of glycogen biosynthetic process; and regulation of glycogen catabolic process. Located in glycogen granule. Part of protein phosphatase type 1 complex. Human ortholog(s) of this gene implicated in Noonan syndrome-like disorder with loose anagen hair 2. Orthologous to human PPP1CB (protein phosphatase 1 catalytic subunit beta); PARTICIPATES IN glycogen biosynthetic pathway; glycogen degradation pathway; adenosine monophosphate-activated protein kinase (AMPK) signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; 3H-1,2-dithiole-3-thione.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
PP-1B; PP1B; PP1beta; protein phosphatase 1, catalytic subunit, beta isoform; protein phosphatase 1, catalytic subunit, beta isozyme; protein phosphatase-1a; serine/threonine-protein phosphatase PP1-beta catalytic subunit
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PPP1CB (protein phosphatase 1 catalytic subunit beta)
HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Ppp1cb (protein phosphatase 1 catalytic subunit beta)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Ppp1cb (protein phosphatase 1 catalytic subunit beta)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PPP1CB (protein phosphatase 1 catalytic subunit beta)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PPP1CB (protein phosphatase 1 catalytic subunit beta)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ppp1cb (protein phosphatase 1 catalytic subunit beta)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PPP1CB (protein phosphatase 1 catalytic subunit beta)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PPP1CB (protein phosphatase 1 catalytic subunit beta)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Ppp1cb (protein phosphatase 1 catalytic subunit beta)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
PPP1CA (protein phosphatase 1 catalytic subunit alpha)
HGNC
OrthoDB
Homo sapiens (human):
PPP1CC (protein phosphatase 1 catalytic subunit gamma)
HGNC
OrthoDB
Homo sapiens (human):
HNRNPUL1 (heterogeneous nuclear ribonucleoprotein U like 1)
HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
PPP1CB (protein phosphatase 1 catalytic subunit beta)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Ppp1cb (protein phosphatase 1 catalytic subunit beta)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ppp1cb (protein phosphatase 1, catalytic subunit, beta isozyme)
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Danio rerio (zebrafish):
ppp1cbl (protein phosphatase 1, catalytic subunit, beta isoform, like)
Alliance
DIOPT (OMA|PANTHER|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):
GLC7
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
flw
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
gsp-1
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
ppp1cb
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Related Pseudogenes:
Ppp1cb-ps1
Ppp1cb-ps7
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 29,681,099 - 29,712,835 (-) NCBI GRCr8 mRatBN7.2 6 23,958,813 - 23,992,841 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 23,960,998 - 23,992,824 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 24,260,597 - 24,292,337 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 24,576,477 - 24,608,213 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 24,065,465 - 24,097,720 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 23,548,507 - 23,581,136 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 23,549,317 - 23,581,052 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 33,416,540 - 33,448,276 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 24,067,544 - 24,099,280 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 24,070,497 - 24,102,233 (-) NCBI Celera 6 23,460,146 - 23,491,883 (-) NCBI Celera Cytogenetic Map 6 q14 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ppp1cb Rat 1,2-dimethylhydrazine multiple interactions ISO Ppp1cb (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of PPP1CB mRNA CTD PMID:22206623 Ppp1cb Rat 1,2-dimethylhydrazine decreases expression ISO Ppp1cb (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of PPP1CB mRNA CTD PMID:22206623 Ppp1cb Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Ppp1cb (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Ppp1cb Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Ppp1cb (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PPP1CB mRNA CTD PMID:21570461 Ppp1cb Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PPP1CB mRNA CTD PMID:32109520 more ... Ppp1cb Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Ppp1cb Rat 2,6-dimethoxyphenol multiple interactions ISO PPP1CB (Homo sapiens) 6480464 [pyrogallol 1 and 3-dimethyl ether co-treated with Furaldehyde] results in decreased expression of and affects the localization of PPP1CB protein CTD PMID:38598786 Ppp1cb Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO PPP1CB (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of PPP1CB mRNA CTD PMID:28628672 Ppp1cb Rat 3H-1,2-dithiole-3-thione decreases expression EXP 6480464 1 and 2-dithiol-3-thione results in decreased expression of PPP1CB mRNA CTD PMID:19162173 Ppp1cb Rat 4,4'-diaminodiphenylmethane decreases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of PPP1CB mRNA CTD PMID:33565098 Ppp1cb Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of PPP1CB mRNA CTD PMID:36041667 Ppp1cb Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of PPP1CB mRNA CTD PMID:24780913 Ppp1cb Rat 7,12-dimethyltetraphene affects expression ISO Ppp1cb (Mus musculus) 6480464 9 more ... CTD PMID:21785161 Ppp1cb Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of PPP1CB mRNA CTD PMID:31881176 Ppp1cb Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of PPP1CB mRNA CTD PMID:28959563 Ppp1cb Rat actinomycin D multiple interactions ISO PPP1CB (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of PPP1CB protein CTD PMID:38460933 Ppp1cb Rat all-trans-retinoic acid decreases expression ISO PPP1CB (Homo sapiens) 6480464 Tretinoin results in decreased expression of PPP1CB mRNA CTD PMID:15498508 Ppp1cb Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PPP1CB mRNA CTD PMID:16483693 Ppp1cb Rat ampicillin multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in increased expression of PPP1CB protein CTD PMID:30545405 Ppp1cb Rat aristolochic acid A decreases expression ISO PPP1CB (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of PPP1CB mRNA CTD PMID:33212167 Ppp1cb Rat aristolochic acid A increases expression ISO PPP1CB (Homo sapiens) 6480464 aristolochic acid I results in increased expression of PPP1CB protein CTD PMID:33212167 Ppp1cb Rat arsenous acid decreases expression ISO PPP1CB (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of PPP1CB mRNA and Arsenic Trioxide results in decreased expression of PPP1CB protein CTD PMID:12852829 and PMID:19364129 Ppp1cb Rat arsenous acid increases expression ISO PPP1CB (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of PPP1CB protein CTD PMID:25419056 Ppp1cb Rat astaxanthin multiple interactions ISO Ppp1cb (Mus musculus) 6480464 astaxanthine inhibits the reaction [LEPR gene mutant form results in increased expression of PPP1CB mRNA] CTD PMID:16964424 Ppp1cb Rat benzene increases expression ISO PPP1CB (Homo sapiens) 6480464 Benzene results in increased expression of PPP1CB mRNA CTD PMID:15929907 and PMID:19162166 Ppp1cb Rat benzo[a]pyrene increases expression ISO Ppp1cb (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of PPP1CB mRNA CTD PMID:20127859 and PMID:22228805 Ppp1cb Rat benzo[a]pyrene decreases expression ISO PPP1CB (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of PPP1CB mRNA CTD PMID:26238291 Ppp1cb Rat benzo[a]pyrene affects expression ISO Ppp1cb (Mus musculus) 6480464 Benzo(a)pyrene affects the expression of PPP1CB mRNA CTD PMID:22342234 Ppp1cb Rat benzo[a]pyrene diol epoxide I decreases expression ISO PPP1CB (Homo sapiens) 6480464 7 more ... CTD PMID:26238291 Ppp1cb Rat bis(2-ethylhexyl) phthalate increases expression ISO Ppp1cb (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of PPP1CB mRNA CTD PMID:33754040 Ppp1cb Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of PPP1CB mRNA CTD PMID:25181051 Ppp1cb Rat bisphenol A increases expression ISO PPP1CB (Homo sapiens) 6480464 bisphenol A results in increased expression of PPP1CB protein CTD PMID:37567409 Ppp1cb Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of PPP1CB mRNA CTD PMID:36041667 Ppp1cb Rat bisphenol A multiple interactions ISO PPP1CB (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of PPP1CB mRNA CTD PMID:28628672 Ppp1cb Rat bisphenol A decreases expression ISO Ppp1cb (Mus musculus) 6480464 bisphenol A results in decreased expression of PPP1CB protein CTD PMID:24909818 Ppp1cb Rat bisphenol AF increases expression ISO PPP1CB (Homo sapiens) 6480464 bisphenol AF results in increased expression of PPP1CB protein CTD PMID:34186270 Ppp1cb Rat Bisphenol B increases expression ISO PPP1CB (Homo sapiens) 6480464 bisphenol B results in increased expression of PPP1CB protein CTD PMID:34186270 Ppp1cb Rat bisphenol F increases expression ISO Ppp1cb (Mus musculus) 6480464 bisphenol F results in increased expression of PPP1CB mRNA CTD PMID:38685157 Ppp1cb Rat bisphenol F increases expression ISO PPP1CB (Homo sapiens) 6480464 bisphenol F results in increased expression of PPP1CB protein CTD PMID:34186270 Ppp1cb Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of PPP1CB mRNA CTD PMID:36041667 Ppp1cb Rat cadmium atom multiple interactions ISO PPP1CB (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PPP1CB mRNA CTD PMID:35301059 Ppp1cb Rat cadmium dichloride increases expression ISO PPP1CB (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of PPP1CB mRNA CTD PMID:26472689 Ppp1cb Rat cadmium dichloride multiple interactions ISO PPP1CB (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PPP1CB mRNA CTD PMID:35301059 Ppp1cb Rat caffeine affects phosphorylation ISO PPP1CB (Homo sapiens) 6480464 Caffeine affects the phosphorylation of PPP1CB protein CTD PMID:35688186 Ppp1cb Rat calcitriol multiple interactions ISO PPP1CB (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of PPP1CB mRNA CTD PMID:21592394 Ppp1cb Rat calcitriol increases expression ISO PPP1CB (Homo sapiens) 6480464 Calcitriol results in increased expression of PPP1CB mRNA CTD PMID:21592394 Ppp1cb Rat calcium atom affects expression EXP 6480464 Calcium affects the expression of PPP1CB mRNA CTD PMID:15913539 Ppp1cb Rat calcium(0) affects expression EXP 6480464 Calcium affects the expression of PPP1CB mRNA CTD PMID:15913539 Ppp1cb Rat cannabidiol increases expression ISO PPP1CB (Homo sapiens) 6480464 Cannabidiol results in increased expression of PPP1CB mRNA CTD PMID:31801206 Ppp1cb Rat carbamazepine affects expression ISO PPP1CB (Homo sapiens) 6480464 Carbamazepine affects the expression of PPP1CB mRNA CTD PMID:24752500 Ppp1cb Rat chlorpyrifos decreases expression ISO Ppp1cb (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of PPP1CB mRNA CTD PMID:37019170 Ppp1cb Rat clobetasol increases expression ISO Ppp1cb (Mus musculus) 6480464 Clobetasol results in increased expression of PPP1CB mRNA CTD PMID:27462272 Ppp1cb Rat clozapine decreases expression EXP 6480464 Clozapine results in decreased expression of PPP1CB mRNA CTD PMID:15860345 Ppp1cb Rat copper(II) sulfate decreases expression ISO PPP1CB (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of PPP1CB mRNA CTD PMID:19549813 Ppp1cb Rat cyclosporin A increases expression ISO PPP1CB (Homo sapiens) 6480464 Cyclosporine results in increased expression of PPP1CB mRNA CTD PMID:27989131 Ppp1cb Rat deguelin increases expression ISO PPP1CB (Homo sapiens) 6480464 deguelin results in increased expression of PPP1CB mRNA CTD PMID:33512557 Ppp1cb Rat dexamethasone multiple interactions ISO PPP1CB (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of PPP1CB mRNA CTD PMID:28628672 Ppp1cb Rat diarsenic trioxide increases expression ISO PPP1CB (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of PPP1CB protein CTD PMID:25419056 Ppp1cb Rat diarsenic trioxide decreases expression ISO PPP1CB (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of PPP1CB mRNA and Arsenic Trioxide results in decreased expression of PPP1CB protein CTD PMID:12852829 and PMID:19364129 Ppp1cb Rat dibenzo[a,l]pyrene affects expression ISO Ppp1cb (Mus musculus) 6480464 dibenzo(a and l)pyrene affects the expression of PPP1CB mRNA CTD PMID:26496743 Ppp1cb Rat dibutyl phthalate increases expression ISO Ppp1cb (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of PPP1CB mRNA CTD PMID:21266533 Ppp1cb Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of PPP1CB mRNA CTD PMID:17379624 Ppp1cb Rat diclofenac affects expression ISO PPP1CB (Homo sapiens) 6480464 Diclofenac affects the expression of PPP1CB mRNA CTD PMID:24752500 Ppp1cb Rat dicrotophos decreases expression ISO PPP1CB (Homo sapiens) 6480464 dicrotophos results in decreased expression of PPP1CB mRNA CTD PMID:28302478 Ppp1cb Rat diethylstilbestrol increases expression ISO PPP1CB (Homo sapiens) 6480464 Diethylstilbestrol results in increased expression of PPP1CB mRNA CTD PMID:36621641 Ppp1cb Rat dioxygen increases expression ISO Ppp1cb (Mus musculus) 6480464 Oxygen deficiency results in increased expression of PPP1CB mRNA CTD PMID:22629407 Ppp1cb Rat dioxygen multiple interactions ISO Ppp1cb (Mus musculus) 6480464 Oxygen inhibits the reaction [Oxygen deficiency results in increased expression of PPP1CB mRNA] CTD PMID:22629407 Ppp1cb Rat doxorubicin increases expression ISO PPP1CB (Homo sapiens) 6480464 Doxorubicin results in increased expression of PPP1CB mRNA CTD PMID:29803840 Ppp1cb Rat enzyme inhibitor multiple interactions ISO PPP1CB (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of PPP1CB protein CTD PMID:23301498 Ppp1cb Rat ethanol decreases expression ISO PPP1CB (Homo sapiens) 6480464 Ethanol results in decreased expression of PPP1CB mRNA CTD PMID:28986285 Ppp1cb Rat ethanol affects splicing ISO Ppp1cb (Mus musculus) 6480464 Ethanol affects the splicing of PPP1CB mRNA CTD PMID:30319688 Ppp1cb Rat folic acid multiple interactions ISO Ppp1cb (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of PPP1CB mRNA CTD PMID:22206623 Ppp1cb Rat formaldehyde decreases expression ISO PPP1CB (Homo sapiens) 6480464 Formaldehyde results in decreased expression of PPP1CB mRNA CTD PMID:23649840 Ppp1cb Rat FR900359 increases phosphorylation ISO PPP1CB (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of PPP1CB protein CTD PMID:37730182 Ppp1cb Rat furfural multiple interactions ISO PPP1CB (Homo sapiens) 6480464 [pyrogallol 1 more ... CTD PMID:38598786 Ppp1cb Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of PPP1CB mRNA CTD PMID:22061828 Ppp1cb Rat gentamycin multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in increased expression of PPP1CB protein CTD PMID:30545405 Ppp1cb Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of PPP1CB mRNA CTD PMID:22061828 Ppp1cb Rat gold atom decreases expression ISO PPP1CB (Homo sapiens) 6480464 Gold results in decreased expression of PPP1CB mRNA CTD PMID:25523186 Ppp1cb Rat gold(0) decreases expression ISO PPP1CB (Homo sapiens) 6480464 Gold results in decreased expression of PPP1CB mRNA CTD PMID:25523186 Ppp1cb Rat haloperidol decreases expression EXP 6480464 Haloperidol results in decreased expression of PPP1CB mRNA CTD PMID:15860345 Ppp1cb Rat hexane decreases methylation EXP 6480464 n-hexane results in decreased methylation of PPP1CB promoter CTD PMID:23740543 Ppp1cb Rat hydrogen peroxide affects expression ISO PPP1CB (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of PPP1CB mRNA CTD PMID:20044591 Ppp1cb Rat indometacin multiple interactions ISO PPP1CB (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of PPP1CB mRNA CTD PMID:28628672 Ppp1cb Rat ivermectin decreases expression ISO PPP1CB (Homo sapiens) 6480464 Ivermectin results in decreased expression of PPP1CB protein CTD PMID:32959892 Ppp1cb Rat lead diacetate increases expression ISO Ppp1cb (Mus musculus) 6480464 lead acetate results in increased expression of PPP1CB mRNA CTD PMID:22609695 Ppp1cb Rat lead diacetate decreases methylation EXP 6480464 lead acetate results in decreased methylation of PPP1CB gene CTD PMID:29571894 Ppp1cb Rat methyl methanesulfonate decreases expression ISO PPP1CB (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of PPP1CB mRNA CTD PMID:23649840 Ppp1cb Rat methylmercury chloride decreases expression ISO PPP1CB (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of PPP1CB mRNA CTD PMID:28001369 Ppp1cb Rat metronidazole multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in increased expression of PPP1CB protein CTD PMID:30545405 Ppp1cb Rat mono(2-ethylhexyl) phthalate increases expression ISO PPP1CB (Homo sapiens) 6480464 mono-(2-ethylhexyl)phthalate results in increased expression of PPP1CB mRNA CTD PMID:38685446 Ppp1cb Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of PPP1CB mRNA CTD PMID:24136188 Ppp1cb Rat neomycin multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in increased expression of PPP1CB protein CTD PMID:30545405 Ppp1cb Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of PPP1CB mRNA CTD PMID:24136188 Ppp1cb Rat Nonylphenol decreases expression EXP 6480464 nonylphenol results in decreased expression of PPP1CB protein CTD PMID:19260726 Ppp1cb Rat Nutlin-3 multiple interactions ISO PPP1CB (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of PPP1CB protein CTD PMID:38460933 Ppp1cb Rat oxybenzone increases expression ISO PPP1CB (Homo sapiens) 6480464 oxybenzone results in increased expression of PPP1CB mRNA CTD PMID:36581016 Ppp1cb Rat ozone decreases expression ISO Ppp1cb (Mus musculus) 6480464 Ozone results in decreased expression of PPP1CB mRNA CTD PMID:12763052 Ppp1cb Rat ozone increases expression EXP 6480464 Ozone results in increased expression of PPP1CB protein CTD PMID:33146391 Ppp1cb Rat paclitaxel affects response to substance ISO PPP1CB (Homo sapiens) 6480464 PPP1CB protein affects the susceptibility to Paclitaxel CTD PMID:16217747 Ppp1cb Rat PCB138 decreases expression EXP 6480464 2 more ... CTD PMID:23829299 Ppp1cb Rat pentachlorophenol decreases expression ISO Ppp1cb (Mus musculus) 6480464 Pentachlorophenol results in decreased expression of PPP1CB mRNA CTD PMID:23892564 Ppp1cb Rat phenobarbital affects expression ISO Ppp1cb (Mus musculus) 6480464 Phenobarbital affects the expression of PPP1CB mRNA CTD PMID:23091169 Ppp1cb Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of PPP1CB mRNA CTD PMID:19162173 Ppp1cb Rat piroxicam decreases expression ISO PPP1CB (Homo sapiens) 6480464 Piroxicam results in decreased expression of PPP1CB mRNA CTD PMID:21858171 Ppp1cb Rat Propiverine affects binding EXP 6480464 propiverine binds to PPP1CB protein CTD PMID:29273565 Ppp1cb Rat pyrimidifen increases expression ISO PPP1CB (Homo sapiens) 6480464 pyrimidifen results in increased expression of PPP1CB mRNA CTD PMID:33512557 Ppp1cb Rat resveratrol decreases expression EXP 6480464 resveratrol results in decreased expression of PPP1CB mRNA CTD PMID:25905778 Ppp1cb Rat resveratrol multiple interactions ISO PPP1CB (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of PPP1CB mRNA CTD PMID:23557933 Ppp1cb Rat rimonabant multiple interactions ISO Ppp1cb (Mus musculus) 6480464 Rimonabant inhibits the reaction [Dietary Fats results in increased expression of PPP1CB mRNA] CTD PMID:19030233 Ppp1cb Rat rotenone increases expression ISO PPP1CB (Homo sapiens) 6480464 Rotenone results in increased expression of PPP1CB mRNA CTD PMID:33512557 Ppp1cb Rat SB 431542 multiple interactions ISO PPP1CB (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in increased expression of PPP1CB protein CTD PMID:37664457 Ppp1cb Rat sodium arsenite increases expression ISO PPP1CB (Homo sapiens) 6480464 sodium arsenite results in increased expression of PPP1CB mRNA CTD PMID:12016162 Ppp1cb Rat sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of PPP1CB mRNA CTD PMID:19072884 Ppp1cb Rat sodium chloride multiple interactions ISO PPP1CB (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of PPP1CB protein CTD PMID:38598786 Ppp1cb Rat sodium dodecyl sulfate decreases expression ISO PPP1CB (Homo sapiens) 6480464 Sodium Dodecyl Sulfate results in decreased expression of PPP1CB protein CTD PMID:21469165 Ppp1cb Rat sodium fluoride decreases expression ISO Ppp1cb (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of PPP1CB protein CTD PMID:28918527 Ppp1cb Rat tamibarotene decreases expression ISO PPP1CB (Homo sapiens) 6480464 tamibarotene results in decreased expression of PPP1CB mRNA CTD PMID:15498508 Ppp1cb Rat tebufenpyrad increases expression ISO PPP1CB (Homo sapiens) 6480464 4-chloro-N-((4-(1 and 1-dimethylethyl)phenyl)methyl)-3-ethyl-1-methyl-1H-pyrazole-5-carboxamide results in increased expression of PPP1CB mRNA CTD PMID:33512557 Ppp1cb Rat tert-butyl hydroperoxide decreases expression ISO PPP1CB (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of PPP1CB mRNA CTD PMID:15336504 Ppp1cb Rat testosterone multiple interactions ISO PPP1CB (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of PPP1CB mRNA CTD PMID:21592394 Ppp1cb Rat testosterone increases expression ISO PPP1CB (Homo sapiens) 6480464 Testosterone results in increased expression of PPP1CB mRNA CTD PMID:21592394 Ppp1cb Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of PPP1CB mRNA CTD PMID:34492290 Ppp1cb Rat titanium dioxide increases methylation ISO Ppp1cb (Mus musculus) 6480464 titanium dioxide results in increased methylation of PPP1CB gene CTD PMID:35295148 Ppp1cb Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of PPP1CB mRNA CTD PMID:19448997 Ppp1cb Rat triphenyl phosphate affects expression ISO PPP1CB (Homo sapiens) 6480464 triphenyl phosphate affects the expression of PPP1CB mRNA CTD PMID:37042841 Ppp1cb Rat Triptolide decreases expression EXP 6480464 triptolide results in decreased expression of PPP1CB mRNA CTD PMID:23639586 Ppp1cb Rat triptonide increases expression ISO Ppp1cb (Mus musculus) 6480464 triptonide results in increased expression of PPP1CB mRNA CTD PMID:33045310 Ppp1cb Rat valproic acid decreases methylation ISO PPP1CB (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of PPP1CB gene CTD PMID:29154799 Ppp1cb Rat valproic acid decreases expression ISO PPP1CB (Homo sapiens) 6480464 Valproic Acid results in decreased expression of PPP1CB mRNA CTD PMID:29501571 Ppp1cb Rat valproic acid affects expression ISO PPP1CB (Homo sapiens) 6480464 Valproic Acid affects the expression of PPP1CB mRNA CTD PMID:25979313 Ppp1cb Rat vancomycin multiple interactions EXP 6480464 [Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in increased expression of PPP1CB protein CTD PMID:30545405
Imported Annotations - KEGG (archival)
1,2-dimethylhydrazine (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,6-dimethoxyphenol (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 3H-1,2-dithiole-3-thione (EXP) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (EXP) 6-propyl-2-thiouracil (EXP) 7,12-dimethyltetraphene (ISO) acetamide (EXP) acrylamide (EXP) actinomycin D (ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP) ampicillin (EXP) aristolochic acid A (ISO) arsenous acid (ISO) astaxanthin (ISO) benzene (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (EXP,ISO) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) calcitriol (ISO) calcium atom (EXP) calcium(0) (EXP) cannabidiol (ISO) carbamazepine (ISO) chlorpyrifos (ISO) clobetasol (ISO) clozapine (EXP) copper(II) sulfate (ISO) cyclosporin A (ISO) deguelin (ISO) dexamethasone (ISO) diarsenic trioxide (ISO) dibenzo[a,l]pyrene (ISO) dibutyl phthalate (EXP,ISO) diclofenac (ISO) dicrotophos (ISO) diethylstilbestrol (ISO) dioxygen (ISO) doxorubicin (ISO) enzyme inhibitor (ISO) ethanol (ISO) folic acid (ISO) formaldehyde (ISO) FR900359 (ISO) furfural (ISO) gentamycin (EXP) gold atom (ISO) gold(0) (ISO) haloperidol (EXP) hexane (EXP) hydrogen peroxide (ISO) indometacin (ISO) ivermectin (ISO) lead diacetate (EXP,ISO) methyl methanesulfonate (ISO) methylmercury chloride (ISO) metronidazole (EXP) mono(2-ethylhexyl) phthalate (ISO) nefazodone (EXP) neomycin (EXP) nimesulide (EXP) Nonylphenol (EXP) Nutlin-3 (ISO) oxybenzone (ISO) ozone (EXP,ISO) paclitaxel (ISO) PCB138 (EXP) pentachlorophenol (ISO) phenobarbital (ISO) pirinixic acid (EXP) piroxicam (ISO) Propiverine (EXP) pyrimidifen (ISO) resveratrol (EXP,ISO) rimonabant (ISO) rotenone (ISO) SB 431542 (ISO) sodium arsenite (EXP,ISO) sodium chloride (ISO) sodium dodecyl sulfate (ISO) sodium fluoride (ISO) tamibarotene (ISO) tebufenpyrad (ISO) tert-butyl hydroperoxide (ISO) testosterone (ISO) thioacetamide (EXP) titanium dioxide (ISO) trichloroethene (EXP) triphenyl phosphate (ISO) Triptolide (EXP) triptonide (ISO) valproic acid (ISO) vancomycin (EXP)
1.
Selective targeting of the gamma1 isoform of protein phosphatase 1 to F-actin in intact cells requires multiple domains in spinophilin and neurabin.
Carmody LC, etal., FASEB J. 2008 Jun;22(6):1660-71. doi: 10.1096/fj.07-092841. Epub 2008 Jan 23.
2.
Functional diversity of protein phosphatase-1, a cellular economizer and reset button.
Ceulemans H and Bollen M, Physiol Rev. 2004 Jan;84(1):1-39.
3.
Differential expression of protein phosphatase 1 isoforms in mammalian brain.
da Cruz e Silva EF, etal., J Neurosci 1995 May;15(5 Pt 1):3375-89.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
AMP-activated protein kinase: also regulated by ADP?
Hardie DG, etal., Trends Biochem Sci. 2011 Sep;36(9):470-7. doi: 10.1016/j.tibs.2011.06.004. Epub 2011 Jul 23.
6.
Interaction of the ribosomal protein, L5, with protein phosphatase type 1.
Hirano K, etal., J Biol Chem. 1995 Aug 25;270(34):19786-90.
7.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
8.
Purification of the hepatic glycogen-associated form of protein phosphatase-1 by microcystin-Sepharose affinity chromatography.
Moorhead G, etal., FEBS Lett. 1995 Apr 3;362(2):101-5.
9.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
10.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
11.
GOA pipeline
RGD automated data pipeline
12.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
13.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
14.
Identification of members of the protein phosphatase 1 gene family in the rat and enhanced expression of protein phosphatase 1 alpha gene in rat hepatocellular carcinomas.
Sasaki K, etal., Jpn J Cancer Res 1990 Dec;81(12):1272-80.
15.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
16.
Par-4: a new activator of myosin phosphatase.
Vetterkind S, etal., Mol Biol Cell. 2010 Apr 1;21(7):1214-24. doi: 10.1091/mbc.E09-08-0711. Epub 2010 Feb 3.
17.
DARPP-32, Jack of All Trades... Master of Which?
Yger M and Girault JA, Front Behav Neurosci. 2011 Sep 8;5:56. doi: 10.3389/fnbeh.2011.00056. eCollection 2011.
Ppp1cb (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 29,681,099 - 29,712,835 (-) NCBI GRCr8 mRatBN7.2 6 23,958,813 - 23,992,841 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 23,960,998 - 23,992,824 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 24,260,597 - 24,292,337 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 24,576,477 - 24,608,213 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 24,065,465 - 24,097,720 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 23,548,507 - 23,581,136 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 23,549,317 - 23,581,052 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 33,416,540 - 33,448,276 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 24,067,544 - 24,099,280 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 24,070,497 - 24,102,233 (-) NCBI Celera 6 23,460,146 - 23,491,883 (-) NCBI Celera Cytogenetic Map 6 q14 NCBI
PPP1CB (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 28,751,604 - 28,802,940 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 28,751,640 - 28,802,940 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 28,974,470 - 29,025,806 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 28,828,118 - 28,879,310 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 28,886,264 - 28,937,456 NCBI Celera 2 28,820,144 - 28,871,300 (+) NCBI Celera Cytogenetic Map 2 p23.2 NCBI HuRef 2 28,716,532 - 28,767,764 (+) NCBI HuRef CHM1_1 2 28,904,700 - 28,955,863 (+) NCBI CHM1_1 T2T-CHM13v2.0 2 28,795,220 - 28,846,552 (+) NCBI T2T-CHM13v2.0
Ppp1cb (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 32,616,192 - 32,651,057 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 32,616,187 - 32,674,777 (+) Ensembl GRCm39 Ensembl GRCm38 5 32,458,848 - 32,493,713 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 32,458,843 - 32,517,433 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 32,761,343 - 32,796,085 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 32,735,841 - 32,769,335 (+) NCBI MGSCv36 mm8 Celera 5 29,932,959 - 29,967,634 (+) NCBI Celera Cytogenetic Map 5 B1 NCBI cM Map 5 17.33 NCBI
Ppp1cb (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955469 10,662,032 - 10,682,398 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955469 10,657,029 - 10,682,398 (+) NCBI ChiLan1.0 ChiLan1.0
PPP1CB (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 12 97,705,718 - 97,757,636 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2A 97,709,065 - 97,761,608 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2A 28,758,176 - 28,809,561 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2A 28,863,650 - 28,889,401 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2A 28,862,083 - 28,889,401 (+) Ensembl panpan1.1 panPan2
PPP1CB (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 17 22,680,691 - 22,699,999 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 17 22,679,783 - 22,699,999 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 17 22,457,238 - 22,494,559 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 17 23,225,044 - 23,264,565 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 17 23,225,011 - 23,268,395 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 17 22,524,746 - 22,562,152 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 17 22,577,001 - 22,614,723 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 17 22,693,483 - 22,730,878 (+) NCBI UU_Cfam_GSD_1.0
Ppp1cb (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024406292 66,837,482 - 66,858,201 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936493 3,981,370 - 4,002,667 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936493 3,981,364 - 4,002,083 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PPP1CB (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 110,437,688 - 110,474,891 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 110,437,681 - 110,474,896 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 117,257,014 - 117,275,122 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PPP1CB (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 14 78,802,295 - 78,852,683 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 14 78,804,548 - 78,852,682 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666045 33,280,709 - 33,332,417 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ppp1cb (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 684 Count of miRNA genes: 294 Interacting mature miRNAs: 365 Transcripts: ENSRNOT00000006190 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
8552962 Pigfal16 Plasma insulin-like growth factor 1 level QTL 16 9.4 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 6 1 41223769 Rat 1549905 Stresp10 Stress response QTL 10 6.83 0.0066 stress-related behavior trait (VT:0010451) number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960) 6 1 27574569 Rat 8693645 Alc31 Alcohol consumption QTL 31 3.7 0.038 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 6 17532521 24011952 Rat 10401812 Kidm54 Kidney mass QTL 54 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 6 14368788 59368788 Rat 1331743 Uae28 Urinary albumin excretion QTL 28 4.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 6 1 34235784 Rat 2292589 Emca10 Estrogen-induced mammary cancer QTL 10 0.048 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 6 16536140 61536140 Rat 10401800 Kidm49 Kidney mass QTL 49 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 6 14368788 59368788 Rat 1300164 Rf15 Renal function QTL 15 3.12 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 6 5074497 54641141 Rat 9589129 Insul24 Insulin level QTL 24 19.06 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 6 1 41223769 Rat 1578758 Tcas9 Tongue tumor susceptibility QTL 9 3.29 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 6 1 37618905 Rat 4145119 Mcs25 Mammary carcinoma susceptibility QTL 25 0.0001 mammary gland integrity trait (VT:0010552) ratio of deaths to total study population during a period of time (CMO:0001023) 6 10894415 110548006 Rat 7411603 Foco13 Food consumption QTL 13 5.5 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 6 1 41223769 Rat 738024 Sach5 Saccharine consumption QTL 5 3.9 0.00039 consumption behavior trait (VT:0002069) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 6 1 43394190 Rat 1598843 Cm63 Cardiac mass QTL 63 2.6 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 6 1 39036266 Rat 7411542 Bw127 Body weight QTL 127 5.5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 6 1 41223769 Rat 9589048 Scfw3 Subcutaneous fat weight QTL 3 4.57 0.001 subcutaneous adipose mass (VT:1000472) abdominal subcutaneous fat pad weight (CMO:0002069) 6 1 41223769 Rat 2293839 Kiddil2 Kidney dilation QTL 2 4.8 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 6 20866422 81133036 Rat 738023 Alc17 Alcohol consumption QTL 17 3.1 0.003 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 6 1 27574569 Rat 1354616 Despr12 Despair related QTL 12 0.0012 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 6 1 27574569 Rat 1576309 Emca7 Estrogen-induced mammary cancer QTL 7 4 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 6 15107216 107351382 Rat 2293709 Bss23 Bone structure and strength QTL 23 5.18 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 6 1 42487980 Rat 2293650 Bss31 Bone structure and strength QTL 31 5.05 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 6 1 42487980 Rat 1578665 Bss16 Bone structure and strength QTL 16 4.4 femur morphology trait (VT:0000559) bone trabecular cross-sectional area (CMO:0002311) 6 11735669 72593685 Rat 7411584 Foco4 Food consumption QTL 4 4.3 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 6 1 42838846 Rat 2293841 Kiddil4 Kidney dilation QTL 4 4.4 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 6 20866422 81133036 Rat 1641898 Colcr4 Colorectal carcinoma resistance QTL4 3.71 0.0007 intestine integrity trait (VT:0010554) well differentiated malignant colorectal tumor surface area measurement (CMO:0002077) 6 20338777 62613667 Rat 2300176 Bmd51 Bone mineral density QTL 51 11.7 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 6 1 27574569 Rat 1300128 Rf16 Renal function QTL 16 3.89 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 6 5074497 34434305 Rat 1578668 Bmd14 Bone mineral density QTL 14 3.8 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 6 11735669 72593685 Rat 2301972 Bp325 Blood pressure QTL 325 4.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 6 1 72227641 Rat 2293656 Bss28 Bone structure and strength QTL 28 6.79 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 6 1 42487980 Rat 1359023 Bp272 Blood pressure QTL 272 2.5 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 16536140 27261739 Rat 1354664 Slep2 Serum leptin concentration QTL 2 4.49 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 6 16536140 71636405 Rat 2300190 Bmd52 Bone mineral density QTL 52 11.2 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 6 1 27574569 Rat
RH139638
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 23,991,569 - 23,991,761 (+) MAPPER mRatBN7.2 Rnor_6.0 6 23,579,887 - 23,580,078 NCBI Rnor6.0 Rnor_5.0 6 33,447,111 - 33,447,302 UniSTS Rnor5.0 RGSC_v3.4 6 24,098,115 - 24,098,306 UniSTS RGSC3.4 Celera 6 23,490,718 - 23,490,909 UniSTS Cytogenetic Map 6 q13 UniSTS
RH140505
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 23,991,661 - 23,991,752 (+) MAPPER mRatBN7.2 Rnor_6.0 6 23,579,979 - 23,580,069 NCBI Rnor6.0 Rnor_5.0 6 33,447,203 - 33,447,293 UniSTS Rnor5.0 RGSC_v3.4 6 24,098,207 - 24,098,297 UniSTS RGSC3.4 Celera 6 23,490,810 - 23,490,900 UniSTS Cytogenetic Map 6 q13 UniSTS
AA901261
Rat Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 6 q13 UniSTS
Ppp1cb
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 68,356,391 - 68,356,761 (+) MAPPER mRatBN7.2 Rnor_6.0 1 71,924,104 - 71,924,473 NCBI Rnor6.0 Rnor_5.0 1 73,311,615 - 73,311,984 UniSTS Rnor5.0 RGSC_v3.4 1 68,210,694 - 68,211,063 UniSTS RGSC3.4 RGSC_v3.4 1 67,082,822 - 67,083,191 UniSTS RGSC3.4 Celera 1 68,734,949 - 68,735,318 UniSTS Cytogenetic Map 6 q13 UniSTS
Ppp1cb
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 68,355,837 - 68,356,274 (+) MAPPER mRatBN7.2 mRatBN7.2 19 22,982,218 - 22,982,680 (+) MAPPER mRatBN7.2 Rnor_6.0 1 71,923,550 - 71,923,986 NCBI Rnor6.0 Rnor_6.0 19 29,370,983 - 29,371,444 NCBI Rnor6.0 Rnor_5.0 19 40,279,142 - 40,279,603 UniSTS Rnor5.0 Rnor_5.0 1 73,311,061 - 73,311,497 UniSTS Rnor5.0 Cytogenetic Map 6 q13 UniSTS Cytogenetic Map 19 q11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000006190 ⟹ ENSRNOP00000006190
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 23,960,999 - 23,992,824 (-) Ensembl Rnor_6.0 Ensembl 6 23,549,317 - 23,581,052 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000099315 ⟹ ENSRNOP00000076771
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 23,965,641 - 23,983,570 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000102151 ⟹ ENSRNOP00000086316
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 23,962,766 - 23,992,471 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000119348 ⟹ ENSRNOP00000091459
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 23,960,998 - 23,983,570 (-) Ensembl
RefSeq Acc Id:
NM_013065 ⟹ NP_037197
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 29,681,099 - 29,712,835 (-) NCBI mRatBN7.2 6 23,960,998 - 23,992,735 (-) NCBI Rnor_6.0 6 23,549,316 - 23,581,052 (-) NCBI Rnor_5.0 6 33,416,540 - 33,448,276 (-) NCBI RGSC_v3.4 6 24,067,544 - 24,099,280 (-) RGD Celera 6 23,460,146 - 23,491,883 (-) RGD
Sequence:
GGCTGGGGTCTGACGCGGCCCGGTTCGTGGGGGCCCGCTTGTTTATTTATTTATTTCTAGTGGGTGCCGCCGGCGTGTGCGCGCGCTCTCGCTGCTCGGCGGGGAGGGGGTGGGGGGAGGGCCGGCGC CCGGGGGGAGTTGGAGCCGGGGTCGAAACGCCGCGTGACTCGTAGGTGAGAACGCCGAGCTACCACCGCCGCCGCCGCTGCCGCCGCGGAGAAGCCCTTGTTCCCGCTGCGGGGAGGAGAGTCTGGTG CCTACAAGATGGCGGACGGGGAGCTGAACGTGGACAGCCTCATCACCCGCCTGCTGGAGGTACGAGGATGTCGTCCGGGAAAAATTGTGCAGATGACTGAAGCAGAAGTCCGAGGACTGTGTATCAAG TCTCGTGAAATCTTTCTTAGCCAGCCTATTCTTTTGGAATTGGAAGCGCCACTGAAGATTTGTGGAGATATTCATGGACAGTATACAGACTTACTGAGATTATTTGAATATGGAGGTTTTCCACCAGA AGCCAACTATCTTTTCTTAGGAGATTATGTGGACAGAGGAAAGCAGTCTTTGGAAACCATCTGTTTGCTATTGGCTTACAAAATCAAATACCCAGAGAACTTCTTTCTTCTACGAGGAAACCATGAGT GTGCTAGCATCAACCGCATTTATGGATTCTATGATGAGTGCAAACGAAGATTTAATATTAAATTGTGGAAGACATTCACTGATTGTTTTAATTGTCTGCCTATAGCTGCTATTGTTGATGAGAAAATC TTCTGCTGTCATGGAGGACTGTCACCAGACCTACAGTCTATGGAACAGATTCGGAGAATTATGAGACCCACTGACGTACCTGATACAGGTTTGCTTTGTGATTTACTGTGGTCCGACCCAGATAAGGA TGTACAAGGCTGGGGAGAAAATGATCGTGGTGTTTCTTTTACTTTTGGAGCTGATGTAGTCAGTAAATTTCTGAATCGTCATGATTTGGACTTGATTTGTCGAGCCCATCAGGTGGTAGAAGATGGAT ATGAATTTTTTGCTAAACGACAATTGGTAACTTTATTTTCTGCCCCAAATTACTGCGGCGAGTTTGACAATGCTGGTGGTATGATGAGTGTGGATGAAACTTTGATGTGTTCATTCCAGATATTGAAA CCATCTGAAAAGAAAGCTAAGTACCAGTATGGTGGGCTGAATTCTGGACGTCCTGTCACTCCGCCTCGAACAGCTAATCCACCGAAGAAAAGGTGAAGACAGGAATTCCGGAAAGAGAAACCATCAGA TTTGTTAAGGACATACTTCATAATATATAAGTGTGCACTGTAAAACCATCCAGCCATTCGACACCCTTTATGATGTCACACCTTTAACTTAAGGAGACGGGTAAAGGATCTTAAATTTTTTTCTAATA GAAAGATGTGCTACACTGTATTGTAATAAGTATACTCTGTTATAATATTCAACAAAGTTAAATCCAAATTCAAAAGTATCCATTAAAGTTCTATCTTCTCATATCACAGTTTTTAAAGTTGAAAGCAT CCCAGTTAAACTAGCTGCGTTAGTTACCCAGATGAGAGCATGAAGATCCATCTGTGTAATGTGGCTTTAGTGTTGCTTGGTTGTTTCTTTATTTTGGGCTTGTTTTGTTTTGTTTGTTTTTGCTAGAA TAATGGCATCTACTTTTCCTATTTTTCCCTAACCATTTTAAAAAGTGAAAATGGGAAGAGCTTTAAAGACATTCACCAACTATTCTTTTCCTTCACTTATCTACTTAAGGAACTGTTGGATCTTACTA AGAAAACTTACGCCTCATAATAAAAAGGAACTTTAGAGGCCGATAGGTTTTAAAAATATACAAACTATTTGATCCAATGATTTTAATCAAACAGTTTGACTGGGCAAACTTTGCAGCTGATAATGACT ATTTCGCTTTTTACAAATTGCCACTGATTTGGATTTGTGCACTCTAACCTTTAATTTATTGATGCTCTATTGTGCAGTAGCATTTCATTTAAGATAAGGCTCATATAGTACTATCCAAAACTAGTTGG TAATGTGATTATGTGGTACCTTGGCTTTAGGTTTTAATTCGCACGAAACACCTTTTGGCATGCTTAACTTTCTGGTATTATCCTCACCTGCATTGGTTTTGTTTTTTGGGGTTTTTGTTGTTGTTTGT TTGTTTGTTTTTAGATCCACAGAACATGAGAATCCTTTTTGACAAGCCTTGGAAAGCTGGCTCTTCTTTCCCTCTCTATGTGAAGGATGTATTTAAATGAACACTGGTCAGTGGGACATTGTCAGCTC TGAGTATTGGGTGCTTCACTGTCTAATAATTGCCATGTGAATGTTGTTTTTGACTGTAAGGCTATGTCACTAAAGATTTTTACTCTGCGTTTTCATAATCAAAGGTCATGATGTGTATAGACATGCTT TGTAGTGAAGTATAGTAGCAATAATTTCTGCACATGATCAAGAGTTTATTGCAGCATTTCTTTCCCTGTTCTCTCTTTTTTAAGGGTTAGCATTAACAAATGTCAAGGAATAGCAAAGTCAACAAAGA CTTTAGGAGGTGGAATTAAGAACACACAGATTTGTGATTCTTTGGATGTGACACTTATTGGATGTTATTCTAAAGTCTTATTGAACATTGTCAAATTTGTAAGCTTCATGGGGATGGACATAATGTTT ATATAATGCCCTTCTTATGTGTTACCATAGATGTGAAACCTTATATTGTCTTTGAAAATGTTAAATTGAGAACTCTGTTAACATTTTATGGATTGGCACATTATATTACTGCAAGAAACATTTGATTT TCAGCACAGTGCAAAAGTTCTTTAAAATGCATATGTCTTTTTTTCTAATTCAATTTTGTTTAAAGCACATTTTAAATGTAGTTTTCTCATTTAGTAAAAGTTGTCTAATTGAAAAAAAAAAAAAAA
hide sequence
RefSeq Acc Id:
XM_039111812 ⟹ XP_038967740
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 29,681,099 - 29,712,655 (-) NCBI mRatBN7.2 6 23,958,813 - 23,992,770 (-) NCBI
RefSeq Acc Id:
NP_037197 ⟸ NM_013065
- UniProtKB:
P62142 (UniProtKB/Swiss-Prot), A6HA24 (UniProtKB/TrEMBL), A0A8I6ABP0 (UniProtKB/TrEMBL)
- Sequence:
MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECAS INRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEF FAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR
hide sequence
Ensembl Acc Id:
ENSRNOP00000006190 ⟸ ENSRNOT00000006190
RefSeq Acc Id:
XP_038967740 ⟸ XM_039111812
- Peptide Label:
isoform X1
Ensembl Acc Id:
ENSRNOP00000091459 ⟸ ENSRNOT00000119348
Ensembl Acc Id:
ENSRNOP00000076771 ⟸ ENSRNOT00000099315
Ensembl Acc Id:
ENSRNOP00000086316 ⟸ ENSRNOT00000102151
RGD ID: 13694419
Promoter ID: EPDNEW_R4944
Type: multiple initiation site
Name: Ppp1cb_1
Description: protein phosphatase 1 catalytic subunit beta
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 6 23,581,000 - 23,581,060 EPDNEW
BioCyc Gene
G2FUF-38379
BioCyc
Ensembl Genes
ENSRNOG00000004612
Ensembl, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Transcript
ENSRNOT00000006190.5
UniProtKB/Swiss-Prot
ENSRNOT00000099315.1
UniProtKB/TrEMBL
ENSRNOT00000102151.1
UniProtKB/TrEMBL
ENSRNOT00000119348.1
UniProtKB/TrEMBL
Gene3D-CATH
3.60.21.10
UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE
IMAGE:5623630
IMAGE-MGC_LOAD
InterPro
Calcineurin-like_PHP_ApaH
UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Metallo-depent_PP-like
UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PP1_catalytic_subunit
UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ser/Thr-sp_prot-phosphatase
UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
STPPase_N
UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report
rno:25594
UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE
MGC:72523
IMAGE-MGC_LOAD
NCBI Gene
25594
ENTREZGENE
PANTHER
SERINE/THREONINE PROTEIN PHOSPHATASE
UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SERINE/THREONINE-PROTEIN PHOSPHATASE PP1-ALPHA CATALYTIC SUBUNIT-RELATED
UniProtKB/TrEMBL
SERINE_THREONINE-PROTEIN PHOSPHATASE
UniProtKB/TrEMBL
SERINE_THREONINE-PROTEIN PHOSPHATASE PP1-BETA CATALYTIC SUBUNIT
UniProtKB/Swiss-Prot
Pfam
Metallophos
UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
STPPase_N
UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PharmGKB
PPP1CB
RGD
PhenoGen
Ppp1cb
PhenoGen
PRINTS
STPHPHTASE
UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE
SER_THR_PHOSPHATASE
UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx
ENSRNOG00000004612
RatGTEx
SMART
PP2Ac
UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP
SSF56300
UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt
A0A8I5ZJA1_RAT
UniProtKB/TrEMBL
A0A8I6A5W1_RAT
UniProtKB/TrEMBL
A0A8I6ABP0
ENTREZGENE, UniProtKB/TrEMBL
A6HA24
ENTREZGENE, UniProtKB/TrEMBL
P62142
ENTREZGENE, UniProtKB/Swiss-Prot
UniProt Secondary
P37140
UniProtKB/Swiss-Prot
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-02-17
Ppp1cb
protein phosphatase 1 catalytic subunit beta
Ppp1cb
protein phosphatase 1, catalytic subunit, beta isozyme
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2011-08-02
Ppp1cb
protein phosphatase 1, catalytic subunit, beta isozyme
Ppp1cb
protein phosphatase 1, catalytic subunit, beta isoform
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2002-06-10
Ppp1cb
Protein phosphatase 1, catalytic subunit, beta isoform
Symbol and Name status set to approved
70586
APPROVED