Gene: Cldn34 (claudin 34) Chinchilla lanigera |
|
Analyze |
|
Symbol: |
Cldn34 |
Name: |
claudin 34 |
RGD ID: |
8732142 |
Description: |
ASSOCIATED WITH autistic disorder (ortholog) |
Type: |
protein-coding
|
RefSeq Status: |
MODEL |
Previously known as: |
claudin-34 |
RGD Orthologs |
|
Alliance Orthologs |
|
More Info |
more info ...
|
More Info |
Species |
Gene symbol and name |
Data Source |
Assertion derived from |
less info ...
|
Orthologs 1 |
Homo sapiens (human): |
CLDN34 (claudin 34) |
NCBI |
Ortholog |
Mus musculus (house mouse): |
Cldn34a (claudin 34A) |
Transitive Ortholog Pipeline |
Transitive Ortholog Pipeline |
Rattus norvegicus (Norway rat): |
Cldn34a (claudin 34A) |
Transitive Ortholog Pipeline |
Transitive Ortholog Pipeline |
Pan paniscus (bonobo/pygmy chimpanzee): |
CLDN34 (claudin 34) |
Transitive Ortholog Pipeline |
Transitive Ortholog Pipeline |
Canis lupus familiaris (dog): |
CLDN34 (claudin 34) |
Transitive Ortholog Pipeline |
Transitive Ortholog Pipeline |
Ictidomys tridecemlineatus (thirteen-lined ground squirrel): |
Cldn34 (claudin 34) |
Transitive Ortholog Pipeline |
Transitive Ortholog Pipeline |
Chlorocebus sabaeus (green monkey): |
CLDN34 (claudin 34) |
Transitive Ortholog Pipeline |
Transitive Ortholog Pipeline |
Heterocephalus glaber (naked mole-rat): |
Cldn34 (claudin 34) |
Transitive Ortholog Pipeline |
Transitive Ortholog Pipeline |
|
Latest Assembly: |
ChiLan1.0 - Chinchilla ChiLan1.0 Assembly |
Position: |
Chinchilla Assembly | Chr | Position (strand) | Source | Genome Browsers |
---|
JBrowse | NCBI | UCSC | Ensembl |
---|
ChiLan1.0 | NW_004955544 | 3,190,014 - 3,190,573 (+) | NCBI | ChiLan1.0 | ChiLan1.0 | | |
|
JBrowse: |
View Region in Genome Browser (JBrowse)
|
Model |
|
Imported Disease Annotations - ClinVar
|
References
Genomics
Comparative Map Data
Cldn34 (Chinchilla lanigera - long-tailed chinchilla) |
Chinchilla Assembly | Chr | Position (strand) | Source | Genome Browsers |
---|
JBrowse | NCBI | UCSC | Ensembl |
---|
ChiLan1.0 | NW_004955544 | 3,190,014 - 3,190,573 (+) | NCBI | ChiLan1.0 | ChiLan1.0 | | |
|
CLDN34 (Homo sapiens - human) |
Human Assembly | Chr | Position (strand) | Source | Genome Browsers |
---|
JBrowse | NCBI | UCSC | Ensembl |
---|
GRCh38 | X | 9,967,358 - 9,968,352 (+) | NCBI | GRCh38 | GRCh38 | hg38 | GRCh38 | GRCh38.p14 Ensembl | X | 9,967,358 - 9,968,352 (+) | Ensembl | GRCh38 | | hg38 | GRCh38 | GRCh37 | X | 9,935,398 - 9,936,392 (+) | NCBI | GRCh37 | GRCh37 | hg19 | GRCh37 | Celera | X | 14,106,681 - 14,107,325 (+) | NCBI | | Celera | | | Cytogenetic Map | X | p22.2 | NCBI | | | | | HuRef | X | 7,767,169 - 7,767,813 (+) | NCBI | | HuRef | | | CHM1_1 | X | 9,965,818 - 9,966,462 (+) | NCBI | | CHM1_1 | | | T2T-CHM13v2.0 | X | 9,549,941 - 9,550,935 (+) | NCBI | | T2T-CHM13v2.0 | | |
|
Cldn34a (Mus musculus - house mouse) |
Mouse Assembly | Chr | Position (strand) | Source | Genome Browsers |
---|
JBrowse | NCBI | UCSC | Ensembl |
---|
GRCm39 | X | 151,320,524 - 151,347,194 (+) | NCBI | GRCm39 | GRCm39 | mm39 | | GRCm39 Ensembl | X | 151,320,497 - 151,347,193 (+) | Ensembl | | GRCm39 Ensembl | | | GRCm38 | X | 152,537,528 - 152,564,198 (+) | NCBI | GRCm38 | GRCm38 | mm10 | GRCm38 | GRCm38.p6 Ensembl | X | 152,537,501 - 152,564,197 (+) | Ensembl | GRCm38 | | mm10 | GRCm38 | MGSCv37 | X | 148,997,877 - 148,998,512 (+) | NCBI | GRCm37 | MGSCv37 | mm9 | NCBIm37 | MGSCv36 | X | 148,997,877 - 148,998,512 (+) | NCBI | | MGSCv36 | mm8 | | Celera | X | 136,689,100 - 136,689,735 (-) | NCBI | | Celera | | | Cytogenetic Map | X | F3 | NCBI | | | | | cM Map | X | 68.46 | NCBI | | | | |
|
Cldn34a (Rattus norvegicus - Norway rat) |
Rat Assembly | Chr | Position (strand) | Source | Genome Browsers |
---|
JBrowse | NCBI | UCSC | Ensembl |
---|
GRCr8 | X | 25,164,586 - 25,233,074 (+) | NCBI | | GRCr8 | | | mRatBN7.2 | X | 21,717,101 - 21,737,363 (+) | NCBI | mRatBN7.2 | mRatBN7.2 | | | mRatBN7.2 Ensembl | X | 21,736,419 - 21,737,054 (+) | Ensembl | | mRatBN7.2 Ensembl | | | UTH_Rnor_SHR_Utx | X | 22,638,720 - 22,639,355 (+) | NCBI | Rnor_SHR | UTH_Rnor_SHR_Utx | | | UTH_Rnor_SHRSP_BbbUtx_1.0 | X | 26,059,696 - 26,060,331 (+) | NCBI | Rnor_SHRSP | UTH_Rnor_SHRSP_BbbUtx_1.0 | | | UTH_Rnor_WKY_Bbb_1.0 | X | 22,318,369 - 22,319,004 (+) | NCBI | Rnor_WKY | UTH_Rnor_WKY_Bbb_1.0 | | | Rnor_6.0 | X | 23,371,171 - 23,415,287 (+) | NCBI | Rnor6.0 | Rnor_6.0 | rn6 | Rnor6.0 | Rnor_6.0 Ensembl | X | 23,414,354 - 23,414,989 (+) | Ensembl | Rnor6.0 | | rn6 | Rnor6.0 | Rnor_5.0 | X | 23,785,424 - 23,832,886 (+) | NCBI | Rnor5.0 | Rnor_5.0 | rn5 | Rnor5.0 | RGSC_v3.4 | X | 42,210,493 - 42,211,128 (+) | NCBI | RGSC3.4 | RGSC_v3.4 | rn4 | RGSC3.4 | Celera | X | 22,158,824 - 22,159,459 (+) | NCBI | | Celera | | | Cytogenetic Map | X | q13 | NCBI | | | | |
|
CLDN34 (Pan paniscus - bonobo/pygmy chimpanzee) |
Bonobo Assembly | Chr | Position (strand) | Source | Genome Browsers |
---|
JBrowse | NCBI | UCSC | Ensembl |
---|
NHGRI_mPanPan1-v2 | X | 11,762,676 - 11,773,083 (+) | NCBI | | NHGRI_mPanPan1-v2 | | | NHGRI_mPanPan1 | X | 11,766,343 - 11,776,750 (+) | NCBI | | NHGRI_mPanPan1 | | | Mhudiblu_PPA_v0 | X | 2,591,451 - 2,599,328 (+) | NCBI | Mhudiblu_PPA_v0 | Mhudiblu_PPA_v0 | panPan3 | | PanPan1.1 | X | 9,850,227 - 9,850,932 (+) | NCBI | panpan1.1 | PanPan1.1 | panPan2 | | PanPan1.1 Ensembl | X | 9,850,227 - 9,850,871 (+) | Ensembl | panpan1.1 | | panPan2 | |
|
CLDN34 (Canis lupus familiaris - dog) |
Dog Assembly | Chr | Position (strand) | Source | Genome Browsers |
---|
JBrowse | NCBI | UCSC | Ensembl |
---|
CanFam3.1 | X | 6,643,967 - 6,657,995 (+) | NCBI | CanFam3.1 | CanFam3.1 | canFam3 | CanFam3.1 | CanFam3.1 Ensembl | X | 6,649,645 - 6,658,010 (+) | Ensembl | CanFam3.1 | | canFam3 | CanFam3.1 | Dog10K_Boxer_Tasha | X | 6,600,165 - 6,614,221 (+) | NCBI | | Dog10K_Boxer_Tasha | | | ROS_Cfam_1.0 | X | 6,590,926 - 6,604,982 (+) | NCBI | | ROS_Cfam_1.0 | | | UMICH_Zoey_3.1 | X | 6,581,258 - 6,595,313 (+) | NCBI | | UMICH_Zoey_3.1 | | | UNSW_CanFamBas_1.0 | X | 6,616,449 - 6,630,505 (+) | NCBI | | UNSW_CanFamBas_1.0 | | | UU_Cfam_GSD_1.0 | X | 6,606,843 - 6,620,899 (+) | NCBI | | UU_Cfam_GSD_1.0 | | |
|
Cldn34 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel) |
|
CLDN34 (Chlorocebus sabaeus - green monkey) |
|
Cldn34 (Heterocephalus glaber - naked mole-rat) |
|
Expression
Sequence
RefSeq Acc Id: |
XM_013508184 ⟹ XP_013363638 |
Type: |
CODING |
Position: |
Chinchilla Assembly | Chr | Position (strand) | Source |
---|
ChiLan1.0 | NW_004955544 | 3,190,014 - 3,190,573 (+) | NCBI |
|
Sequence: |
ATGACCTTTCTTGTCCATACTGCCGATTGCCAGGTCCCAGGCTGATCTGTTGCCACCATCACAT GGATCCTCTGCAGCACTTCCATGGGCCTCNTGGAGTGGCACATGTGGCACATGGATGACCTGTG GCTCTCCTACGCTGGCACCATCTGTGTGGGAGTATGAAAAGTCCACATTTACCACCATCACAAC TGCAGCAAAGTCAGAATGTGTCACCCACACACCTACAGTGATACATTCCTCGCTCCCAGTATAA GCACAGCTCAGCACTTCCTGGTGGTCACCAGCACTCTAGGGCTCTTTGCCAAAGCCTTCACTAT TTTAGCACTCAGGAACTCACATGTGGGTATCCTACAGAAGAATGTCATCCACATCCCATTCATC TTTGCATGGGGTCTAGTCACTGCTGCTAGTGGATGCATGTCCATTGCTGTTCTCTGGAATCACT ACTATGTCACAAATATCAAGTGGATTCACTTCCTACCATCTTTCCATGTCCCCAATACTCAGGA AAGTGGAAGTGGCATGCTCATGGCAATGCCAGCTGCATCCATAATGTAG
hide sequence
|
RefSeq Acc Id: |
XP_013363638 ⟸ XM_013508184 |
- Sequence: |
MTFLVHTADCQVPGXSVATITWILCSTSMGLXEWHMWHMDDLWLSYAGTICVGVXKVHIYHHHN CSKVRMCHPHTYSDTFLAPSISTAQHFLVVTSTLGLFAKAFTILALRNSHVGILQKNVIHIPFI FAWGLVTAASGCMSIAVLWNHYYVTNIKWIHFLPSFHVPNTQESGSGMLMAMPAASIM
hide sequence
|
Additional Information
Nomenclature History
Date |
Current Symbol |
Current Name |
Previous Symbol |
Previous Name |
Description |
Reference |
Status |
2015-08-25 |
Cldn34 |
claudin 34 |
LOC102009880 |
uncharacterized LOC102009880 |
Symbol and/or name change |
5135510 |
APPROVED |
|
|