Ifnab (interferon alpha B) - Rat Genome Database

Name: Ifnab
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Ifnab (interferon alpha B) Mus musculus

Analyze

No known orthologs.

Symbol:

Ifnab

Name:

interferon alpha B

RGD ID:

1621617

MGI Page

MGI

Description:

Predicted to enable cytokine activity and type I interferon receptor binding activity. Predicted to be involved in several processes, including B cell activation; lymphocyte activation involved in immune response; and positive regulation of peptidyl-serine phosphorylation of STAT protein. Predicted to be active in extracellular space. Human ortholog(s) of this gene implicated in Crimean-Congo hemorrhagic fever; common cold; hepatitis B; liver disease (multiple); and sarcoidosis. Orthologous to several human genes including IFNA4 (interferon alpha 4).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

If1ai8; interferon 1ai8; interferon alpha family, gene B

RGD Orthologs

Alliance Genes

More Info

homologs ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Other homologs ²				less info ...
Homo sapiens (human):	IFNA4 (interferon alpha 4)	HGNC	Ensembl, HomoloGene, OMA, OrthoMCL, Panther, Treefam
Homo sapiens (human):	IFNA1 (interferon alpha 1)	HGNC	Ensembl, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Homo sapiens (human):	IFNA7 (interferon alpha 7)	HGNC	Ensembl, OMA, OrthoMCL, Panther, Treefam
Homo sapiens (human):	IFNA10 (interferon alpha 10)	HGNC	Ensembl, OMA, OrthoMCL, Panther, Treefam
Homo sapiens (human):	IFNA13 (interferon alpha 13)	HGNC	Ensembl, OMA, OrthoDB, OrthoMCL, Treefam
Homo sapiens (human):	IFNA17 (interferon alpha 17)	HGNC	Ensembl, OMA, OrthoMCL, Panther, Treefam
Homo sapiens (human):	IFNA21 (interferon alpha 21)	HGNC	Ensembl, OMA, Panther, Treefam
Homo sapiens (human):	IFNA8 (interferon alpha 8)	HGNC	Ensembl, OMA, Panther, Treefam
Homo sapiens (human):	IFNA14 (interferon alpha 14)	HGNC	Ensembl, OMA, Panther, Treefam
Homo sapiens (human):	IFNA6 (interferon alpha 6)	HGNC	Ensembl, OMA, Panther, Treefam
Homo sapiens (human):	IFNA2 (interferon alpha 2)	HGNC	Ensembl, OMA, Panther, Treefam
Homo sapiens (human):	IFNA16 (interferon alpha 16)	HGNC	Ensembl, OMA, Panther, Treefam
Homo sapiens (human):	IFNA5 (interferon alpha 5)	HGNC	Ensembl, OMA, Panther
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Ifna4 (interferon, alpha 4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Homo sapiens (human):	IFNA4 (interferon alpha 4)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	IFNA21 (interferon alpha 21)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	IFNA8 (interferon alpha 8)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	IFNA7 (interferon alpha 7)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	IFNA10 (interferon alpha 10)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	IFNA14 (interferon alpha 14)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	IFNA6 (interferon alpha 6)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	IFNA2 (interferon alpha 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	IFNA5 (interferon alpha 5)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	IFNA16 (interferon alpha 16)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	IFNA13 (interferon alpha 13)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	IFNA17 (interferon alpha 17)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	IFNA1 (interferon alpha 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ifnphi3 (interferon phi 3)	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	ifnphi2 (interferon phi 2)	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	88,608,836 - 88,609,505 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	88,608,539 - 88,609,596 (-)	Ensembl		GRCm39 Ensembl
GRCm38	4	88,690,599 - 88,691,268 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	88,690,302 - 88,691,359 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	88,336,503 - 88,337,172 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	88,161,886 - 88,162,458 (-)	NCBI		MGSCv36	mm8
Celera	4	87,199,721 - 87,200,390 (-)	NCBI		Celera
Cytogenetic Map	4	C4	NCBI
cM Map	4	42.02	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adaptive immune response (IBA)

B cell differentiation (IBA)

B cell proliferation (IBA)

cytokine-mediated signaling pathway (IBA)

humoral immune response (IBA)

natural killer cell activation involved in immune response (IBA)

positive regulation of peptidyl-serine phosphorylation of STAT protein (IBA)

response to exogenous dsRNA (IBA)

T cell activation involved in immune response (IBA)

Cellular Component

extracellular space (IBA,ISO)

Molecular Function

cytokine activity (IBA,ISO)

type I interferon receptor binding (IBA)

Molecular Pathway Annotations Click to see Annotation Detail View

autoimmune thyroiditis pathway (IEA)

autophagy pathway (IEA)

hepatitis C pathway (IEA)

influenza A pathway (IEA)

Jak-Stat signaling pathway (IEA)

measles pathway (IEA)

Retinoic acid-inducible gene (RIG) I-like receptor signaling pathway (IEA)

Toll-like receptor signaling pathway (IEA)

tuberculosis pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:6094686	PMID:7530016	PMID:7684767	PMID:8245849	PMID:8786318	PMID:12205107	PMID:12477932	PMID:14983024	PMID:15240719	PMID:15684736	PMID:17277142	PMID:18726328
PMID:21873635

Genomics

Variants

Variants in Ifnab
6 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	203
Count of miRNA genes:	196
Interacting mature miRNAs:	203
Transcripts:	ENSMUST00000105146
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCm39)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
11567249	Elorr3_m	ethanol induced loss of righting response 3 (mouse)					4	3722677	156268235	Mouse
4142047	Mvwf3_m	modifier of von Willebrand factor 3 (mouse)			Not determined			14010457	117072206	Mouse
4141911	W6q15_m	weight 6 weeks QTL 15 (mouse)			Not determined			17892616	88982216	Mouse
39128211	Lwq22_m	liver weight QTL 22 (mouse)					4	17892616	88982216	Mouse
1357453	Kidq4_m	kidney weight QTL 4 (mouse)			Not determined		4	17892616	88982216	Mouse
26884449	Sklq2_m	skull length QTL 2, 5 week (mouse)					4	36700000	128993793	Mouse
27226724	Tibw2_m	tibia width 2, proximal, 10 week (mouse)					4	43000000	108357197	Mouse
1558948	Ath8_m	atherosclerosis 8 (mouse)			Not determined		4	45658442	105156995	Mouse
1357895	Ctrcts_m	cataract severity (mouse)			Not determined		4	45709925	138342753	Mouse
1300966	Pabr2_m	plasma apolipoprotein B (human) regulator 2 (mouse)			Not determined		4	46332646	105801860	Mouse
11532714	Sluc43_m	susceptibility to lung cancer 43 (mouse)					4	46642108	123127211	Mouse
1301033	Abbp2_m	A/J and C57BL/6 blood pressure 2 (mouse)			Not determined		4	53550839	93763305	Mouse
4141900	Skts-fp1_m	skin tumor susceptibility in FVB and PWK 1 (mouse)			Not determined		4	53550839	124055180	Mouse
26884434	Zlq1_m	zygomatic length QTL 1, 5 week (mouse)					4	53700000	103257197	Mouse
27095905	Scvln3_m	sacral vertebrae length 2, 5 week (mouse)					4	55600000	128993793	Mouse
27095934	Ulnl2_m	ulna length 2, 5 week (mouse)					4	57700000	94788237	Mouse
26884437	Sklq13_m	skull length QTL 13, 16 week (mouse)					4	57700000	155684457	Mouse
10043964	Obq26_m	obesity QTL 26 (mouse)			Not determined		4	59047251	93047251	Mouse
1357507	Synch2_m	synechia 2 (mouse)			Not determined		4	60145277	94145424	Mouse
1301190	Cd4ts2_m	CD4 T cell subset 2 (mouse)			Not determined		4	60145277	94145424	Mouse
1357870	Pfat1_m	predicted fat percentage 1 (mouse)			Not determined		4	63619526	97619685	Mouse
12879903	Berr8_m	berghei resistance locus 8 (mouse)					4	64222460	98222460	Mouse
27095939	Ulnl9_m	ulna length 9, 16 week (mouse)					4	65318237	118857197	Mouse
13506251	Cytrq1_m	cytokine response QTL 1 (mouse)					4	65718086	99718086	Mouse
25314312	Syncl2_m	synaptonemal complex length 2 (mouse)					4	65718237	146584457	Mouse
12880404	Embq1_m	emotional behavior QTL 1 (mouse)					4	65757203	95921546	Mouse
27095938	Ulnl6_m	ulna length 6, 10 week (mouse)					4	66718237	98588237	Mouse
1301757	Tlsr4_m	thymic lymphoma suppressor region 4 (mouse)			Not determined		4	66757130	100757258	Mouse
1357561	Mbsyd_m	metabolic syndrome (mouse)			Not determined		4	66888445	100888588	Mouse
27095900	Scvln9_m	sacral vertebrae length 2, 10 week (mouse)					4	68018237	107157197	Mouse
27095917	Scvln14_m	sacral vertebrae length 2, 16 week (mouse)					4	68018237	130277062	Mouse
26884445	Sklq7_m	skull length QTL 7, 10 week (mouse)					4	68018237	150884457	Mouse
27095924	Pglq2_m	pelvic girdle length QTL 2, 5 week (mouse)					4	69118237	130727311	Mouse
1302057	Pgia27_m	proteoglycan induced arthritis 27 (mouse)			Not determined		4	70067227	104067464	Mouse
12879897	Berr4_m	berghei resistance locus 4 (mouse)					4	71982069	105982216	Mouse
1302044	Nss1_m	NOD Sjogren's syndrome 1 (mouse)			Not determined		4	71982069	105982216	Mouse
1301739	Pitm2_m	prion incubation time 2 (mouse)			Not determined		4	71982069	105982216	Mouse
1302031	Bulb1_m	bulb size 1 (mouse)			Not determined		4	74033887	108034029	Mouse
1301597	Anxty_m	anxiety (mouse)			Not determined		4	74137574	128009280	Mouse
10412193	Plep_m	plasma lepin levels (mouse)			Not determined		4	74444699	108444983	Mouse
11532700	Sluc43d_m	susceptibility to lung cancer 43d (mouse)					4	74444699	108444983	Mouse
11532701	Sluc43e_m	susceptibility to lung cancer 43e (mouse)					4	74444699	108444983	Mouse
11532702	Sluc43f_m	susceptibility to lung cancer 43f (mouse)					4	74444699	108444983	Mouse
11532703	Sluc43g_m	susceptibility to lung cancer 43g (mouse)					4	74444699	108444983	Mouse
11532704	Sluc43a_m	susceptibility to lung cancer 43a (mouse)					4	74444699	108444983	Mouse
11532705	Sluc43b_m	susceptibility to lung cancer 43b (mouse)					4	74444699	108444983	Mouse
11532706	Sluc43c_m	susceptibility to lung cancer 43c (mouse)					4	74444699	108444983	Mouse
11532707	Sluc43h_m	susceptibility to lung cancer 43h (mouse)					4	74444699	108444983	Mouse
11532708	Sluc43i_m	susceptibility to lung cancer 43i (mouse)					4	74444699	108444983	Mouse
26884431	Zlq8_m	zygomatic length QTL 8, 16 week (mouse)					4	74718237	108357197	Mouse
26884406	Huml3_m	humerus length 3, 10 week (mouse)					4	75618237	100157197	Mouse
1301545	Gauc_m	glucose area under curve (mouse)			Not determined		4	76763107	110763305	Mouse
1300697	Sle2_m	systemic lupus erythmatosus susceptibility 2 (mouse)			Not determined		4	77957579	111957775	Mouse
11039504	Ltpr4a_m	Leishmania tropica response 4a (mouse)					4	79365751	113365867	Mouse
11039505	Ltpr4c_m	Leishmania tropica response 4c (mouse)					4	79365751	113365867	Mouse
11039506	Ltpr4b_m	Leishmania tropica response 4b (mouse)					4	79365751	113365867	Mouse
11039517	Ltpr4_m	Leishmania tropica response 4 (mouse)					4	79365751	113365867	Mouse
4142203	Lyr_m	lymphoma resistance (mouse)			Not determined			80752445	88769188	Mouse
12904738	Idohtq_m	iris defect with ocular hypertension QTL (mouse)					4	80752467	93112991	Mouse
12904933	Edlmmq3_m	extensor digitorum longus muscle mass QTL 3 (mouse)					4	81213991	115213991	Mouse
1302204	Spm1_m	splenomegaly modifier (mouse)			Not determined		4	82244395	116244582	Mouse
27095921	Pglq12_m	pelvic girdle length QTL 12, 16 week (mouse)					4	83118237	108357197	Mouse
1301867	Idd11_m	insulin dependent diabetes susceptibility 11 (mouse)			Not determined		4	83604870	117605006	Mouse
10412176	Habiir3_m	hyperoxic acute lung injury imprinted region 3 (mouse)			Not determined		4	83757130	94293740	Mouse
27226787	Feml14_m	femur length 14, 10 week (mouse)					4	84918237	107157197	Mouse
26884435	Zlq4_m	zygomatic length QTL 4, 10 week (mouse)					4	85118237	104957197	Mouse
1357726	Lnopy1_m	lens opacity 1 (mouse)			Not determined		4	85428838	119429037	Mouse
1301556	Cd4vts1_m	CD4 virgin T cell subset 1 (mouse)			Not determined		4	85428838	119429037	Mouse
1301930	Papg1_m	pulmonary adenoma progression 1 (mouse)			Not determined		4	85781167	119781279	Mouse
1301118	Bbaa23_m	B.burgdorferi-associated arthritis 23 (mouse)			Not determined		4	85781167	119781279	Mouse
27226801	Feml6_m	femur length 6, 5 week (mouse)					4	87518237	103257197	Mouse
27226746	Metcl8_m	metatarsal-calcaneal length 8, 10 week (mouse)					4	87518237	107157197	Mouse
27226739	Metcl14_m	metatarsal-calcaneal length 14, 16 week (mouse)					4	87518237	108357197	Mouse
27095927	Pglq7_m	pelvic girdle length QTL 7, 10 week (mouse)					4	88118237	108357197	Mouse
27226716	Metcl2_m	metatarsal-calcaneal length 2, 5 week (mouse)					4	88118237	118557197	Mouse
27226770	Tibl11_m	tibia length 11, 10 week (mouse)					4	88518237	108357197	Mouse
27226766	Tibl17_m	tibia length 17, 16 week (mouse)					4	88518237	108457197	Mouse
1300601	Tlsr1_m	thymic lymphoma suppressor region 1 (mouse)			Not determined		4	88601158	94957775	Mouse

Markers in Region

L38698

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	4	88,816,851 - 88,816,926	UniSTS	GRCm38
GRCm38	4	88,690,530 - 88,690,605	UniSTS	GRCm38
MGSCv37	4	88,462,755 - 88,462,830	UniSTS	GRCm37
MGSCv37	4	88,336,434 - 88,336,509	UniSTS	GRCm37
Celera	4	87,199,652 - 87,199,727	UniSTS
Celera	4	87,298,536 - 87,298,612	UniSTS
Cytogenetic Map	4	C4	UniSTS
cM Map	4	42.6	UniSTS
Whitehead_YAC	4		UniSTS

Ifna1

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	4	C4	UniSTS
cM Map	4	42.6	UniSTS

UniSTS:491243

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	4	88,690,599 - 88,691,268	UniSTS	GRCm38
MGSCv37	4	88,336,503 - 88,337,172	UniSTS	GRCm37
Celera	4	87,297,869 - 87,298,542	UniSTS
Celera	4	87,199,721 - 87,200,390	UniSTS
Cytogenetic Map	4	C4	UniSTS

Expression

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_008336	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AL928605	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC116862	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC116864	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	L38698	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	LR760991	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSMUST00000071378 ⟹ ENSMUSP00000071333

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	4	88,608,539 - 88,609,596 (-)	Ensembl
GRCm38.p6 Ensembl	4	88,690,302 - 88,691,359 (-)	Ensembl

RefSeq Acc Id:

NM_008336 ⟹ NP_032362

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	4	88,608,836 - 88,609,505 (-)	NCBI
GRCm38	4	88,690,599 - 88,691,268 (-)	ENTREZGENE
MGSCv37	4	88,336,503 - 88,337,172 (-)	RGD
Celera	4	87,199,721 - 87,200,390 (-)	RGD
cM Map	4		ENTREZGENE

Sequence:

show sequence

CCAAACAGCCCAGAAGACCAGCAGCATTGGCAATATTCACCATGGCTAGGCTCAGCACTTTCCT
AATGGTCCTGGCAGTGATGAGCTACTGGTCAACCTGCCCTCTAGGATGTGACCTGCCTCAGACT
CATAACCTCAGGAACAAGAGAGCCTTGACACTCCTGGTACAAATGAGGAGACTCTCCCCTCTCT
CCTGCCTGAAGGACAGGAAGGACTTCGGATTCCCCCAGGAGAAGGTGGATGCCCAGCAGATCCA
GGAGGCTCAAGCCATCCCTGTCCTGACTGAGCTGACCCAGCAGATGCTGACCCTCTTCACATCA
AAGGCTTCATCTGCTGCTTGGAATGCAACCCTACTAGACTCATTCTGCAATGACCTCCACCAGC
AACTCAATGACCTGAAAACCTGTCTGATGCAGGAGGTGGGGGTGCAGGAATCTCCCCTGACCCA
GGAAGACTCCCTGCTGGCTGTGAGGAAATACTTCCACAGCATCACTGTGTACCTGAGAGAGAAG
AAACACAGCCCCTGTGCCTGGGAAGTGGTCAGAGCAGAAGTCTGGAGAGCCCTGTCTTCCTCAG
CCAAGTTGCTGGCAAGTCTGAGTGAGGAGAAGGAGTGAGTCTGAGACCCAGTGGAGAGAATCTC
CTGGACTAGGACACTGCACCTCTCTGCCCA

hide sequence

Protein Sequences


Protein RefSeqs	NP_032362	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA58254	(Get FASTA)	NCBI Sequence Viewer
	AAI16863	(Get FASTA)	NCBI Sequence Viewer
	AAI16865	(Get FASTA)	NCBI Sequence Viewer
	CAB0000147	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000071333
	ENSMUSP00000071333.6

RefSeq Acc Id:	NP_032362 ⟸ NM_008336
- Peptide Label:	precursor
- UniProtKB:	L7MTU6 (UniProtKB/TrEMBL), Q61719 (UniProtKB/TrEMBL)
- Sequence:	show sequence MARLSTFLMVLAVMSYWSTCPLGCDLPQTHNLRNKRALTLLVQMRRLSPLSCLKDRKDFGFPQE KVDAQQIQEAQAIPVLTELTQQMLTLFTSKASSAAWNATLLDSFCNDLHQQLNDLKTCLMQEVG VQESPLTQEDSLLAVRKYFHSITVYLREKKHSPCAWEVVRAEVWRALSSSAKLLASLSEEKE hide sequence

RefSeq Acc Id:

ENSMUSP00000071333 ⟸ ENSMUST00000071378

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-L7MTU6-F1-model_v2	AlphaFold	L7MTU6	1-190	view protein structure

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	MGI:1097683	AgrOrtholog
Ensembl Genes	ENSMUSG00000100079	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSMUST00000071378	ENTREZGENE
	ENSMUST00000071378.6	UniProtKB/TrEMBL
Gene3D-CATH	1.20.1250.10	UniProtKB/TrEMBL
InterPro	4_helix_cytokine-like_core	UniProtKB/TrEMBL
	Interferon_alpha/beta/delta	UniProtKB/TrEMBL
KEGG Report	mmu:15974	UniProtKB/TrEMBL
MGD	MGI:1097683	ENTREZGENE
NCBI Gene	15974	ENTREZGENE
PANTHER	ALPHA-INTERFERON-RELATED	UniProtKB/TrEMBL
	Interferon_abd	UniProtKB/TrEMBL
Pfam	Interferon	UniProtKB/TrEMBL
PhenoGen	Ifnab	PhenoGen
PRINTS	INTERFERONAB	UniProtKB/TrEMBL
PROSITE	INTERFERON_A_B_D	UniProtKB/TrEMBL
SMART	IFabd	UniProtKB/TrEMBL
Superfamily-SCOP	4_helix_cytokine	UniProtKB/TrEMBL
UniProt	L7MTU6	ENTREZGENE, UniProtKB/TrEMBL
	Q61719	ENTREZGENE, UniProtKB/TrEMBL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Annotations - KEGG (archival)