Cadm4 (cell adhesion molecule 4) - Rat Genome Database

Name: Cadm4
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Cadm4 (cell adhesion molecule 4) Rattus norvegicus

Analyze

Symbol:

Cadm4

Name:

cell adhesion molecule 4

RGD ID:

1304722

Description:

Predicted to enable enzyme binding activity and vascular endothelial growth factor receptor binding activity. Involved in synaptic membrane adhesion. Is active in synaptic membrane. Orthologous to human CADM4 (cell adhesion molecule 4); INTERACTS WITH 2,3,7,8-Tetrachlorodibenzofuran; acetamide; alpha-Zearalanol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Igsf4c; immunoglobulin superfamily member 4C; immunoglobulin superfamily, member 4C; LOC365216; Necl-4; nectin-like protein 4; Upar; urokinase plasminogen activator receptor

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CADM4 (cell adhesion molecule 4)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):	Cadm4 (cell adhesion molecule 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Cadm4 (cell adhesion molecule 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CADM4 (cell adhesion molecule 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CADM4 (cell adhesion molecule 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Cadm4 (cell adhesion molecule 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CADM4 (cell adhesion molecule 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CADM4 (cell adhesion molecule 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Cadm4 (cell adhesion molecule 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	RNF222 (ring finger protein 222)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	CADM4 (cell adhesion molecule 4)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Cadm4 (cell adhesion molecule 4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cadm4 (cell adhesion molecule 4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	dpr16	Alliance	DIOPT (InParanoid\|SonicParanoid)
Drosophila melanogaster (fruit fly):	dpr19	Alliance	DIOPT (InParanoid\|SonicParanoid)
Drosophila melanogaster (fruit fly):	dpr15	Alliance	DIOPT (InParanoid\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	cadm4	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	89,203,089 - 89,225,345 (+)	NCBI		GRCr8
mRatBN7.2	1	80,075,163 - 80,097,423 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	80,075,202 - 80,097,423 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	85,468,817 - 85,490,110 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	94,018,691 - 94,039,966 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	87,224,638 - 87,245,935 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	81,365,200 - 81,369,841 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	81,365,138 - 81,370,109 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	82,625,741 - 82,630,379 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	79,783,972 - 79,788,613 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	79,768,363 - 79,868,066 (+)	NCBI
Celera	1	74,528,342 - 74,549,564 (+)	NCBI		Celera
Cytogenetic Map	1	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

ethylmalonic encephalopathy (ISO)

schizophrenia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-catechin (ISO)

(1->4)-beta-D-glucan (ISO)

1,1-dichloroethene (ISO)

1,2-dichloroethane (ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

3,4-methylenedioxymethamphetamine (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

acetamide (EXP)

alpha-Zearalanol (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

carbon nanotube (ISO)

chlorpyrifos (ISO)

copper atom (EXP)

copper(0) (EXP)

dichloroacetic acid (ISO)

dorsomorphin (ISO)

entinostat (ISO)

ethanol (ISO)

folic acid (ISO)

FR900359 (ISO)

isoprenaline (ISO)

ivermectin (ISO)

panobinostat (ISO)

pentanal (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

phenobarbital (ISO)

potassium chromate (ISO)

SB 431542 (ISO)

silver atom (ISO)

silver(0) (ISO)

sunitinib (ISO)

temozolomide (ISO)

tert-butyl hydroperoxide (ISO)

tetrachloromethane (EXP)

thioacetamide (EXP)

titanium dioxide (ISO)

trichostatin A (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

homophilic cell adhesion via plasma membrane adhesion molecules (IBA)

negative regulation of peptidyl-threonine phosphorylation (IEA,ISO,ISS)

negative regulation of peptidyl-tyrosine phosphorylation (IBA,IEA,ISO,ISS)

negative regulation of protein phosphorylation (ISO)

negative regulation of vascular endothelial growth factor receptor signaling pathway (IEA,ISO,ISS)

negative regulation of vascular endothelial growth factor signaling pathway (IEA,ISO,ISS)

regulation of cell motility (IEA,ISO,ISS)

regulation of cell population proliferation (IEA,ISO,ISS)

regulation of protein phosphorylation (ISO)

regulation of Rac protein signal transduction (IBA,IEA,ISO,ISS)

regulation of wound healing (IBA,IEA,ISO,ISS)

synaptic membrane adhesion (IDA,IEP,IMP,NAS)

Cellular Component

cell leading edge (IEA,ISO,ISS)

cell-cell contact zone (IBA,IEA,ISO,ISS)

membrane (IEA)

synaptic membrane (IDA,IEP)

Molecular Function

protein phosphatase binding (IEA,ISO)

receptor tyrosine kinase binding (IEA,ISO)

vascular endothelial growth factor receptor 1 binding (IEA,ISO)

vascular endothelial growth factor receptor 2 binding (IBA,IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	SynCAMs organize synapses through heterophilic adhesion.	Fogel AI, etal., J Neurosci. 2007 Nov 14;27(46):12516-30.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:17558405	PMID:17724124	PMID:23376485	PMID:23611113	PMID:25893857	PMID:28119456	PMID:29476059

Genomics

Comparative Map Data

Cadm4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	89,203,089 - 89,225,345 (+)	NCBI		GRCr8
mRatBN7.2	1	80,075,163 - 80,097,423 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	80,075,202 - 80,097,423 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	85,468,817 - 85,490,110 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	94,018,691 - 94,039,966 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	87,224,638 - 87,245,935 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	81,365,200 - 81,369,841 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	81,365,138 - 81,370,109 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	82,625,741 - 82,630,379 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	79,783,972 - 79,788,613 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	79,768,363 - 79,868,066 (+)	NCBI
Celera	1	74,528,342 - 74,549,564 (+)	NCBI		Celera
Cytogenetic Map	1	q21	NCBI

CADM4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	43,622,368 - 43,641,984 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	43,622,368 - 43,639,850 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	44,126,520 - 44,144,002 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	48,818,362 - 48,835,831 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	48,818,361 - 48,835,831	NCBI
Celera	19	40,929,016 - 40,946,485 (-)	NCBI		Celera
Cytogenetic Map	19	q13.31	NCBI
HuRef	19	40,557,289 - 40,562,715 (-)	NCBI		HuRef
CHM1_1	19	44,128,270 - 44,133,697 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	19	46,444,027 - 46,463,643 (-)	NCBI		T2T-CHM13v2.0

Cadm4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	24,181,448 - 24,203,958 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	24,181,448 - 24,203,964 (+)	Ensembl		GRCm39 Ensembl
GRCm38	7	24,482,023 - 24,504,533 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	24,482,023 - 24,504,539 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	25,267,042 - 25,289,552 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	24,190,859 - 24,213,187 (+)	NCBI		MGSCv36	mm8
Celera	7	19,096,111 - 19,118,626 (+)	NCBI		Celera
Cytogenetic Map	7	A3	NCBI
cM Map	7	11.03	NCBI

Cadm4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955555	1,356,143 - 1,368,480 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955555	1,356,143 - 1,361,404 (-)	NCBI	ChiLan1.0	ChiLan1.0

CADM4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	49,781,407 - 49,798,930 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	51,636,125 - 51,668,041 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	40,564,288 - 40,581,830 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1 Ensembl	19	49,172,485 - 49,180,023 (-)	Ensembl	panpan1.1		panPan2

CADM4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	111,507,543 - 111,512,733 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	111,507,543 - 111,513,308 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	110,977,797 - 110,992,457 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	112,108,192 - 112,122,853 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	112,108,175 - 112,122,852 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	111,696,331 - 111,710,988 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	111,330,179 - 111,344,834 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	112,214,399 - 112,229,059 (+)	NCBI		UU_Cfam_GSD_1.0

Cadm4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	16,473,278 - 16,479,855 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936706	820,632 - 825,392 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936706	820,622 - 825,775 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CADM4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	50,462,450 - 50,478,383 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	50,462,439 - 50,478,409 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	46,217,364 - 46,327,475 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CADM4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	37,143,477 - 37,161,524 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	37,140,676 - 37,161,524 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666073	16,684,642 - 16,702,815 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cadm4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624907	1,152,645 - 1,168,589 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624907	1,152,063 - 1,168,587 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Cadm4
58 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	96
Count of miRNA genes:	78
Interacting mature miRNAs:	86
Transcripts:	ENSRNOT00000026793
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1554320	Bmd1	Bone mineral density QTL 1	12.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	509108	86060548	Rat
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	5925874	115540829	Rat
2313062	Bmd73	Bone mineral density QTL 73	3.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	11481312	82174945	Rat
2313065	Bss67	Bone structure and strength QTL 67	3.1	0.0001	tibia area (VT:1000281)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
2313069	Bss68	Bone structure and strength QTL 68	2.9	0.0001	tibia size trait (VT:0100001)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
2313075	Bss66	Bone structure and strength QTL 66	3.4	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	11481312	82174945	Rat
2313077	Bss69	Bone structure and strength QTL 69	3.5	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	11481312	82174945	Rat
2313092	Bmd72	Bone mineral density QTL 72	2.5	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	11481312	82174945	Rat
2313097	Bss70	Bone structure and strength QTL 70	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	22340647	102268831	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	30882023	123479925	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
1300172	Bp172	Blood pressure QTL 172	3.56		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	32737273	90665040	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
2313051	Bss57	Bone structure and strength QTL 57	3.7	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	43284731	118944897	Rat
2313059	Bss55	Bone structure and strength QTL 55	3.2	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
2313072	Bss53	Bone structure and strength QTL 53	4.3	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	43284731	118944897	Rat
2313078	Bss54	Bone structure and strength QTL 54	3.5	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
2313094	Bss58	Bone structure and strength QTL 58	3.7	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	43284731	118944897	Rat
2313098	Bmd70	Bone mineral density QTL 70	3.6	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	43284731	118944897	Rat
2313099	Bss56	Bone structure and strength QTL 56	2.4	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	1	43284731	118944897	Rat
2302059	Pia36	Pristane induced arthritis QTL 36	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	43333002	88333002	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	48963584	144267916	Rat
4889962	Bss94	Bone structure and strength QTL 94	3.8		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	49361465	82174945	Rat
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	49393172	94393172	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	49393172	159356837	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
6903308	Scl36	Serum cholesterol QTL 36	2	0.0125	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	53863041	90532583	Rat
4889919	Bss86	Bone structure and strength QTL 86	4.1		tibia area (VT:1000281)	tibia midshaft total cross-sectional area (CMO:0001715)	1	53895117	82174945	Rat
4889929	Bss87	Bone structure and strength QTL 87	6.7		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	53895117	82174945	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	56732668	98773277	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	56949932	101949932	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	57336763	151090257	Rat
1300121	Hrtrt1	Heart rate QTL 1	3.7		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	65789093	115540829	Rat
7421628	Bp361	Blood pressure QTL 361		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	66023617	118608521	Rat
631512	Scl6	Serum cholesterol level QTL 6	9.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	72197680	90508767	Rat
1358192	Ept13	Estrogen-induced pituitary tumorigenesis QTL 13	3.4		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	77494165	122494165	Rat
10054135	Gmadr2	Adrenal mass QTL 2	1.97	0.0129	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	77857876	122857876	Rat
1549903	Bp267	Blood pressure QTL 267			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	77876254	106047988	Rat
61344	Bp29	Blood pressure QTL 29	7.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	78350581	123350581	Rat
7411712	Strs4	Sensitivity to stroke QTL 4	8.7		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	1	78430536	123430536	Rat
61433	Cia2	Collagen induced arthritis QTL 2	5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	78430754	91209302	Rat
1582234	Gluco18	Glucose level QTL 18	3.4	0.0003	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	78479925	123479925	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium					4				74	12	16
Low	3	38	30	23	11	23	7	9		23	25	11	7
Below cutoff		5	27	18	4	18	1	2					1

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001047107	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ272745	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000026793 ⟹ ENSRNOP00000026793

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	80,075,202 - 80,097,423 (+)	Ensembl
Rnor_6.0 Ensembl	1	81,365,138 - 81,370,109 (+)	Ensembl

RefSeq Acc Id:

NM_001047107 ⟹ NP_001040572

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	89,203,089 - 89,225,345 (+)	NCBI
mRatBN7.2	1	80,075,163 - 80,097,423 (+)	NCBI
Rnor_6.0	1	81,365,200 - 81,369,841 (+)	NCBI
Rnor_5.0	1	82,625,741 - 82,630,379 (+)	NCBI
RGSC_v3.4	1	79,783,972 - 79,788,613 (+)	RGD
Celera	1	74,528,342 - 74,549,564 (+)	RGD

Sequence:

show sequence

ATGGGCCGGGCCCGGCGCTTCCAGTGGCCGCTGCTGCTACTGTGGGCGGCCGCGGCGGGGCCAG
GGACGGCACAGGAAGTGCAGACAGAGAATGTGACGGTGGCCGAGGGTGGGGTGGCTGAGATCAC
CTGCCGTCTGCATCAGTATGATGGGTCTATAGTCGTCATTCAGAACCCAGCCCGGCAGACCCTC
TTTTTCAATGGCACCCGAGCCCTGAAGGACGAACGATTCCAGCTGGAGGAGTTCTCCCCGCGCC
GAGTGCGCATCAGGCTCTCAGACGCCCGCCTGGAGGACGAGGGGGGCTACTTCTGCCAGCTCTA
CACGGAGGACACCCACCACCAGATCGCCACGCTCACTGTCTTAGTGGCTCCGGAGAATCCTGTG
GTGGAGGTCCGAGAGCAAGCAGTGGAGGGCGGCGAGGTGGAACTCAGCTGCCTGGTTCCGCGGT
CGCGCCCCGCAGCGGTCCTGCGCTGGTATCGCGATCGCAAGGAGCTGAAAGGAGTGAGCAGCGG
CCAGGAGAACGGCAAGGTGTGGAGCGTGGCGAGCACTGTGCGGTTCCGCGTGGACCGCAAGGAC
GACGGCGGTATCGTCATCTGTGAAGCGCAGAACCAGGCGCTGCCCTCGGGGCACAGCAAGCAGA
CGCAGTACGTGCTGGATGTGCAGTATTCCCCCACAGCTCGGATCCACGCCTCTCAAGCTGTAGT
CAGGGAGGGAGACACTCTGGTGCTGACATGTGCTGTCACAGGGAACCCCAGGCCAAACCAGATC
CGCTGGAACCGTGGGAATGAGTCTCTGCCAGAGAGGGCGGAGGCGTTGGGCGAGACGCTCACGC
TGCCTGGCCTGGTATCTGCAGATAACGGCACCTACACCTGCGAGGCGGCGAACAAGCACGGCCA
CGCCAGGGCGCTCTACGTGCTTGTGGTCTATGACCCCGGAGCAGTGGTAGAGGCTCAGACATCG
GTTCCCTACGCCATCGTGGGCGGCATCCTGGCGCTACTGGTGTTTCTGATCATATGCGTGCTAG
TAGGCATGGTGTGGTGCTCTGTCCGACAGAAGGGCTCCTATCTGACCCATGAGGCCAGTGGCTT
GGATGAGCAGGGAGAAGCCAGAGAAGCCTTCCTCAACGGCAGTGATGGACACAAGCGGAAAGAA
GAATTCTTCATTTGA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001040572	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	ABB85364	(Get FASTA)	NCBI Sequence Viewer
	EDM08091	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000026793
	ENSRNOP00000026793.6
	ENSRNOP00055046191
	ENSRNOP00060047333
	ENSRNOP00065047688
GenBank Protein	Q1WIM1	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001040572 ⟸ NM_001047107
- Peptide Label:	precursor
- UniProtKB:	Q1WIM1 (UniProtKB/Swiss-Prot), A6J8Z3 (UniProtKB/TrEMBL), F1M7V6 (UniProtKB/TrEMBL)
- Sequence:	show sequence MGRARRFQWPLLLLWAAAAGPGTAQEVQTENVTVAEGGVAEITCRLHQYDGSIVVIQNPARQTL FFNGTRALKDERFQLEEFSPRRVRIRLSDARLEDEGGYFCQLYTEDTHHQIATLTVLVAPENPV VEVREQAVEGGEVELSCLVPRSRPAAVLRWYRDRKELKGVSSGQENGKVWSVASTVRFRVDRKD DGGIVICEAQNQALPSGHSKQTQYVLDVQYSPTARIHASQAVVREGDTLVLTCAVTGNPRPNQI RWNRGNESLPERAEALGETLTLPGLVSADNGTYTCEAANKHGHARALYVLVVYDPGAVVEAQTS VPYAIVGGILALLVFLIICVLVGMVWCSVRQKGSYLTHEASGLDEQGEAREAFLNGSDGHKRKE EFFI hide sequence

RefSeq Acc Id:

ENSRNOP00000026793 ⟸ ENSRNOT00000026793

Protein Domains

Ig-like Ig-like C2-type Ig-like V-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q1WIM1-F1-model_v2	AlphaFold	Q1WIM1	1-388	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1304722	AgrOrtholog
BioCyc Gene	G2FUF-60443	BioCyc
Ensembl Genes	ENSRNOG00000024243	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSRNOG00055032445	UniProtKB/Swiss-Prot
	ENSRNOG00060032999	UniProtKB/Swiss-Prot
	ENSRNOG00065033704	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000026793	ENTREZGENE, UniProtKB/TrEMBL
	ENSRNOT00000026793.7	UniProtKB/Swiss-Prot
	ENSRNOT00055056035	UniProtKB/Swiss-Prot
	ENSRNOT00060057254	UniProtKB/Swiss-Prot
	ENSRNOT00065057904	UniProtKB/Swiss-Prot
Gene3D-CATH	2.60.40.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	CD80_C2-set	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ig-like_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ig-like_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ig-like_fold	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ig_sub	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ig_sub2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ig_V-set	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Neurexin-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:365216	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	365216	ENTREZGENE
PANTHER	IG-LIKE DOMAIN-CONTAINING PROTEIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR45889:SF3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	C2-set_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ig_3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	V-set	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Cadm4	PhenoGen
PROSITE	IG_LIKE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000024243	RatGTEx
	ENSRNOG00055032445	RatGTEx
	ENSRNOG00060032999	RatGTEx
	ENSRNOG00065033704	RatGTEx
SMART	4.1m	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	IGc2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SM00409	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF48726	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A6J8Z3	ENTREZGENE, UniProtKB/TrEMBL
	CADM4_RAT	UniProtKB/Swiss-Prot
	F1M7V6	ENTREZGENE, UniProtKB/TrEMBL
	Q1WIM1	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-04	Cadm4	cell adhesion molecule 4	Igsf4c_predicted	immunoglobulin superfamily, member 4C (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-12	Igsf4c_predicted	immunoglobulin superfamily, member 4C (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar