Symbol:
Dpp7
Name:
dipeptidylpeptidase 7
RGD ID:
71073
Description:
Enables dipeptidyl-peptidase activity. Involved in protein catabolic process. Predicted to be located in Golgi apparatus and lysosome. Predicted to be active in vesicle. Orthologous to human DPP7 (dipeptidyl peptidase 7); INTERACTS WITH 1-naphthyl isothiocyanate; 2,3,7,8-tetrachlorodibenzodioxine; 2,5-hexanedione.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
dipeptidyl aminopeptidase II; dipeptidyl peptidase 2; dipeptidyl peptidase 7; dipeptidyl peptidase II; dipeptidyl-peptidase 2; dipeptidyl-peptidase II; DPP II; Dpp2; quiescent cell proline dipeptidase
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
DPP7 (dipeptidyl peptidase 7) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Dpp7 (dipeptidylpeptidase 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Dpp7 (dipeptidyl peptidase 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
DPP7 (dipeptidyl peptidase 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
DPP7 (dipeptidyl peptidase 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Dpp7 (dipeptidyl peptidase 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
DPP7 (dipeptidyl peptidase 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
DPP7 (dipeptidyl peptidase 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Dpp7 (dipeptidyl peptidase 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
DPP7 (dipeptidyl peptidase 7)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Dpp7 (dipeptidylpeptidase 7)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
dpp7 (dipeptidyl-peptidase 7)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 28,563,240 - 28,567,492 (-) NCBI GRCr8 mRatBN7.2 3 8,165,091 - 8,169,343 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 8,165,091 - 8,169,355 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 11,270,225 - 11,274,475 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 19,856,455 - 19,860,705 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 18,046,298 - 18,050,548 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 2,569,135 - 2,573,387 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 2,569,135 - 2,573,387 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 2,550,548 - 2,554,800 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 3,514,968 - 3,519,220 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 3,514,967 - 3,519,220 (-) NCBI Celera 3 2,991,272 - 2,995,524 (-) NCBI Celera Cytogenetic Map 3 p13 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Dpp7 Rat (1->4)-beta-D-glucan multiple interactions ISO Dpp7 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of DPP7 mRNA CTD PMID:36331819 Dpp7 Rat 1,2-dimethylhydrazine multiple interactions ISO Dpp7 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of DPP7 mRNA CTD PMID:22206623 Dpp7 Rat 1,2-dimethylhydrazine increases expression ISO Dpp7 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of DPP7 mRNA CTD PMID:22206623 Dpp7 Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of DPP7 mRNA CTD PMID:25380136 Dpp7 Rat 17beta-estradiol increases expression ISO DPP7 (Homo sapiens) 6480464 Estradiol results in increased expression of DPP7 mRNA CTD PMID:18556351 Dpp7 Rat 17beta-estradiol multiple interactions ISO Dpp7 (Mus musculus) 6480464 [Estradiol co-treated with Progesterone] results in increased expression of DPP7 mRNA CTD PMID:18556351 Dpp7 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of DPP7 mRNA CTD PMID:21215274 and PMID:32109520 Dpp7 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of DPP7 mRNA CTD PMID:34747641 Dpp7 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Dpp7 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of DPP7 mRNA CTD PMID:21570461 Dpp7 Rat 2,5-hexanedione multiple interactions EXP 6480464 [carbendazim co-treated with 2 and 5-hexanedione] results in decreased expression of DPP7 mRNA CTD PMID:22382377 Dpp7 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of DPP7 mRNA CTD PMID:28522335 Dpp7 Rat 4,4'-diaminodiphenylmethane increases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of DPP7 mRNA CTD PMID:25380136 Dpp7 Rat 4,4'-sulfonyldiphenol decreases expression ISO Dpp7 (Mus musculus) 6480464 bisphenol S results in decreased expression of DPP7 mRNA CTD PMID:39298647 Dpp7 Rat 4,4'-sulfonyldiphenol increases expression ISO DPP7 (Homo sapiens) 6480464 bisphenol S results in increased expression of DPP7 protein CTD PMID:34186270 Dpp7 Rat 4-hydroxyphenyl retinamide decreases expression ISO Dpp7 (Mus musculus) 6480464 Fenretinide results in decreased expression of DPP7 mRNA CTD PMID:28973697 Dpp7 Rat 4-nitroaniline multiple interactions ISO DPP7 (Homo sapiens) 6480464 [DPP7 protein results in increased cleavage of Dipeptides] which results in increased abundance of 4-nitroaniline more ... CTD PMID:16725115 Dpp7 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of DPP7 mRNA CTD PMID:31881176 Dpp7 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of DPP7 mRNA CTD PMID:16483693 Dpp7 Rat Aroclor 1254 increases expression ISO Dpp7 (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in increased expression of DPP7 mRNA CTD PMID:25270620 Dpp7 Rat arsane increases expression EXP 6480464 Arsenic results in increased expression of DPP7 mRNA CTD PMID:18315880 Dpp7 Rat arsane multiple interactions ISO DPP7 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in increased expression of DPP7 mRNA CTD PMID:32525701 Dpp7 Rat arsenic atom increases expression EXP 6480464 Arsenic results in increased expression of DPP7 mRNA CTD PMID:18315880 Dpp7 Rat arsenic atom multiple interactions ISO DPP7 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in increased expression of DPP7 mRNA CTD PMID:32525701 Dpp7 Rat arsenite(3-) increases expression ISO Dpp7 (Mus musculus) 6480464 arsenite results in increased expression of DPP7 mRNA CTD PMID:18929588 Dpp7 Rat benzo[a]pyrene increases expression ISO Dpp7 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of DPP7 mRNA CTD PMID:22228805 Dpp7 Rat benzo[a]pyrene increases expression ISO DPP7 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of DPP7 protein CTD PMID:32717239 Dpp7 Rat beta-naphthoflavone multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of DPP7 mRNA CTD PMID:18164116 Dpp7 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of DPP7 mRNA CTD PMID:25181051 Dpp7 Rat bisphenol A increases expression ISO Dpp7 (Mus musculus) 6480464 bisphenol A results in increased expression of DPP7 mRNA CTD PMID:33221593 more ... Dpp7 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of DPP7 mRNA CTD PMID:34947998 Dpp7 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of DPP7 gene CTD PMID:28505145 Dpp7 Rat bisphenol AF increases expression ISO DPP7 (Homo sapiens) 6480464 bisphenol AF results in increased expression of DPP7 protein CTD PMID:34186270 Dpp7 Rat Bisphenol B increases expression ISO DPP7 (Homo sapiens) 6480464 bisphenol B results in increased expression of DPP7 protein CTD PMID:34186270 Dpp7 Rat bisphenol F increases expression ISO DPP7 (Homo sapiens) 6480464 bisphenol F results in increased expression of DPP7 protein CTD PMID:34186270 Dpp7 Rat carbendazim multiple interactions EXP 6480464 [carbendazim co-treated with 2 and 5-hexanedione] results in decreased expression of DPP7 mRNA CTD PMID:22382377 Dpp7 Rat carbon nanotube affects expression ISO Dpp7 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Dpp7 Rat cisplatin multiple interactions ISO DPP7 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of DPP7 mRNA CTD PMID:27392435 Dpp7 Rat copper atom increases expression EXP 6480464 Copper results in increased expression of DPP7 mRNA CTD PMID:30556269 Dpp7 Rat copper(0) increases expression EXP 6480464 Copper results in increased expression of DPP7 mRNA CTD PMID:30556269 Dpp7 Rat copper(II) sulfate decreases expression ISO DPP7 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of DPP7 mRNA CTD PMID:19549813 Dpp7 Rat cyclosporin A decreases expression ISO Dpp7 (Mus musculus) 6480464 Cyclosporine results in decreased expression of DPP7 mRNA CTD PMID:19770486 Dpp7 Rat diazinon increases methylation ISO DPP7 (Homo sapiens) 6480464 Diazinon results in increased methylation of DPP7 gene CTD PMID:22964155 Dpp7 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of DPP7 mRNA CTD PMID:21266533 Dpp7 Rat dichloroacetic acid decreases expression ISO Dpp7 (Mus musculus) 6480464 Dichloroacetic Acid results in decreased expression of DPP7 mRNA CTD PMID:28962523 Dpp7 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of DPP7 mRNA CTD PMID:29391264 Dpp7 Rat epoxiconazole decreases expression ISO Dpp7 (Mus musculus) 6480464 epoxiconazole results in decreased expression of DPP7 mRNA CTD PMID:35436446 Dpp7 Rat ethyl methanesulfonate decreases expression ISO DPP7 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in decreased expression of DPP7 mRNA CTD PMID:23649840 Dpp7 Rat etoposide multiple interactions ISO DPP7 (Homo sapiens) 6480464 Etoposide promotes the reaction [[DPP7 protein results in increased cleavage of Dipeptides] which results in increased abundance of 4-nitroaniline] CTD PMID:16725115 Dpp7 Rat folic acid multiple interactions ISO Dpp7 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of DPP7 mRNA CTD PMID:22206623 Dpp7 Rat formaldehyde decreases expression ISO DPP7 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of DPP7 mRNA CTD PMID:23649840 Dpp7 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of DPP7 mRNA CTD PMID:22061828 and PMID:33387578 Dpp7 Rat hydroquinone O-beta-D-glucopyranoside decreases expression ISO DPP7 (Homo sapiens) 6480464 Arbutin results in decreased expression of DPP7 mRNA CTD PMID:17103032 Dpp7 Rat inulin multiple interactions ISO Dpp7 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of DPP7 mRNA CTD PMID:36331819 Dpp7 Rat iron dichloride decreases expression ISO DPP7 (Homo sapiens) 6480464 ferrous chloride results in decreased expression of DPP7 mRNA CTD PMID:35984750 Dpp7 Rat isoprenaline increases expression ISO Dpp7 (Mus musculus) 6480464 Isoproterenol results in increased expression of DPP7 mRNA CTD PMID:20003209 Dpp7 Rat lead(0) affects expression ISO DPP7 (Homo sapiens) 6480464 Lead affects the expression of DPP7 mRNA CTD PMID:28903495 Dpp7 Rat methyl methanesulfonate decreases expression ISO DPP7 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of DPP7 mRNA CTD PMID:23649840 Dpp7 Rat methylmercury chloride decreases expression ISO DPP7 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of DPP7 mRNA CTD PMID:28001369 Dpp7 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions ISO DPP7 (Homo sapiens) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde promotes the reaction [[DPP7 protein results in increased cleavage of Dipeptides] which results in increased abundance of 4-nitroaniline] CTD PMID:16725115 Dpp7 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of DPP7 mRNA CTD PMID:18164116 Dpp7 Rat N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of DPP7 mRNA CTD PMID:19638242 Dpp7 Rat N-nitrosodimethylamine increases expression EXP 6480464 Dimethylnitrosamine results in increased expression of DPP7 mRNA CTD PMID:25380136 Dpp7 Rat nickel dichloride affects expression EXP 6480464 nickel chloride affects the expression of DPP7 mRNA CTD PMID:22110744 Dpp7 Rat nickel sulfate decreases expression ISO DPP7 (Homo sapiens) 6480464 nickel sulfate results in decreased expression of DPP7 mRNA CTD PMID:22714537 Dpp7 Rat nigericin multiple interactions ISO DPP7 (Homo sapiens) 6480464 Nigericin promotes the reaction [[DPP7 protein results in increased cleavage of Dipeptides] which results in increased abundance of 4-nitroaniline] CTD PMID:16725115 Dpp7 Rat ozone multiple interactions ISO DPP7 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of DPP7 mRNA CTD PMID:35430440 Dpp7 Rat perfluorohexanesulfonic acid increases expression ISO Dpp7 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of DPP7 mRNA CTD PMID:37995155 Dpp7 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Dpp7 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of DPP7 mRNA more ... CTD PMID:36331819 Dpp7 Rat pirinixic acid multiple interactions ISO Dpp7 (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of DPP7 mRNA CTD PMID:19710929 Dpp7 Rat pirinixic acid increases expression ISO Dpp7 (Mus musculus) 6480464 pirinixic acid results in increased expression of DPP7 mRNA CTD PMID:18301758 Dpp7 Rat progesterone multiple interactions ISO Dpp7 (Mus musculus) 6480464 [Estradiol co-treated with Progesterone] results in increased expression of DPP7 mRNA CTD PMID:18556351 Dpp7 Rat resveratrol increases expression EXP 6480464 resveratrol results in increased expression of DPP7 mRNA CTD PMID:25905778 Dpp7 Rat rotenone increases expression ISO Dpp7 (Mus musculus) 6480464 Rotenone results in increased expression of DPP7 mRNA CTD PMID:23186747 Dpp7 Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of DPP7 protein CTD PMID:35544339 Dpp7 Rat silicon dioxide increases expression ISO Dpp7 (Mus musculus) 6480464 Silicon Dioxide results in increased expression of DPP7 mRNA CTD PMID:29203145 Dpp7 Rat sodium arsenate multiple interactions ISO DPP7 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in increased expression of DPP7 mRNA CTD PMID:32525701 Dpp7 Rat sodium arsenite decreases expression ISO DPP7 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of DPP7 mRNA CTD PMID:22714537 Dpp7 Rat sodium arsenite decreases expression ISO Dpp7 (Mus musculus) 6480464 sodium arsenite results in decreased expression of DPP7 mRNA CTD PMID:37682722 Dpp7 Rat Soman increases expression EXP 6480464 Soman results in increased expression of DPP7 mRNA CTD PMID:19281266 Dpp7 Rat sunitinib increases expression ISO DPP7 (Homo sapiens) 6480464 Sunitinib results in increased expression of DPP7 mRNA CTD PMID:31533062 Dpp7 Rat temozolomide decreases expression ISO DPP7 (Homo sapiens) 6480464 Temozolomide results in decreased expression of DPP7 mRNA CTD PMID:31758290 Dpp7 Rat tetrachloromethane decreases expression ISO Dpp7 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of DPP7 mRNA CTD PMID:31919559 Dpp7 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of DPP7 mRNA CTD PMID:23411599 and PMID:34492290 Dpp7 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of DPP7 mRNA CTD PMID:33387578 Dpp7 Rat triclosan decreases expression ISO DPP7 (Homo sapiens) 6480464 Triclosan results in decreased expression of DPP7 mRNA CTD PMID:30510588 Dpp7 Rat valproic acid increases methylation ISO DPP7 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of DPP7 gene CTD PMID:29154799 Dpp7 Rat valproic acid affects expression ISO Dpp7 (Mus musculus) 6480464 Valproic Acid affects the expression of DPP7 mRNA CTD PMID:17292431 Dpp7 Rat valproic acid decreases expression ISO DPP7 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of DPP7 mRNA CTD PMID:24383497 and PMID:29154799
(1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (EXP) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,5-hexanedione (EXP) 3-chloropropane-1,2-diol (EXP) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 4-nitroaniline (ISO) acetamide (EXP) ammonium chloride (EXP) Aroclor 1254 (ISO) arsane (EXP,ISO) arsenic atom (EXP,ISO) arsenite(3-) (ISO) benzo[a]pyrene (ISO) beta-naphthoflavone (EXP) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) carbendazim (EXP) carbon nanotube (ISO) cisplatin (ISO) copper atom (EXP) copper(0) (EXP) copper(II) sulfate (ISO) cyclosporin A (ISO) diazinon (ISO) dibutyl phthalate (EXP) dichloroacetic acid (ISO) endosulfan (EXP) epoxiconazole (ISO) ethyl methanesulfonate (ISO) etoposide (ISO) folic acid (ISO) formaldehyde (ISO) gentamycin (EXP) hydroquinone O-beta-D-glucopyranoside (ISO) inulin (ISO) iron dichloride (ISO) isoprenaline (ISO) lead(0) (ISO) methyl methanesulfonate (ISO) methylmercury chloride (ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) N-nitrosodiethylamine (EXP) N-nitrosodimethylamine (EXP) nickel dichloride (EXP) nickel sulfate (ISO) nigericin (ISO) ozone (ISO) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) pirinixic acid (ISO) progesterone (ISO) resveratrol (EXP) rotenone (EXP,ISO) silicon dioxide (ISO) sodium arsenate (ISO) sodium arsenite (ISO) Soman (EXP) sunitinib (ISO) temozolomide (ISO) tetrachloromethane (ISO) thioacetamide (EXP) trichloroethene (EXP) triclosan (ISO) valproic acid (ISO)
1.
Purification, molecular cloning, and immunohistochemical localization of dipeptidyl peptidase II from the rat kidney and its identity with quiescent cell proline dipeptidase.
Araki H, etal., J Biochem (Tokyo) 2001 Feb;129(2):279-88.
2.
Cloning and functional expression of rat kidney dipeptidyl peptidase II.
Fukasawa KM, etal., Biochem J 2001 Jan 15;353(Pt 2):283-90.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
5.
Gene Data Set
MGD Curation, June 12, 2002
6.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
7.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.
GOA pipeline
RGD automated data pipeline
9.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
10.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
Dpp7 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 28,563,240 - 28,567,492 (-) NCBI GRCr8 mRatBN7.2 3 8,165,091 - 8,169,343 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 8,165,091 - 8,169,355 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 11,270,225 - 11,274,475 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 19,856,455 - 19,860,705 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 18,046,298 - 18,050,548 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 2,569,135 - 2,573,387 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 2,569,135 - 2,573,387 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 2,550,548 - 2,554,800 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 3,514,968 - 3,519,220 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 3,514,967 - 3,519,220 (-) NCBI Celera 3 2,991,272 - 2,995,524 (-) NCBI Celera Cytogenetic Map 3 p13 NCBI
DPP7 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 9 137,110,546 - 137,118,306 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 9 137,110,542 - 137,118,309 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 9 140,004,998 - 140,009,185 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 9 139,124,813 - 139,129,016 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 9 137,280,936 - 137,285,002 NCBI Celera 9 110,519,219 - 110,522,731 (-) NCBI Celera Cytogenetic Map 9 q34.3 NCBI HuRef 9 109,466,325 - 109,469,873 (-) NCBI HuRef CHM1_1 9 140,153,770 - 140,157,892 (-) NCBI CHM1_1 T2T-CHM13v2.0 9 149,348,484 - 149,356,230 (-) NCBI T2T-CHM13v2.0
Dpp7 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 25,242,302 - 25,246,365 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 25,242,288 - 25,246,371 (-) Ensembl GRCm39 Ensembl GRCm38 2 25,352,290 - 25,356,389 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 25,352,276 - 25,356,359 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 25,207,810 - 25,211,852 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 25,174,299 - 25,178,341 (-) NCBI MGSCv36 mm8 Celera 2 25,079,828 - 25,083,870 (-) NCBI Celera Cytogenetic Map 2 A3 NCBI cM Map 2 17.19 NCBI
Dpp7 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955513 5,106,430 - 5,109,483 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955513 5,105,833 - 5,109,676 (+) NCBI ChiLan1.0 ChiLan1.0
DPP7 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 11 2,269,365 - 2,288,713 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 9 1,210,294 - 2,291,046 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 9 108,170,361 - 108,189,498 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 9 137,140,493 - 137,143,599 (-) NCBI panpan1.1 PanPan1.1 panPan2
DPP7 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 9 48,554,062 - 48,557,752 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 9 48,554,077 - 48,557,746 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 9 47,739,358 - 47,743,048 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 9 49,414,287 - 49,417,976 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 9 49,414,287 - 49,417,961 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 9 48,190,576 - 48,194,266 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 9 48,489,346 - 48,493,035 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 9 48,536,605 - 48,540,294 (-) NCBI UU_Cfam_GSD_1.0
Dpp7
DPP7 No map positions available.
DPP7 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 12 1,062,639 - 1,079,143 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 12 1,074,811 - 1,079,550 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666058 4,224,922 - 4,229,393 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Dpp7
.
Predicted Target Of
Count of predictions: 44 Count of miRNA genes: 40 Interacting mature miRNAs: 44 Transcripts: ENSRNOT00000017271 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
631545 Bp85 Blood pressure QTL 85 3.1 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 1 33278763 Rat 4889966 Bss95 Bone structure and strength QTL 95 4.4 tibia area (VT:1000281) tibia-fibula cross-sectional area (CMO:0001718) 3 1 36847613 Rat 2292615 Ept17 Estrogen-induced pituitary tumorigenesis QTL 17 6.7 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 3 6537645 10778823 Rat 631679 Cm10 Cardiac mass QTL 10 7.34 0.0001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 1 31158234 Rat 2290452 Scl56 Serum cholesterol level QTL 56 2.26 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 3 1 91609953 Rat 631568 Bp92 Blood pressure QTL 92 2.2 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 1 39874793 Rat 70202 Alc19 Alcohol consumption QTL 19 2.5 drinking behavior trait (VT:0001422) ethanol intake volume to total fluid intake volume ratio (CMO:0001591) 3 1 27494778 Rat 2312664 Scl62 Serum cholesterol level QTL 62 0.05 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 3 1 38710544 Rat 61468 Bp15 Blood pressure QTL 15 4.4 blood pressure trait (VT:0000183) pulse pressure (CMO:0000292) 3 1 33278763 Rat 1358185 Ept6 Estrogen-induced pituitary tumorigenesis QTL 6 6.7 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 3 6537645 10778823 Rat 631831 Alc8 Alcohol consumption QTL 8 2.7 consumption behavior trait (VT:0002069) calculated ethanol drink intake rate (CMO:0001615) 3 1 33230976 Rat
RH130913
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 8,165,104 - 8,165,307 (+) MAPPER mRatBN7.2 Rnor_6.0 3 2,569,149 - 2,569,351 NCBI Rnor6.0 Rnor_5.0 3 2,550,562 - 2,550,764 UniSTS Rnor5.0 RGSC_v3.4 3 3,514,982 - 3,515,184 UniSTS RGSC3.4 Celera 3 2,991,286 - 2,991,488 UniSTS Cytogenetic Map 3 p13 UniSTS
RH131536
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 8,164,634 - 8,164,825 (+) MAPPER mRatBN7.2 Rnor_6.0 3 2,568,679 - 2,568,869 NCBI Rnor6.0 Rnor_5.0 3 2,550,092 - 2,550,282 UniSTS Rnor5.0 RGSC_v3.4 3 3,514,512 - 3,514,702 UniSTS RGSC3.4 Celera 3 2,990,816 - 2,991,006 UniSTS Cytogenetic Map 3 p13 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000017271 ⟹ ENSRNOP00000017271
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 8,165,091 - 8,169,355 (-) Ensembl Rnor_6.0 Ensembl 3 2,569,135 - 2,573,387 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000115633 ⟹ ENSRNOP00000095189
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 8,165,091 - 8,169,355 (-) Ensembl
RefSeq Acc Id:
NM_031973 ⟹ NP_114179
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 28,563,240 - 28,567,492 (-) NCBI mRatBN7.2 3 8,165,091 - 8,169,343 (-) NCBI Rnor_6.0 3 2,569,135 - 2,573,387 (-) NCBI Rnor_5.0 3 2,550,548 - 2,554,800 (-) NCBI RGSC_v3.4 3 3,514,968 - 3,519,220 (-) RGD Celera 3 2,991,272 - 2,995,524 (-) RGD
Sequence:
CATGACTGCCAGCGGCCCGCTCAGAATCAGGCATGGGTCTCCATCCTTGTTCTCCTGTGGACCATGGGGTCCCCTCCTGGGTCCTGGTCTTGTTGCTGACACTGGGTCTGTGCAGCCTGCAGGCTACA
hide sequence
RefSeq Acc Id:
NP_114179 ⟸ NM_031973
- Peptide Label:
precursor
- UniProtKB:
Q9EPB1 (UniProtKB/Swiss-Prot), A6JT47 (UniProtKB/TrEMBL), A0A8I6AJ69 (UniProtKB/TrEMBL)
- Sequence:
MGLHPCSPVDHGVPSWVLVLLLTLGLCSLQATADSVLDPDFRENYFEQYMDHFNFESFSNKTFGQRFLVSDKFWKMGEGPIFFYTGNEGDIWSLANNSGFIVELAAQQEALLVFAEHRYYGKSLPFGV
hide sequence
Ensembl Acc Id:
ENSRNOP00000017271 ⟸ ENSRNOT00000017271
Ensembl Acc Id:
ENSRNOP00000095189 ⟸ ENSRNOT00000115633
RGD ID: 13691872 Promoter ID: EPDNEW_R2397 Type: multiple initiation site Name: Dpp7_1 Description: dipeptidylpeptidase 7 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 3 2,573,380 - 2,573,440 EPDNEW
BioCyc Gene G2FUF-50460 BioCyc
Ensembl Genes ENSRNOG00000012640 Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Transcript ENSRNOT00000017271 ENTREZGENE
ENSRNOT00000017271.4 UniProtKB/Swiss-Prot
ENSRNOT00000115633.1 UniProtKB/TrEMBL
Gene3D-CATH 1.20.120.980 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
3.40.50.1820 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE IMAGE:7110490 IMAGE-MGC_LOAD
InterPro AB_hydrolase UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Peptidase_S28 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ser_carbopepase_S28_SKS UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report rno:83799 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE MGC:93328 IMAGE-MGC_LOAD
NCBI Gene 83799 ENTREZGENE
PANTHER DIPEPTIDYL PEPTIDASE 2 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROTEASE S28 PRO-X CARBOXYPEPTIDASE-RELATED UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam Peptidase_S28 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen Dpp7 PhenoGen
RatGTEx ENSRNOG00000012640 RatGTEx
Superfamily-SCOP SSF53474 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt A0A8I6AJ69 ENTREZGENE, UniProtKB/TrEMBL
A6JT47 ENTREZGENE, UniProtKB/TrEMBL
A6JT48_RAT UniProtKB/TrEMBL
DPP2_RAT UniProtKB/Swiss-Prot, ENTREZGENE
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-07-09
Dpp7
dipeptidylpeptidase 7
Symbol and Name updated to reflect Human and Mouse nomenclature
70877 APPROVED
Note Type
Note
Reference
gene_protein
500 amino acids; mature enzyme contains 464 residues with predicted molecular weight of 51 kDa
70613
