Symbol:
Neto1
Name:
neuropilin and tolloid like 1
RGD ID:
1566269
Description:
Predicted to enable ionotropic glutamate receptor binding activity. Predicted to be involved in learning or memory; modulation of chemical synaptic transmission; and protein localization to synapse. Predicted to act upstream of or within receptor localization to synapse. Predicted to be located in excitatory synapse. Predicted to be active in Schaffer collateral - CA1 synapse; glutamatergic synapse; and postsynaptic density membrane. Orthologous to human NETO1 (neuropilin and tolloid like 1); INTERACTS WITH 1,2-dimethylhydrazine; 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC307206; neuropilin (NRP) and tolloid (TLL)-like 1; neuropilin and tolloid-like protein 1; RGD1566269; similar to Neuropilin- and tolloid-like protein 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 18 81,905,455 - 82,028,730 (+) NCBI GRCr8 mRatBN7.2 18 79,635,633 - 79,753,913 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 18 79,635,633 - 79,749,030 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 18 81,744,847 - 81,859,798 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 18 82,416,897 - 82,531,858 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 18 80,252,532 - 80,367,485 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 18 83,471,342 - 83,585,043 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 18 83,471,342 - 83,584,357 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 18 82,532,693 - 82,646,402 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 18 82,888,369 - 83,107,662 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 18 78,220,855 - 78,334,439 (+) NCBI Celera Cytogenetic Map 18 q12.3 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Neto1 Rat 1,1,1-trichloroethane decreases expression ISO Neto1 (Mus musculus) 6480464 1 more ... CTD PMID:25270620 Neto1 Rat 1,2-dimethylhydrazine decreases expression EXP 6480464 1 and 2-Dimethylhydrazine results in decreased expression of NETO1 mRNA CTD PMID:27840820 Neto1 Rat 17beta-estradiol affects expression ISO NETO1 (Homo sapiens) 6480464 Estradiol affects the expression of NETO1 mRNA CTD PMID:22574217 Neto1 Rat 17beta-estradiol multiple interactions ISO NETO1 (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in increased expression of NETO1 mRNA CTD PMID:30165855 Neto1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Neto1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of NETO1 mRNA CTD PMID:24680724 Neto1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of NETO1 mRNA CTD PMID:32109520 Neto1 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Neto1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether increases expression ISO NETO1 (Homo sapiens) 6480464 2 more ... CTD PMID:26705709 Neto1 Rat 2-palmitoylglycerol increases expression ISO NETO1 (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of NETO1 mRNA CTD PMID:37199045 Neto1 Rat 4,4'-sulfonyldiphenol increases expression ISO Neto1 (Mus musculus) 6480464 bisphenol S results in increased expression of NETO1 mRNA CTD PMID:30951980 and PMID:39298647 Neto1 Rat 5-aza-2'-deoxycytidine increases expression ISO NETO1 (Homo sapiens) 6480464 Decitabine results in increased expression of NETO1 mRNA CTD PMID:21856257 Neto1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of NETO1 mRNA CTD PMID:24780913 Neto1 Rat aflatoxin B1 decreases methylation ISO NETO1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of NETO1 gene and Aflatoxin B1 results in decreased methylation of NETO1 intron CTD PMID:27153756 and PMID:30157460 Neto1 Rat Aflatoxin B2 alpha increases methylation ISO NETO1 (Homo sapiens) 6480464 aflatoxin B2 results in increased methylation of NETO1 intron CTD PMID:30157460 Neto1 Rat all-trans-retinoic acid increases expression ISO NETO1 (Homo sapiens) 6480464 Tretinoin results in increased expression of NETO1 mRNA CTD PMID:21934132 Neto1 Rat arsane multiple interactions ISO NETO1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of NETO1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of NETO1 mRNA CTD PMID:39836092 Neto1 Rat arsenic atom multiple interactions ISO NETO1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of NETO1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of NETO1 mRNA CTD PMID:39836092 Neto1 Rat arsenite(3-) increases methylation ISO NETO1 (Homo sapiens) 6480464 arsenite results in increased methylation of NETO1 promoter CTD PMID:23974009 Neto1 Rat benzo[a]pyrene affects methylation ISO NETO1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of NETO1 intron CTD PMID:30157460 Neto1 Rat benzo[a]pyrene increases methylation ISO NETO1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of NETO1 promoter CTD PMID:27901495 Neto1 Rat benzo[e]pyrene affects methylation ISO NETO1 (Homo sapiens) 6480464 benzo(e)pyrene affects the methylation of NETO1 intron CTD PMID:30157460 Neto1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of NETO1 mRNA CTD PMID:25181051 more ... Neto1 Rat bisphenol A multiple interactions ISO NETO1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of NETO1 gene CTD PMID:31601247 Neto1 Rat bisphenol A increases expression ISO Neto1 (Mus musculus) 6480464 bisphenol A results in increased expression of NETO1 mRNA CTD PMID:35598803 Neto1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of NETO1 mRNA CTD PMID:34947998 Neto1 Rat calcitriol decreases expression ISO NETO1 (Homo sapiens) 6480464 Calcitriol results in decreased expression of NETO1 mRNA CTD PMID:21592394 Neto1 Rat calcitriol multiple interactions ISO NETO1 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of NETO1 mRNA CTD PMID:21592394 Neto1 Rat choline multiple interactions ISO Neto1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of NETO1 mRNA CTD PMID:20938992 Neto1 Rat copper(II) sulfate decreases expression ISO NETO1 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of NETO1 mRNA CTD PMID:19549813 Neto1 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of NETO1 mRNA CTD PMID:26577399 Neto1 Rat diethylstilbestrol decreases expression EXP 6480464 Diethylstilbestrol results in decreased expression of NETO1 mRNA CTD PMID:37077353 Neto1 Rat dorsomorphin multiple interactions ISO NETO1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Neto1 Rat ethanol affects splicing ISO Neto1 (Mus musculus) 6480464 Ethanol affects the splicing of NETO1 mRNA CTD PMID:30319688 Neto1 Rat fenamidone decreases expression ISO Neto1 (Mus musculus) 6480464 fenamidone results in decreased expression of NETO1 mRNA CTD PMID:27029645 Neto1 Rat folic acid multiple interactions ISO Neto1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of NETO1 mRNA CTD PMID:20938992 Neto1 Rat fonofos increases methylation ISO NETO1 (Homo sapiens) 6480464 Fonofos results in increased methylation of NETO1 promoter CTD PMID:22847954 Neto1 Rat formaldehyde increases expression ISO NETO1 (Homo sapiens) 6480464 Formaldehyde results in increased expression of NETO1 mRNA CTD PMID:27905399 Neto1 Rat fulvestrant multiple interactions ISO NETO1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of NETO1 gene CTD PMID:31601247 Neto1 Rat ketoconazole decreases expression EXP 6480464 Ketoconazole results in decreased expression of NETO1 mRNA CTD PMID:37077353 Neto1 Rat L-methionine multiple interactions ISO Neto1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of NETO1 mRNA CTD PMID:20938992 Neto1 Rat manganese atom multiple interactions ISO NETO1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of NETO1 mRNA CTD PMID:39836092 Neto1 Rat manganese(0) multiple interactions ISO NETO1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of NETO1 mRNA CTD PMID:39836092 Neto1 Rat manganese(II) chloride multiple interactions ISO NETO1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of NETO1 mRNA CTD PMID:39836092 Neto1 Rat methapyrilene increases methylation ISO NETO1 (Homo sapiens) 6480464 Methapyrilene results in increased methylation of NETO1 intron CTD PMID:30157460 Neto1 Rat methylmercury chloride increases expression ISO NETO1 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of NETO1 mRNA CTD PMID:28001369 Neto1 Rat paracetamol decreases expression ISO NETO1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of NETO1 mRNA CTD PMID:26690555 Neto1 Rat parathion increases methylation ISO NETO1 (Homo sapiens) 6480464 Parathion results in increased methylation of NETO1 promoter CTD PMID:22847954 Neto1 Rat phenylmercury acetate multiple interactions ISO NETO1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of NETO1 mRNA CTD PMID:27188386 Neto1 Rat SB 431542 multiple interactions ISO NETO1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Neto1 Rat silver atom decreases expression ISO NETO1 (Homo sapiens) 6480464 Silver results in decreased expression of NETO1 mRNA CTD PMID:26551752 Neto1 Rat silver(0) decreases expression ISO NETO1 (Homo sapiens) 6480464 Silver results in decreased expression of NETO1 mRNA CTD PMID:26551752 Neto1 Rat sodium arsenite multiple interactions ISO NETO1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of NETO1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of NETO1 mRNA CTD PMID:39836092 Neto1 Rat terbufos increases methylation ISO NETO1 (Homo sapiens) 6480464 terbufos results in increased methylation of NETO1 promoter CTD PMID:22847954 Neto1 Rat testosterone multiple interactions ISO NETO1 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of NETO1 mRNA CTD PMID:21592394 Neto1 Rat testosterone increases expression ISO NETO1 (Homo sapiens) 6480464 Testosterone results in increased expression of NETO1 mRNA CTD PMID:33359661 Neto1 Rat testosterone decreases expression ISO NETO1 (Homo sapiens) 6480464 Testosterone results in decreased expression of NETO1 mRNA CTD PMID:21592394 Neto1 Rat tetrachloromethane affects expression ISO Neto1 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of NETO1 mRNA CTD PMID:17484886 Neto1 Rat trichostatin A increases expression ISO NETO1 (Homo sapiens) 6480464 trichostatin A results in increased expression of NETO1 mRNA CTD PMID:24935251 Neto1 Rat triclosan decreases expression ISO NETO1 (Homo sapiens) 6480464 Triclosan results in decreased expression of NETO1 mRNA CTD PMID:30510588 Neto1 Rat valproic acid affects expression ISO NETO1 (Homo sapiens) 6480464 Valproic Acid affects the expression of NETO1 mRNA CTD PMID:25979313 Neto1 Rat valproic acid multiple interactions ISO NETO1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of NETO1 mRNA CTD PMID:27188386 Neto1 Rat valproic acid increases expression ISO NETO1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of NETO1 mRNA CTD PMID:23179753 more ... Neto1 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of NETO1 mRNA CTD PMID:19015723
1,1,1-trichloroethane (ISO) 1,2-dimethylhydrazine (EXP) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2-palmitoylglycerol (ISO) 4,4'-sulfonyldiphenol (ISO) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) all-trans-retinoic acid (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) bisphenol A (EXP,ISO) calcitriol (ISO) choline (ISO) copper(II) sulfate (ISO) Cuprizon (EXP) diethylstilbestrol (EXP) dorsomorphin (ISO) ethanol (ISO) fenamidone (ISO) folic acid (ISO) fonofos (ISO) formaldehyde (ISO) fulvestrant (ISO) ketoconazole (EXP) L-methionine (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methapyrilene (ISO) methylmercury chloride (ISO) paracetamol (ISO) parathion (ISO) phenylmercury acetate (ISO) SB 431542 (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) terbufos (ISO) testosterone (ISO) tetrachloromethane (ISO) trichostatin A (ISO) triclosan (ISO) valproic acid (ISO) vinclozolin (EXP)
Neto1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 18 81,905,455 - 82,028,730 (+) NCBI GRCr8 mRatBN7.2 18 79,635,633 - 79,753,913 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 18 79,635,633 - 79,749,030 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 18 81,744,847 - 81,859,798 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 18 82,416,897 - 82,531,858 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 18 80,252,532 - 80,367,485 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 18 83,471,342 - 83,585,043 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 18 83,471,342 - 83,584,357 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 18 82,532,693 - 82,646,402 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 18 82,888,369 - 83,107,662 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 18 78,220,855 - 78,334,439 (+) NCBI Celera Cytogenetic Map 18 q12.3 NCBI
NETO1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 18 72,742,314 - 72,867,987 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 18 72,742,314 - 72,868,146 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 18 70,409,549 - 70,535,222 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 18 68,565,767 - 68,685,790 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 18 68,565,766 - 68,683,914 NCBI Celera 18 67,266,714 - 67,386,741 (-) NCBI Celera Cytogenetic Map 18 q22.3 NCBI HuRef 18 67,129,054 - 67,254,266 (-) NCBI HuRef CHM1_1 18 70,404,789 - 70,530,029 (-) NCBI CHM1_1 T2T-CHM13v2.0 18 72,963,774 - 73,089,445 (-) NCBI T2T-CHM13v2.0
Neto1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 18 86,411,110 - 86,524,482 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 18 86,413,077 - 86,524,843 (+) Ensembl GRCm39 Ensembl GRCm38 18 86,394,815 - 86,506,721 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 18 86,394,952 - 86,506,718 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 18 86,564,344 - 86,671,289 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 18 86,529,145 - 86,635,466 (+) NCBI MGSCv36 mm8 Celera 18 87,432,805 - 87,540,028 (+) NCBI Celera Cytogenetic Map 18 E4 NCBI cM Map 18 58.47 NCBI
Neto1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955402 56,262,137 - 56,376,142 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955402 56,262,137 - 56,376,105 (-) NCBI ChiLan1.0 ChiLan1.0
NETO1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 17 90,262,474 - 90,387,572 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 18 75,955,097 - 76,080,195 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 18 66,114,425 - 66,240,141 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 18 69,402,193 - 69,527,333 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 18 69,408,116 - 69,527,333 (-) Ensembl panpan1.1 panPan2
NETO1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 6,114,152 - 6,242,178 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 6,114,067 - 6,225,821 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 7,125,478 - 7,252,116 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 5,929,615 - 6,056,608 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 5,929,703 - 6,044,453 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 5,967,271 - 6,093,806 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 5,921,208 - 6,048,154 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 6,139,656 - 6,266,730 (+) NCBI UU_Cfam_GSD_1.0
Neto1
NETO1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 150,711,628 - 150,817,437 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 150,711,486 - 150,821,626 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 167,021,548 - 167,061,940 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
NETO1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 18 6,956,629 - 7,082,135 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 18 6,957,091 - 7,076,892 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666060 18,776,177 - 18,902,102 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Neto1
.
Predicted Target Of
Count of predictions: 151 Count of miRNA genes: 102 Interacting mature miRNAs: 134 Transcripts: ENSRNOT00000019384 Prediction methods: Miranda, Targetscan Result types: miRGate_prediction
1331733 Bp233 Blood pressure QTL 233 3.97196 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 24796977 79788953 Rat 9589041 Epfw12 Epididymal fat weight QTL 12 17.08 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 18 46640675 83828827 Rat 2303584 Gluco55 Glucose level QTL 55 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 18 48520044 83828827 Rat 8694432 Bw165 Body weight QTL 165 3.81 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 18 46640675 83828827 Rat 1331741 Bp232 Blood pressure QTL 232 3.59112 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 18 21372893 83213037 Rat 1298072 Cia26 Collagen induced arthritis QTL 26 3.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 18 54709769 83828827 Rat 1600373 Mamtr6 Mammary tumor resistance QTL 6 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 18 19278901 83218561 Rat 2303571 Bw92 Body weight QTL 92 3 body mass (VT:0001259) body weight (CMO:0000012) 18 48520044 83828827 Rat 6903353 Bp353 Blood pressure QTL 353 2.8 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 18 59796478 83828827 Rat 1598826 Anxrr20 Anxiety related response QTL 20 3.04 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 18 41432971 83828827 Rat 1578667 Bss21 Bone structure and strength QTL 21 3.5 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 18 11791518 83218561 Rat 2303120 Mamtr8 Mammary tumor resistance QTL 8 0.001 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 18 31359408 83218561 Rat 738008 Hcar14 Hepatocarcinoma resistance QTL 14 4.3 liver integrity trait (VT:0010547) liver nonremodeling tumorous lesion number (CMO:0001462) 18 51464733 83218561 Rat 724542 Kidm2 Kidney mass QTL 2 2.6 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 18 59172115 83828827 Rat 6903356 Bp354 Blood pressure QTL 354 4.6 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 59796478 83828827 Rat 631518 Bw11 Body weight QTL 11 2.8 body mass (VT:0001259) body weight (CMO:0000012) 18 35870723 80870723 Rat 61367 Iddm4 Insulin dependent diabetes mellitus QTL 4 2.33 0.0074 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 18 38192455 83192455 Rat 6893683 Bw110 Body weight QTL 110 2.7 0.002 body mass (VT:0001259) body weight (CMO:0000012) 18 43345022 83828827 Rat 8694366 Abfw8 Abdominal fat weight QTL 8 6.38 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 18 46640675 83828827 Rat 1578661 Bss20 Bone structure and strength QTL 20 3.7 femur morphology trait (VT:0000559) femoral neck cross-sectional area (CMO:0001697) 18 11791518 83218561 Rat
D18Mit6
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 18 81,806,709 - 81,806,852 (+) Marker Load Pipeline mRatBN7.2 18 79,531,886 - 79,532,029 (+) MAPPER mRatBN7.2 Rnor_6.0 18 83,366,257 - 83,366,399 NCBI Rnor6.0 Rnor_5.0 18 82,427,608 - 82,427,750 UniSTS Rnor5.0 RGSC_v3.4 18 82,920,379 - 82,920,522 RGD RGSC3.4 RGSC_v3.4 18 82,920,380 - 82,920,522 UniSTS RGSC3.4 RGSC_v3.1 18 82,993,830 - 82,993,972 RGD Celera 18 78,116,960 - 78,117,102 UniSTS RH 3.4 Map 18 768.3 RGD RH 3.4 Map 18 768.3 UniSTS SHRSP x BN Map 18 51.2799 UniSTS SHRSP x BN Map 18 51.2799 RGD Cytogenetic Map 18 q13 UniSTS
D18Got77
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 18 79,683,569 - 79,683,854 (+) MAPPER mRatBN7.2 Rnor_6.0 18 83,518,834 - 83,519,118 NCBI Rnor6.0 Rnor_5.0 18 82,580,185 - 82,580,469 UniSTS Rnor5.0 RGSC_v3.4 18 83,042,103 - 83,042,388 RGD RGSC3.4 RGSC_v3.4 18 83,042,104 - 83,042,388 UniSTS RGSC3.4 RGSC_v3.1 18 83,115,554 - 83,115,838 RGD Celera 18 78,269,014 - 78,269,298 UniSTS RH 3.4 Map 18 768.2 RGD RH 3.4 Map 18 768.2 UniSTS Cytogenetic Map 18 q13 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
7
38
107
58
62
37
12
37
6
149
64
93
32
59
25
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000019384 ⟹ ENSRNOP00000019384
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 18 79,635,633 - 79,749,030 (+) Ensembl Rnor_6.0 Ensembl 18 83,471,342 - 83,584,357 (+) Ensembl
RefSeq Acc Id:
NM_001107371 ⟹ NP_001100841
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 81,910,453 - 82,023,847 (+) NCBI mRatBN7.2 18 79,635,633 - 79,749,030 (+) NCBI Rnor_6.0 18 83,471,342 - 83,584,357 (+) NCBI Rnor_5.0 18 82,532,693 - 82,646,402 (+) NCBI RGSC_v3.4 18 82,888,369 - 83,107,662 (+) RGD Celera 18 78,220,855 - 78,334,439 (+) RGD
Sequence:
CGCCGCCCCATTCCGCCGCTCACCAGCCCTGGGGGCACCGGCTGTGCTCAGCTGCCCAGTCTCACCCAGGCTTCGAGCTTCCTGGAGGGTCATGCAACCCGTAGCTATGACTAAGACGCTCACTTGGT
hide sequence
RefSeq Acc Id:
XM_006255035 ⟹ XP_006255097
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 81,905,455 - 82,028,730 (+) NCBI mRatBN7.2 18 79,636,453 - 79,753,913 (+) NCBI Rnor_6.0 18 83,472,212 - 83,585,043 (+) NCBI Rnor_5.0 18 82,532,693 - 82,646,402 (+) NCBI
Sequence:
GAAGTCTCCCCGTTTCTAAATGGAATTAGTGGAGATCGGAGCCTCTGGTGTAACGCACAGACATGATCTATGGACGCAGTTTGTTTCACATTATAGCAAGTTTAATCATCCTCCATTCTTCTGGAGCA
hide sequence
RefSeq Acc Id:
XM_008772133 ⟹ XP_008770355
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 81,905,455 - 81,987,177 (+) NCBI mRatBN7.2 18 79,636,453 - 79,712,356 (+) NCBI Rnor_6.0 18 83,472,212 - 83,548,275 (+) NCBI
Sequence:
GAAGTCTCCCCGTTTCTAAATGGAATTAGTGGAGATCGGAGCCTCTGGTGTAACGCACAGACAT
hide sequence
RefSeq Acc Id:
XM_039096765 ⟹ XP_038952693
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 81,905,455 - 82,028,730 (+) NCBI mRatBN7.2 18 79,636,453 - 79,753,913 (+) NCBI
RefSeq Acc Id:
XM_039096766 ⟹ XP_038952694
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 81,905,455 - 82,028,730 (+) NCBI mRatBN7.2 18 79,636,453 - 79,753,913 (+) NCBI
RefSeq Acc Id:
XM_039096767 ⟹ XP_038952695
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 81,919,787 - 82,028,730 (+) NCBI mRatBN7.2 18 79,644,967 - 79,753,913 (+) NCBI
RefSeq Acc Id:
XM_039096768 ⟹ XP_038952696
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 81,919,692 - 82,028,730 (+) NCBI mRatBN7.2 18 79,644,863 - 79,753,913 (+) NCBI
RefSeq Acc Id:
XM_039096769 ⟹ XP_038952697
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 81,905,455 - 81,996,287 (+) NCBI mRatBN7.2 18 79,636,453 - 79,721,472 (+) NCBI
RefSeq Acc Id:
XM_063277287 ⟹ XP_063133357
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 81,905,455 - 82,028,730 (+) NCBI
RefSeq Acc Id:
XM_063277288 ⟹ XP_063133358
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 81,905,455 - 82,016,979 (+) NCBI
RefSeq Acc Id:
XR_005496025
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 81,905,455 - 81,996,136 (+) NCBI mRatBN7.2 18 79,636,453 - 79,721,319 (+) NCBI
RefSeq Acc Id:
NP_001100841 ⟸ NM_001107371
- Peptide Label:
precursor
- UniProtKB:
D4AAD6 (UniProtKB/TrEMBL), A6K5M8 (UniProtKB/TrEMBL)
- Sequence:
MIYGRSLFHIIASLIILHSSGATKKGTEKQITPETQKSVQCGTWTKHAEGGVFTSPNYPGKYPPDRECVYIIEAAPRQCIELYFDEKYSIEPSWECKFDHIEVRDGPFGFSPIIGRFCGQQNPPVIKS
hide sequence
RefSeq Acc Id:
XP_006255097 ⟸ XM_006255035
- Peptide Label:
isoform X1
- UniProtKB:
D4AAD6 (UniProtKB/TrEMBL), A6K5M8 (UniProtKB/TrEMBL)
- Sequence:
MIYGRSLFHIIASLIILHSSGATKKGTEKQITPETQKSVQCGTWTKHAEGGVFTSPNYPGKYPP
hide sequence
RefSeq Acc Id:
XP_008770355 ⟸ XM_008772133
- Peptide Label:
isoform X6
- Sequence:
MIYGRSLFHIIASLIILHSSGATKKGTEKQITPETQKSVQCGTWTKHAEGGVFTSPNYPGKYPPDRECVYIIEAAPRQCIELYFDEKYSIEPSWECKFDHIEVRDGPFGFSPIIGRFCGQQNPPVIKS
hide sequence
Ensembl Acc Id:
ENSRNOP00000019384 ⟸ ENSRNOT00000019384
RefSeq Acc Id:
XP_038952693 ⟸ XM_039096765
- Peptide Label:
isoform X1
- UniProtKB:
D4AAD6 (UniProtKB/TrEMBL), A6K5M8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038952694 ⟸ XM_039096766
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_038952697 ⟸ XM_039096769
- Peptide Label:
isoform X7
RefSeq Acc Id:
XP_038952696 ⟸ XM_039096768
- Peptide Label:
isoform X4
RefSeq Acc Id:
XP_038952695 ⟸ XM_039096767
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_063133357 ⟸ XM_063277287
- Peptide Label:
isoform X1
- UniProtKB:
A6K5M8 (UniProtKB/TrEMBL), D4AAD6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063133358 ⟸ XM_063277288
- Peptide Label:
isoform X5
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-12-10
Neto1
neuropilin and tolloid like 1
Neto1
neuropilin (NRP) and tolloid (TLL)-like 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-03-07
Neto1
neuropilin (NRP) and tolloid (TLL)-like 1
RGD1566269_predicted
similar to Neuropilin- and tolloid-like protein 1 (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-07
RGD1566269_predicted
similar to Neuropilin- and tolloid-like protein 1 (predicted)
LOC307206
similar to Neuropilin- and tolloid-like protein 1
Symbol and Name status set to approved
1299863 APPROVED
2006-02-09
LOC307206
similar to Neuropilin- and tolloid-like protein 1
Symbol and Name status set to provisional
70820 PROVISIONAL
