Advanced Search (OLGA)

Gene: Smyd2 (SET and MYND domain containing 2) Rattus norvegicus

Analyze

Symbol:

Smyd2

Name:

SET and MYND domain containing 2

RGD ID:

727785

Description:

Predicted to enable RNA polymerase II complex binding activity; histone H3K36 methyltransferase activity; and p53 binding activity. Involved in heart development. Predicted to be located in cytosol. Predicted to be active in nucleus. Orthologous to human SMYD2 (SET and MYND domain containing 2); PARTICIPATES IN histone modification pathway; methionine cycle/metabolic pathway; p53 signaling pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; atrazine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

histone methyltransferase SMYD2; HSKM-B; N-lysine methyltransferase SMYD2; SET and MYND domain-containing protein 2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SMYD2 (SET and MYND domain containing 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Smyd2 (SET and MYND domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Smyd2 (SET and MYND domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SMYD2 (SET and MYND domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SMYD2 (SET and MYND domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Smyd2 (SET and MYND domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SMYD2 (SET and MYND domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SMYD2 (SET and MYND domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Smyd2 (SET and MYND domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Smyd2 (SET and MYND domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	SMYD2 (SET and MYND domain containing 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Smyd2 (SET and MYND domain containing 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	smyd2a (SET and MYND domain containing 2a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Smyd3	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Smyd3	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	set-14	Alliance	DIOPT (InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	set-14	Alliance	DIOPT (OrthoFinder\|OrthoInspector\|PANTHER)
Caenorhabditis elegans (roundworm):	set-18	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	SET6	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Caenorhabditis elegans (roundworm):	set-30	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	set-30	Alliance	DIOPT (OMA\|PANTHER\|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):	SET5	Alliance	DIOPT (InParanoid\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	smyd2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	103,956,470 - 103,997,774 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	13	103,956,473 - 103,997,774 (-)	Ensembl				GRCr8
mRatBN7.2	13	101,425,270 - 101,466,576 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	101,425,273 - 101,466,576 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	13	103,940,656 - 103,981,564 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	105,329,429 - 105,370,669 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	102,534,981 - 102,578,302 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	108,642,156 - 108,686,293 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	108,642,156 - 108,686,290 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	13	113,261,746 - 113,302,399 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	13	106,160,147 - 106,201,473 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	13	100,910,865 - 100,950,701 (-)	NCBI		Celera
RGSC_v3.1	13	106,349,462 - 106,390,567 (-)	NCBI
Cytogenetic Map	13	q26	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Esophageal Neoplasms (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17beta-estradiol (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

5-aza-2'-deoxycytidine (ISO)

acrylamide (ISO)

all-trans-retinoic acid (ISO)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

atrazine (EXP)

benzo[a]pyrene (EXP)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

cadmium dichloride (ISO)

cantharidin (ISO)

carbamazepine (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

cobalt dichloride (ISO)

copper(II) sulfate (ISO)

coumestrol (ISO)

cyclosporin A (ISO)

dicrotophos (ISO)

dioxygen (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

Enterolactone (ISO)

ethanol (ISO)

ethyl methanesulfonate (ISO)

fenthion (ISO)

flutamide (EXP)

folic acid (ISO)

gentamycin (EXP)

ivermectin (ISO)

leflunomide (EXP)

levonorgestrel (ISO)

lipopolysaccharide (ISO)

LLY-507 (ISO)

menadione (ISO)

methidathion (ISO)

methoxychlor (EXP)

methyl methanesulfonate (ISO)

N,N-diethyl-m-toluamide (EXP)

N-methyl-4-phenylpyridinium (EXP)

panobinostat (ISO)

paracetamol (ISO)

paraquat (EXP)

permethrin (EXP)

phenobarbital (ISO)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

S-adenosyl-L-methioninate (ISO)

S-adenosyl-L-methionine (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

testosterone undecanoate (ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trichostatin A (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vitamin E (ISO)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

chromatin organization (IEA)

chromatin remodeling (IEA)

DNA-templated transcription (IEA)

heart development (IBA,IEP)

methylation (IEA)

negative regulation of cell population proliferation (IEA,ISO,ISS)

negative regulation of DNA-templated transcription (IBA)

negative regulation of transcription by RNA polymerase II (IEA,ISO,ISS)

peptidyl-lysine dimethylation (ISO,ISS)

peptidyl-lysine monomethylation (ISO,ISS)

regulation of DNA damage response, signal transduction by p53 class mediator (IEA,ISO,ISS)

Cellular Component

cytoplasm (IEA,ISO,ISS)

cytosol (IEA,ISO,ISS)

nucleus (IBA,IEA,ISO,ISS)

Molecular Function

histone H3K36 methyltransferase activity (IBA,IEA,ISO,ISS)

histone H3K4 trimethyltransferase activity (IEA)

histone methyltransferase activity (IEA)

metal ion binding (IEA)

methyltransferase activity (IEA)

p53 binding (IEA,ISO)

protein binding (ISO)

protein-lysine N-methyltransferase activity (IEA,ISO,ISS)

RNA polymerase II complex binding (IEA,ISO,ISS)

transferase activity (IEA)

zinc ion binding (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

histone modification pathway (ISO)

methionine cycle/metabolic pathway (ISO)

p53 signaling pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Histone lysine methylation dynamics: establishment, regulation, and biological impact.	Black JC, etal., Mol Cell. 2012 Nov 30;48(4):491-507. doi: 10.1016/j.molcel.2012.11.006.
2.	Dysregulation of CREB binding protein triggers thrombin-induced proliferation of vascular smooth muscle cells.	Chen J, etal., Mol Cell Biochem. 2008 Aug;315(1-2):123-30. Epub 2008 May 23.
3.	Cardiac deletion of Smyd2 is dispensable for mouse heart development.	Diehl F, etal., PLoS One. 2010 Mar 17;5(3):e9748. doi: 10.1371/journal.pone.0009748.
4.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.	Targeting protein lysine methylation and demethylation in cancers.	He Y, etal., Acta Biochim Biophys Sin (Shanghai). 2012 Jan;44(1):70-9. doi: 10.1093/abbs/gmr109.
6.	Modes of p53 regulation.	Kruse JP and Gu W, Cell. 2009 May 15;137(4):609-22. doi: 10.1016/j.cell.2009.04.050.
7.	NCBI rat LocusLink and RefSeq merged data October 15, 2003	NCBI rat LocusLink and RefSeq merged data October 15, 2003
8.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
9.	GOA pipeline	RGD automated data pipeline
10.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	Comprehensive gene review and curation	RGD comprehensive gene curation
13.	Lysine methyltransferase Smyd2 regulates Hsp90-mediated protection of the sarcomeric titin springs and cardiac function.	Voelkel T, etal., Biochim Biophys Acta. 2013 Apr;1833(4):812-22. doi: 10.1016/j.bbamcr.2012.09.012. Epub 2012 Oct 6.

Additional References at PubMed

PMID:8889548	PMID:12783626	PMID:16805913	PMID:17108971	PMID:20870719	PMID:22862948	PMID:24880080	PMID:30337525	PMID:32096186	PMID:38770649

Genomics

Comparative Map Data

Smyd2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	103,956,470 - 103,997,774 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	13	103,956,473 - 103,997,774 (-)	Ensembl				GRCr8
mRatBN7.2	13	101,425,270 - 101,466,576 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	101,425,273 - 101,466,576 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	13	103,940,656 - 103,981,564 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	105,329,429 - 105,370,669 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	102,534,981 - 102,578,302 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	108,642,156 - 108,686,293 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	108,642,156 - 108,686,290 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	13	113,261,746 - 113,302,399 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	13	106,160,147 - 106,201,473 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	13	100,910,865 - 100,950,701 (-)	NCBI		Celera
RGSC_v3.1	13	106,349,462 - 106,390,567 (-)	NCBI
Cytogenetic Map	13	q26	NCBI

SMYD2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	214,281,159 - 214,337,131 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	214,280,935 - 214,337,137 (+)	Ensembl			hg38	GRCh38
GRCh37	1	214,454,502 - 214,510,474 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	212,521,199 - 212,577,097 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	1	210,842,970 - 210,898,868	NCBI
Celera	1	187,677,508 - 187,733,362 (+)	NCBI		Celera
Cytogenetic Map	1	q32.3	NCBI
HuRef	1	185,129,703 - 185,185,600 (+)	NCBI		HuRef
CHM1_1	1	215,726,941 - 215,782,851 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	213,520,680 - 213,576,627 (+)	NCBI		T2T-CHM13v2.0

Smyd2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	189,612,689 - 189,654,758 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	189,612,689 - 189,654,560 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	1	189,880,492 - 189,922,495 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	189,880,492 - 189,922,363 (-)	Ensembl			mm10	GRCm38
MGSCv37	1	191,704,371 - 191,746,167 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	1	191,581,280 - 191,623,076 (-)	NCBI		MGSCv36	mm8
Celera	1	196,790,858 - 196,832,656 (-)	NCBI		Celera
Cytogenetic Map	1	H6	NCBI
cM Map	1	95.03	NCBI

Smyd2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955406	3,465,924 - 3,509,156 (-)	Ensembl
ChiLan1.0	NW_004955406	3,467,123 - 3,509,156 (-)	NCBI	ChiLan1.0	ChiLan1.0

SMYD2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	35,065,100 - 35,121,132 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	35,029,402 - 35,085,432 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	189,849,167 - 189,905,193 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	194,729,116 - 194,761,043 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	194,729,116 - 194,761,045 (+)	Ensembl			panPan2	panpan1.1

SMYD2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	7	12,281,581 - 12,331,294 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	7	12,281,710 - 12,331,164 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	7	11,855,760 - 11,905,351 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	7	11,991,481 - 12,041,301 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	7	11,991,446 - 12,044,237 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	7	11,915,043 - 11,964,795 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	7	12,019,583 - 12,068,986 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	7	12,143,792 - 12,193,251 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Smyd2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	61,907,871 - 61,955,361 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936628	3,918,230 - 3,965,387 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936628	3,917,898 - 3,965,382 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SMYD2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	9	129,263,526 - 129,316,349 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	9	129,263,524 - 129,316,226 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	9	142,158,967 - 142,212,600 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SMYD2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	25	15,236,773 - 15,293,154 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	25	15,235,653 - 15,293,153 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666055	15,711,719 - 15,767,873 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Smyd2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624771	19,441,456 - 19,487,793 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624771	19,441,452 - 19,485,897 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Smyd2
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	10	67,953,863 - 67,993,372 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Smyd2
326 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	173
Count of miRNA genes:	123
Interacting mature miRNAs:	133
Transcripts:	ENSRNOT00000004783
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
7207885	Glom27	Glomerulus QTL 27	3.9		kidney glomerulus integrity trait (VT:0010546)	kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139)	13	21120177	109350286	Rat
738027	Lnnr6	Liver neoplastic nodule remodeling QTL 6	3.3		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	13	65613454	109350286	Rat
7387280	Uae43	Urinary albumin excretion QTL 43	5.69	0.4174	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	68983334	109350286	Rat
2293702	Bss34	Bone structure and strength QTL 34	4.61	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	13	67635937	109350286	Rat
2293687	Bss26	Bone structure and strength QTL 26	4.6	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	13	67635937	109350286	Rat
1576318	Schws5	Schwannoma susceptibility QTL 5		0.0351	nervous system integrity trait (VT:0010566)	post-insult time to trigeminal nerve neurilemmoma formation (CMO:0002019)	13	64497900	109350286	Rat
12879475	Bp400	Blood pressure QTL 400			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	64375743	109350286	Rat
8655951	Rf63	Renal function QTL 63	12.2		blood urea nitrogen amount (VT:0005265)	plasma urea nitrogen level (CMO:0000586)	13	71610804	109350286	Rat
4889606	Gluco63	Glucose level QTL 63	2.86	0.003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	13	83286150	109350286	Rat
2293341	Glom15	Glomerulus QTL 15	9.1		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	13	67635937	109350286	Rat

Markers in Region

RH130282

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	13	101,425,352 - 101,425,540 (-)	MAPPER	mRatBN7.2
Rnor_6.0	13	108,686,023 - 108,686,210	NCBI	Rnor6.0
Rnor_5.0	13	113,302,129 - 113,302,316	UniSTS	Rnor5.0
RGSC_v3.4	13	106,160,230 - 106,160,417	UniSTS	RGSC3.4
Celera	13	100,910,948 - 100,911,135	UniSTS
RH 3.4 Map	13	697.9	UniSTS
Cytogenetic Map	13	q27	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	163	91	90	59	92	59	6	356	192	11	142	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_206851	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AW433707	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BK001057	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB726546	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473985	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000013	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000004783 ⟹ ENSRNOP00000004783

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	13	103,956,473 - 103,997,774 (-)	Ensembl
mRatBN7.2 Ensembl	13	101,425,273 - 101,466,576 (-)	Ensembl
Rnor_6.0 Ensembl	13	108,642,156 - 108,686,290 (+)	Ensembl

RefSeq Acc Id:

NM_206851 ⟹ NP_996733

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	103,956,470 - 103,997,774 (-)	NCBI
mRatBN7.2	13	101,425,270 - 101,466,576 (-)	NCBI
Rnor_6.0	13	108,642,156 - 108,686,293 (+)	NCBI
Rnor_5.0	13	113,261,746 - 113,302,399 (+)	NCBI
RGSC_v3.4	13	106,160,147 - 106,201,473 (-)	RGD
Celera	13	100,910,865 - 100,950,701 (-)	RGD

Sequence:

show sequence

GTGCCCCGCAGCGCGCAGCCGCAGCGCTGCCAGCATGCGCGCCGAGGCCCGCGGCGGCCTGGAG
CGCTTCTGCAGCGCGGGCAAGGGCCGGGGGCTCCGTGCGCTGCGGCCCTTCCACGTGGGCGACC
TCCTCTTCTCCTGCCCGGCCTACGCCTGCGTGCTCACCGTGGGCGAGCGGGGCCACCACTGCGA
GTGCTGCTTCGCCAGGAAAGAAGGATTGTCGAAATGTGGACGATGCAAGCAAGCCTTCTACTGC
GATGTGGAGTGTCAGAAAGAAGACTGGCCCCTGCACAAGCTGGAGTGCTCCTCCATGGTTGTTT
TCGGGGAGAACTGGAATCCCTCGGAGACTGTGCGGCTCACAGCAAGGATCCTGGCCAAGCAGAA
AATGCACCCAGAGAGGACACCTTCAGAGAAACTGTTGGCCGTGAGGGAGTTTGAGTCACATCTG
GACAAGCTAGACAACGAGAAGAAGGATCTCATCCAGAGCGACATCGCGGCGCTCCATCAGTTCT
ACTCCAAGCACCTGGAGTTCCCTGACCACAGCAGCCTTGTGGTGCTCTTTGCCCAGGTGAACTG
TAATGGCTTCACTATTGAAGATGAGGAGCTCTCTCACTTGGGATCGGCGATATTTCCTGATGTT
GCGCTGATGAATCACAGCTGCTGCCCGAATGTCATTGTGACCTACAAAGGTACCCTGGCAGAAG
TCAGAGCTGTGCAGGAGATCCACCCAGGAGATGAGGTGTTCACCAGCTATATCGACCTGCTGTA
TCCAACAGAAGACAGGAACGACCGGTTAAGAGACTCCTACTTCTTTACCTGTGAGTGCCGGGAG
TGTACGACCAAGGACAAGGACAAGGCCAAGGTGGAAATCCGGAAGCTCAGCAACCCACCTCAGG
CAGAAGCCATCCGAGACATGGTCAGATACGCACGCAATGTCATCGAGGAGTTCCGGAGGGCCAA
GCACTACAAATCCCCTAGTGAGCTGTTGGAAATCTGTGAGCTCAGCCAGGAGAAGATGAGCTCT
GTGTTTGAGGACAGCAATGTGTACATGCTACACATGATGTACCAGGCCATGGGCGTCTGCCTGT
ACATGCAGGACTGGGAAGGAGCCCTGAAATATGGCCAGAAGATCATCAAACCCTACAGTAAGCA
CTACCCCGTGTACTCCCTCAACGTGGCCTCCATGTGGCTGAAGTTGGGAAGACTGTACATGGGC
CTGGAGAACAAAGCTGCCGGGGAGAAGGCCCTGAAGAAGGCCATCGCCATCATGGAAATAGCTC
ATGGCAAGGACCACCCGTACATCTCCGAGATCAAGCAGGAAATTGAGAGCCACTGACCATGCGT
CCCAGCTTTCCGTCAGAAACCTCACAGTCACCCCAGCCTTCTGCAAGCCTCGCCATGCTGTGTT
CCAGTTCGCATTTCCAGTGCTTGCCTGTGCTCTAAGGGCCGTGGCATGATTTCACATAATACAT
ATTTTGGGCAGATTGAGCTTTAAAAAATGCAACCATTTTCCCTCTGTGCCTGTCGGAATGCTCT
GCAGAGCTGACCGAGGAGAGAATAAAAGCGCCAGTCCTTAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_996733	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	DAA01315	(Get FASTA)	NCBI Sequence Viewer
	EDL94968	(Get FASTA)	NCBI Sequence Viewer
	EDL94969	(Get FASTA)	NCBI Sequence Viewer
	EDL94970	(Get FASTA)	NCBI Sequence Viewer
	EDL94971	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000004783
	ENSRNOP00000004783.4
GenBank Protein	Q7M6Z3	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_996733 ⟸ NM_206851

- UniProtKB:

Q7M6Z3 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MRAEARGGLERFCSAGKGRGLRALRPFHVGDLLFSCPAYACVLTVGERGHHCECCFARKEGLSK
CGRCKQAFYCDVECQKEDWPLHKLECSSMVVFGENWNPSETVRLTARILAKQKMHPERTPSEKL
LAVREFESHLDKLDNEKKDLIQSDIAALHQFYSKHLEFPDHSSLVVLFAQVNCNGFTIEDEELS
HLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIHPGDEVFTSYIDLLYPTEDRNDRLRD
SYFFTCECRECTTKDKDKAKVEIRKLSNPPQAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEI
CELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALKYGQKIIKPYSKHYPVYSLNVASM
WLKLGRLYMGLENKAAGEKALKKAIAIMEIAHGKDHPYISEIKQEIESH

hide sequence

Ensembl Acc Id:

ENSRNOP00000004783 ⟸ ENSRNOT00000004783

Protein Domains

MYND-type SET

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q7M6Z3-F1-model_v2	AlphaFold	Q7M6Z3	1-433	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13699106

Promoter ID:

EPDNEW_R9631

Type:

initiation region

Name:

Smyd2_1

Description:

SET and MYND domain containing 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	13	108,642,172 - 108,642,232	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:727785	AgrOrtholog
BioCyc Gene	G2FUF-16899	BioCyc
Ensembl Genes	ENSRNOG00000003583	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000004783	ENTREZGENE
	ENSRNOT00000004783.7	UniProtKB/Swiss-Prot
Gene3D-CATH	1.10.220.160	UniProtKB/Swiss-Prot
	1.25.40.10	UniProtKB/Swiss-Prot
	2.170.270.10	UniProtKB/Swiss-Prot
	6.10.140.2220	UniProtKB/Swiss-Prot
InterPro	H3K4_H4K5_MeTrfase	UniProtKB/Swiss-Prot
	SET_dom	UniProtKB/Swiss-Prot
	SET_dom_sf	UniProtKB/Swiss-Prot
	SMYD2_SET	UniProtKB/Swiss-Prot
	TPR-like_helical_dom_sf	UniProtKB/Swiss-Prot
	Znf_MYND	UniProtKB/Swiss-Prot
KEGG Report	rno:289372	UniProtKB/Swiss-Prot
NCBI Gene	289372	ENTREZGENE
PANTHER	HISTONE-LYSINE N-METHYLTRANSFERASE SMYD	UniProtKB/Swiss-Prot
	N-LYSINE METHYLTRANSFERASE SMYD2	UniProtKB/Swiss-Prot
Pfam	SET	UniProtKB/Swiss-Prot
	zf-MYND	UniProtKB/Swiss-Prot
PhenoGen	Smyd2	PhenoGen
PROSITE	SET	UniProtKB/Swiss-Prot
	ZF_MYND_1	UniProtKB/Swiss-Prot
	ZF_MYND_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000003583	RatGTEx
Superfamily-SCOP	SSF48452	UniProtKB/Swiss-Prot
	SSF82199	UniProtKB/Swiss-Prot
UniProt	A6JGW2_RAT	UniProtKB/TrEMBL
	A6JGW3_RAT	UniProtKB/TrEMBL
	A6JGW4_RAT	UniProtKB/TrEMBL
	A6JGW5_RAT	UniProtKB/TrEMBL
	Q7M6Z3	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-09-10	Smyd2	SET and MYND domain containing 2			Symbol and Name status set to approved	1299863	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - PID (archival)