Advanced Search (OLGA)

Gene: Pdzk1 (PDZ domain containing 1) Rattus norvegicus

Analyze

Symbol:

Pdzk1

Name:

PDZ domain containing 1

RGD ID:

70924

Description:

Enables scavenger receptor binding activity. Predicted to be involved in several processes, including carnitine transport; positive regulation of protein targeting to membrane; and regulation of monoatomic ion transport. Predicted to act upstream of or within in utero embryonic development. Located in apical plasma membrane and microvillus membrane. Orthologous to several human genes including PDZK1 (PDZ domain containing 1); INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

C-terminal linking and modulating protein; C-terminal-linking and modulating protein; Clamp; dietary Pi-regulated RNA-1; diphor-1; na(+)/H(+) exchange regulatory cofactor NHE-RF3; na(+)/H(+) exchanger regulatory factor 3; na/Pi cotransporter C-terminal-associated protein 1; naPi-Cap1; NHERF-3; PDZ domain-containing protein 1; sodium-hydrogen exchanger regulatory factor 3

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PDZK1 (PDZ domain containing 1)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Pdzk1 (PDZ domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Pdzk1 (PDZ domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PDZK1 (PDZ domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PDZK1 (PDZ domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Pdzk1 (PDZ domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PDZK1 (PDZ domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PDZK1 (PDZ domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Pdzk1 (PDZ domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	PDZK1P1 (PDZ domain containing 1 pseudogene 1)	HGNC	Panther
Alliance orthologs ³
Homo sapiens (human):	PDZK1 (PDZ domain containing 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Pdzk1 (PDZ domain containing 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	PDZK1P1 (PDZ domain containing 1 pseudogene 1)	Alliance	DIOPT (OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	pdzk1 (PDZ domain containing 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	pdzk1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	187,064,995 - 187,096,348 (+)	NCBI		GRCr8
mRatBN7.2	2	184,376,161 - 184,407,514 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	184,376,161 - 184,407,514 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	192,046,710 - 192,077,941 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	189,846,505 - 189,877,666 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	184,679,274 - 184,710,509 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	198,965,685 - 198,999,323 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	198,965,685 - 198,999,323 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	218,452,670 - 218,484,881 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	191,643,593 - 191,675,995 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	191,606,346 - 191,638,749 (+)	NCBI
Celera	2	176,900,642 - 176,931,947 (+)	NCBI		Celera
Cytogenetic Map	2	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

adenoid cystic carcinoma (ISO)

Breast Neoplasms (ISO)

cataract 46 juvenile-onset (ISO)

gastrointestinal stromal tumor (ISO)

parathyroid carcinoma (ISO)

Prostatic Neoplasms (ISO)

Salivary Gland Neoplasms (ISO)

schizophrenia (ISO)

thrombocytopenia-absent radius syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

3,3,4,4,5,5,6,6,7,7,8,8,9,9,10,10,10-heptadecafluoro-1-decanol (ISO)

3H-1,2-dithiole-3-thione (EXP)

4,4'-diaminodiphenylmethane (EXP)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

4-nonylphenol (ISO)

4-octylphenol (ISO)

acrylamide (ISO)

afimoxifene (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

beta-lapachone (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

butanal (ISO)

C60 fullerene (EXP)

cadmium atom (ISO)

carbon nanotube (ISO)

chromium(6+) (ISO)

ciglitazone (ISO)

clofibric acid (EXP)

Clofop (ISO)

clomiphene (ISO)

cocaine (EXP)

copper(II) chloride (ISO)

copper(II) sulfate (ISO)

coumestrol (ISO)

cyclosporin A (ISO)

daidzein (ISO)

dicrotophos (ISO)

diethylstilbestrol (ISO)

dinophysistoxin 1 (ISO)

dioxygen (ISO)

Enterolactone (ISO)

estriol (ISO)

estrone (ISO)

flurbiprofen (ISO)

fulvestrant (ISO)

furan (EXP)

gefitinib (ISO)

genistein (ISO)

glafenine (EXP)

GW 501516 (ISO)

hexestrol (ISO)

hydrogen peroxide (ISO)

hydroquinone O-beta-D-glucopyranoside (ISO)

isotretinoin (ISO)

menadione (ISO)

mestranol (ISO)

methylmercury chloride (ISO)

microcystin-LR (ISO)

mono(2-ethylhexyl) phthalate (ISO)

Muraglitazar (EXP)

N-nitrosodiethylamine (EXP)

nefazodone (EXP)

nickel atom (ISO)

nickel sulfate (ISO)

O-methyleugenol (ISO)

paracetamol (ISO)

pentanal (ISO)

perfluorononanoic acid (ISO)

perfluorooctanoic acid (ISO)

phenobarbital (ISO)

phytoestrogen (ISO)

pirinixic acid (ISO)

pregnenolone 16alpha-carbonitrile (EXP)

propanal (ISO)

raloxifene (ISO)

resveratrol (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sodium fluoride (ISO)

tamoxifen (ISO)

Tesaglitazar (EXP)

Tetrachlorobisphenol A (EXP,ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

troglitazone (EXP)

urethane (ISO)

valproic acid (ISO)

wortmannin (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

carnitine transport (ISO)

cholesterol transport (NAS)

in utero embryonic development (ISO)

intracellular transport (NAS)

positive regulation of cation transmembrane transport (ISO)

positive regulation of ion transmembrane transporter activity (ISO)

positive regulation of protein localization to membrane (ISO)

positive regulation of protein targeting to membrane (ISO,ISS)

protein localization to plasma membrane (IBA,ISO)

regulation of monoatomic anion transport (ISO,ISS)

Cellular Component

apical plasma membrane (IBA,IDA)

brush border (ISO)

brush border membrane (ISO,ISS)

microvillus membrane (IDA)

plasma membrane (ISO,ISS)

Molecular Function

PDZ domain binding (ISO)

protein binding (IPI,ISO)

protein-containing complex binding (IPI)

protein-membrane adaptor activity (IBA)

scavenger receptor binding (IDA)

signaling receptor binding (IBA)

References

References - curated

#	Reference Title	Reference Citation
1.	Interactions between CAP70 and actinfilin are important for integrity of actin cytoskeleton structures in neurons.	Chen Y and Li M, Neuropharmacology. 2005 Dec;49(7):1026-41. Epub 2005 Jul 28.
2.	Identification of a new gene product (diphor-1) regulated by dietary phosphate.	Custer M, etal., Am J Physiol 1997 Nov;273(5 Pt 2):F801-6.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	NHE3 regulatory factor 1 (NHERF1) modulates intestinal sodium-dependent phosphate transporter (NaPi-2b) expression in apical microvilli.	Giral H, etal., J Biol Chem. 2012 Oct 12;287(42):35047-56. doi: 10.1074/jbc.M112.392415. Epub 2012 Aug 17.
5.	Identification of a PDZ-domain-containing protein that interacts with the scavenger receptor class B type I.	Ikemoto M, etal., Proc Natl Acad Sci U S A 2000 Jun 6;97(12):6538-43.
6.	Gene Data Set	MGD Curation, June 12, 2002
7.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
8.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.	GOA pipeline	RGD automated data pipeline
10.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
11.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
12.	Analysis of different complexes of type IIa sodium-dependent phosphate transporter in rat renal cortex using blue-native polyacrylamide gel electrophoresis.	Tanimura A, etal., J Med Invest. 2011 Feb;58(1-2):140-7.

Additional References at PubMed

PMID:9461128	PMID:15489334	PMID:15523054	PMID:15994332	PMID:16141316	PMID:16236806	PMID:16738539	PMID:17990980	PMID:19056867	PMID:23376485	PMID:27996060	PMID:29752999
PMID:37696999

Genomics

Comparative Map Data

Pdzk1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	187,064,995 - 187,096,348 (+)	NCBI		GRCr8
mRatBN7.2	2	184,376,161 - 184,407,514 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	184,376,161 - 184,407,514 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	192,046,710 - 192,077,941 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	189,846,505 - 189,877,666 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	184,679,274 - 184,710,509 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	198,965,685 - 198,999,323 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	198,965,685 - 198,999,323 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	218,452,670 - 218,484,881 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	191,643,593 - 191,675,995 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	191,606,346 - 191,638,749 (+)	NCBI
Celera	2	176,900,642 - 176,931,947 (+)	NCBI		Celera
Cytogenetic Map	2	q34	NCBI

PDZK1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	145,670,852 - 145,707,400 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	145,670,852 - 145,708,148 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	145,727,666 - 145,764,207 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	144,439,083 - 144,475,430 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	143,216,769 - 143,253,117	NCBI
Celera	1	119,930,736 - 119,957,156 (+)	NCBI		Celera
Cytogenetic Map	1	q21.1	NCBI
HuRef	1	119,691,465 - 119,728,015 (+)	NCBI		HuRef
CHM1_1	1	147,038,978 - 147,075,526 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	144,787,642 - 144,824,930 (-)	NCBI		T2T-CHM13v2.0

Pdzk1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	96,736,772 - 96,778,242 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	96,736,600 - 96,778,242 (+)	Ensembl		GRCm39 Ensembl
GRCm38	3	96,829,456 - 96,870,926 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	96,829,284 - 96,870,926 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	96,633,988 - 96,674,849 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	3	96,915,531 - 96,956,331 (+)	NCBI		MGSCv36	mm8
Celera	3	98,239,046 - 98,278,106 (+)	NCBI		Celera
Cytogenetic Map	3	F2.1	NCBI
cM Map	3	42.0	NCBI

Pdzk1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955568	386,904 - 436,346 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955568	405,697 - 436,346 (+)	NCBI	ChiLan1.0	ChiLan1.0

PDZK1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	103,060,229 - 103,125,645 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	102,647,669 - 102,708,517 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	122,034,097 - 122,091,823 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	113,579,273 - 113,615,526 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	113,579,273 - 113,615,390 (-)	Ensembl	panpan1.1		panPan2

PDZK1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	17	58,496,977 - 58,536,772 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	17	57,964,905 - 58,005,087 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	17	59,493,230 - 59,533,453 (-)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	17	58,366,239 - 58,406,279 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	17	58,427,299 - 58,467,509 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	17	59,153,604 - 59,193,832 (-)	NCBI		UU_Cfam_GSD_1.0

Pdzk1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	20,550,890 - 20,577,629 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936867	426,648 - 439,512 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PDZK1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	99,625,080 - 99,657,161 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	99,625,085 - 99,657,170 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	109,286,291 - 109,324,485 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PDZK1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	13,026,422 - 13,076,094 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	13,040,475 - 13,079,241 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	15,720,272 - 15,756,120 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pdzk1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624772	17,022,967 - 17,057,447 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624772	17,023,837 - 17,057,160 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Pdzk1
254 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	278
Count of miRNA genes:	185
Interacting mature miRNAs:	207
Transcripts:	ENSRNOT00000000107
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578648	Bss11	Bone structure and strength QTL 11	4.7		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	2	114837527	211674221	Rat
1358356	Srcrt1	Stress Responsive Cort QTL1	3.66		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	2	161699179	222436696	Rat
1331734	Bp204	Blood pressure QTL 204	3.61192		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	168358098	223265385	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118463	226797303	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	81754530	227146641	Rat
10755499	Bp389	Blood pressure QTL 389	2.61		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	18960362	228801039	Rat
1298076	Bp166	Blood pressure QTL 166		0.0009	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	136445150	202447032	Rat
152025245	Scl81	Serum cholesterol level QTL 81	3.49		blood cholesterol amount (VT:0000180)		2	122609194	206936711	Rat
70162	Bp63	Blood pressure QTL 63	5.64		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	2	169745596	214745596	Rat
1554319	Bmd2	Bone mineral density QTL 2	13.4	0.0001	lumbar vertebra area (VT:0010570)	lumbar vertebra cross-sectional area (CMO:0001689)	2	114837675	212549332	Rat
12879836	Kidm61	Kidney mass QTL 61		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	152413072	185122374	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	78665619	219826953	Rat
10043136	Iddm54	Insulin dependent diabetes mellitus QTL 54	3.4	0.0001	blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	2	143657411	190602963	Rat
12879837	Am2	Aortic mass QTL 2		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	2	152413072	185122374	Rat
12879838	Cm86	Cardiac mass QTL 86		0.002	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	152413072	185122374	Rat
1302793	Bw16	Body weight QTL 16	5	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	2	157142209	202446871	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	43154682	202446871	Rat
12879839	Cm85	Cardiac mass QTL 85		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	2	152413072	185122374	Rat
61469	Bp16	Blood pressure QTL 16	5.64		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	2	169745596	214745596	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	2	135552573	202446871	Rat
1549833	Bp257	Blood pressure QTL 257		0.003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	168354880	185122374	Rat
1358900	Bw48	Body weight QTL 48	4.88		body mass (VT:0001259)	body weight (CMO:0000012)	2	157142078	211086598	Rat
4889834	Pur24	Proteinuria QTL 24	5.8	0.014	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	2	184114274	202447032	Rat
1359030	Bp277	Blood pressure QTL 277			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	114837527	185876470	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	56043031	202447032	Rat
12879840	Bw179	Body weight QTL 179		0.005	body mass (VT:0001259)	body weight (CMO:0000012)	2	152413072	185122374	Rat
1581502	Esta3	Estrogen-induced thymic atrophy QTL 3			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	2	136916935	189599348	Rat
9589044	Scfw1	Subcutaneous fat weight QTL 1	5.8	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	2	182171407	227171407	Rat
8694435	Bw166	Body weight QTL 166	14.08	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	2	182171407	227171407	Rat
1359032	Hrtrt18	Heart rate QTL 18			heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	2	157142078	192625452	Rat
2301966	Bp322	Blood pressure QTL 322	3.58		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	150540301	202447032	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118275	202447032	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	81689826	221035911	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
8694194	Abfw1	Abdominal fat weight QTL 1	11.7	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	2	182171407	227171407	Rat
1359022	Ppulsi1	Prepulse inhibition QTL 1	3.63		prepulse inhibition trait (VT:0003088)	acoustic startle response measurement (CMO:0001519)	2	136916935	213594495	Rat
1641891	Alcrsp17	Alcohol response QTL 17			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	249053267	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	78665619	249053267	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	76539322	202447032	Rat
2300189	Bmd48	Bone mineral density QTL 48	5.8	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	2	179335906	224335906	Rat
8662843	Vetf9	Vascular elastic tissue fragility QTL 9	2.05		thoracic aorta molecular composition trait (VT:0010568)	aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003)	2	157142078	226277316	Rat
631501	Bp101	Blood pressure QTL 101	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	150341684	202446871	Rat
2307174	Activ3	Activity QTL 3	4.83	0.000058	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	2	168594495	213594495	Rat
1331794	Bp202	Blood pressure QTL 202	3.66819		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	141194931	223265385	Rat
71113	Cari2	Carrageenan-induced inflammation QTL 2	2.7	0.009	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	2	141596551	202447032	Rat
1331805	Cm29	Cardiac mass QTL 29	3.50746		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	2	141194931	223265385	Rat
634308	Sach6	Saccharin preference QTL 6	4.9		taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	2	112456140	212696837	Rat
1598805	Memor8	Memory QTL 8	3		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	2	150341585	189039377	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
724568	Uae13	Urinary albumin excretion QTL 13	4.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	2	143157029	210020885	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1300165	Rf9	Renal function QTL 9	3.28		kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	2	133914684	202447032	Rat
738013	Alc15	Alcohol consumption QTL 15	4.1	0.00022	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	2	184165752	229165752	Rat
61401	Niddm2	Non-insulin dependent diabetes mellitus QTL 2	4.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	144599348	189599348	Rat
631507	Bp105	Blood pressure QTL 105		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	112456140	212696837	Rat
1641925	Alcrsp2	Alcohol response QTL 2			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	221167075	Rat
1354609	Niddm62	Non-insulin dependent diabetes mellitus QTL 62	4.72	0.000006	insulin secretion trait (VT:0003564)	plasma insulin level (CMO:0000342)	2	150540301	202447032	Rat
1598833	Bp295	Blood pressure QTL 295	3.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	147798556	192798556	Rat
61417	Cia10	Collagen induced arthritis QTL 10	3.4		joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	2	179946951	224946951	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	81754530	222436696	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	46123260	202447032	Rat
8694383	Bw158	Body weight QTL 158	7.69	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	2	182171407	227171407	Rat
7488927	Bp365	Blood pressure QTL 365		0.008	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	162765032	207765032	Rat
1598838	Bp290	Blood pressure QTL 290	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	166539266	211539266	Rat
7488925	Bp364	Blood pressure QTL 364		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	160564068	205564068	Rat
2306901	Bp337	Blood pressure QTL 337		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	164073756	227146641	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	74786664	206665859	Rat
2293084	Iddm26	Insulin dependent diabetes mellitus QTL 26	2.9		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	174930955	213594495	Rat

Markers in Region

RH134273

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	184,401,617 - 184,401,811 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	198,993,427 - 198,993,620	NCBI	Rnor6.0
Rnor_5.0	2	218,478,985 - 218,479,178	UniSTS	Rnor5.0
RGSC_v3.4	2	191,670,099 - 191,670,292	UniSTS	RGSC3.4
Celera	2	176,926,070 - 176,926,263	UniSTS
RH 3.4 Map	2	1245.6	UniSTS
Cytogenetic Map	2	q34	UniSTS

BF387011

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	184,394,675 - 184,394,839 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	198,986,223 - 198,986,386	NCBI	Rnor6.0
Rnor_5.0	2	218,471,781 - 218,471,944	UniSTS	Rnor5.0
RGSC_v3.4	2	191,662,708 - 191,662,871	UniSTS	RGSC3.4
Celera	2	176,919,129 - 176,919,292	UniSTS
RH 3.4 Map	2	1245.6	UniSTS
Cytogenetic Map	2	q34	UniSTS

AI267131

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	184,405,507 - 184,406,048 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	198,997,317 - 198,997,857	NCBI	Rnor6.0
Rnor_5.0	2	218,482,875 - 218,483,415	UniSTS	Rnor5.0
RGSC_v3.4	2	191,673,989 - 191,674,529	UniSTS	RGSC3.4
Celera	2	176,929,940 - 176,930,481	UniSTS
Cytogenetic Map	2	q34	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	41	73	91	90	59	25	59	6	209	88	53	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031712	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF013145	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF116896	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC078788	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474015	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000000107 ⟹ ENSRNOP00000000107

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	184,376,161 - 184,407,514 (+)	Ensembl
Rnor_6.0 Ensembl	2	198,965,685 - 198,999,323 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000091578 ⟹ ENSRNOP00000074757

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	2	198,965,711 - 198,999,318 (+)	Ensembl

RefSeq Acc Id:

NM_031712 ⟹ NP_113900

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	187,064,995 - 187,096,348 (+)	NCBI
mRatBN7.2	2	184,376,161 - 184,407,514 (+)	NCBI
Rnor_6.0	2	198,965,685 - 198,999,323 (+)	NCBI
Rnor_5.0	2	218,452,670 - 218,484,881 (+)	NCBI
RGSC_v3.4	2	191,643,593 - 191,675,995 (+)	RGD
Celera	2	176,900,642 - 176,931,947 (+)	RGD

Sequence:

show sequence

GTGAGTTCCAAGACTAGTAGTGTTCACAGCAGGGAGAATTTCTAGTGACGGAGCGGATCCTTCT
CCACAGAAATGGCCTCCACCTTCAACCCCAGAGAGTGTAAATTGTCCAAAAAAGAGGGGCAGAA
CTATGGCTTCTTCCTCCGCATTGAAAAGGACACTGACGGTCACCTGGTCCGGGTGATTGAGGAG
GGGAGCCCGGCAGAGAAGGCAGGGCTCCTAGACGGCGACAGAGTGCTCAGGATCAACGGGGTCT
TTGTTGACAAGGAAGAGCATGCACAGGTGGTGGATCTGGTCAGAAAGAGCGGGAATTCAGTGAC
CCTGCTGGTTCTGGATGGAGACTCCTATGAGAAGGCTGTAAAACATCAGGTGGACTTGAAAGAA
CTGGATCAAAGCCCAAGGGAGCCAGCTCTGAATGAAAAGAAACCCGACCTTGGGATGAATGGAG
GGGTGGAGACGTGTGCCCAGCCACGGCTCTGCTACCTGGTGAAGGAGGGCAACAGCTTTGGCTT
CTCTCTGAAAACTATCCAAGGTAAAAAGGGCGTGTTCCTGACTGATATAACACCTCAGGGCGTG
GCCATGAAAGCTGGTGTTCTGGCTGATGATCACTTGATTGAAGTGAATGGAGAAAATGTAGAAA
ACGCCAGTCATGAGGAAGTGGTGGAAAAGGTGACAAAGTCAGGAAGCCGTATCATGTTCCTCCT
TGTGGACAAAGAAACTGCCAGGTGCCATAGTGAGCAGAAAACACCGTTCAAGAGGGAGACAGCC
AGTTTGAAACTGCTGCCCCACCAGCCCCGGGTAGTAGTGATCAAGAAGGGCAGCAATGGCTACG
GTTTCTATCTGAGGGCGGGCCCTGAACAGAAAGGTCAAATCATCAAGGACATAGAACCTGGAAG
CCCAGCAGAGGCAGCTGGCTTGAAGAACAATGACTTGGTAGTTGCTGTCAATGGCGAGTCTGTG
GAAGCTCTTGATCATGACAGTGTGGTGGAAATGATTAGAAACGGTGGAGACCAGACTACTCTGT
TGGTGCTGGACAAGGAGGCAGACAGAATCTATAGCCTGGCTCGTTTCTCTCCACTTCTCTACTG
CCAAAGTCAAGAACTGCCTAATGGTTCTGTGAAGGAAGCCCCAGCTCCCATCTCTGCTCCTCTG
GAGGCCCCAGGCTCAGCTACCACAGAGGACGTGGGGGATCATAAACCCAAGCTCTGCAGGCTGA
TTAAAGAGGACGACAGCTACGGCTTTCACCTGAACGCCATTCGGGGCCAGCCAGGCTCCTTTGT
CAAGGAGGTACAGCAGGGTGGCCCTGCTGACAAGGCAGGGCTGGAGAATGAGGACATCATCATT
GAAGTGAATGGGGAGAATGTGCAAGATGAACCCTATGACAGAGTGGTGGAGAGAATCAAGAGCA
GCGGGGAGCACGTCACTCTGTTGGTCTGTGGAAAGGTGGCCTACAGCTATTTTCAAGCTAAGAA
AATCCCCATCCTTTCTTCCTTGGCTGACCCCCTGGTGGCTGGTCCTGATGAAAAAGGAGAGACT
GAGCATGACTCAGCAGAGTCCACGAAAGACTCCTCCCACCCAGCAAGAGACCGAACTCTCAGCG
CAGCCTCCCACTCTTCTTCCAACTCTGAAGACACGGTGATGTGAAGAGAACAAACGACGTTTCC
CCTCATGGTCCGAGGAAGGAGCCCCTCGGACCCTGCCAGACCTCCTCAGAACCATCAGTCCCTG
ACCGAAACTGCGGACTGTCTGTCTGTCTGTCTGCTGCTGTAAGGGCTGCTACTGCAGGCTGCTT
ATTTATGCTCAGCTTAGCTGGAGGGAGGGCCGGGTTCCGGTTCTTTCTATGTGGTATCTTCCAA
CGTGCAACTTTTCACTTCTGTTGATGAAACTTTGATGAAACGTCTTACTTCTGTGGGCTTGAGC
ACTGGGATGATTCATTTGTGTCTTGTGAGTGATGATGATTAAAGTACCCAGCAGACCTTTAAAA
AAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_113900	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB66880	(Get FASTA)	NCBI Sequence Viewer
	AAF74985	(Get FASTA)	NCBI Sequence Viewer
	AAH78788	(Get FASTA)	NCBI Sequence Viewer
	EDL85601	(Get FASTA)	NCBI Sequence Viewer
	EDL85602	(Get FASTA)	NCBI Sequence Viewer
	EDL85603	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000000107.5
GenBank Protein	Q9JJ40	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_113900 ⟸ NM_031712

- UniProtKB:

Q6AZ21 (UniProtKB/Swiss-Prot), O35234 (UniProtKB/Swiss-Prot), Q9JJ40 (UniProtKB/Swiss-Prot), A6K399 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MASTFNPRECKLSKKEGQNYGFFLRIEKDTDGHLVRVIEEGSPAEKAGLLDGDRVLRINGVFVD
KEEHAQVVDLVRKSGNSVTLLVLDGDSYEKAVKHQVDLKELDQSPREPALNEKKPDLGMNGGVE
TCAQPRLCYLVKEGNSFGFSLKTIQGKKGVFLTDITPQGVAMKAGVLADDHLIEVNGENVENAS
HEEVVEKVTKSGSRIMFLLVDKETARCHSEQKTPFKRETASLKLLPHQPRVVVIKKGSNGYGFY
LRAGPEQKGQIIKDIEPGSPAEAAGLKNNDLVVAVNGESVEALDHDSVVEMIRNGGDQTTLLVL
DKEADRIYSLARFSPLLYCQSQELPNGSVKEAPAPISAPLEAPGSATTEDVGDHKPKLCRLIKE
DDSYGFHLNAIRGQPGSFVKEVQQGGPADKAGLENEDIIIEVNGENVQDEPYDRVVERIKSSGE
HVTLLVCGKVAYSYFQAKKIPILSSLADPLVAGPDEKGETEHDSAESTKDSSHPARDRTLSAAS
HSSSNSEDTVM

hide sequence

Ensembl Acc Id:

ENSRNOP00000000107 ⟸ ENSRNOT00000000107

Ensembl Acc Id:

ENSRNOP00000074757 ⟸ ENSRNOT00000091578

Protein Domains

PDZ

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9JJ40-F1-model_v2	AlphaFold	Q9JJ40	1-523	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13691591

Promoter ID:

EPDNEW_R2115

Type:

initiation region

Name:

Pdzk1_1

Description:

PDZ domain containing 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	2	198,965,703 - 198,965,763	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:70924	AgrOrtholog
BioCyc Gene	G2FUF-51957	BioCyc
Ensembl Genes	ENSRNOG00000000096	Ensembl, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000000107.7	UniProtKB/Swiss-Prot
Gene3D-CATH	2.30.42.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7109724	IMAGE-MGC_LOAD
InterPro	NHER	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PDZ	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PDZ_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:65144	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:93341	IMAGE-MGC_LOAD
NCBI Gene	65144	ENTREZGENE
PANTHER	NA(+)_H(+) EXCHANGE REGULATORY COFACTOR NHE-RF3-RELATED	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PDZ DOMAIN CONTAINING PROTEIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	PDZ	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Pdzk1	PhenoGen
PROSITE	PDZ	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000000096	RatGTEx
SMART	PDZ	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	PDZ domain-like	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
UniProt	A6K399	ENTREZGENE, UniProtKB/TrEMBL
	NHRF3_RAT	UniProtKB/Swiss-Prot
	O35234	ENTREZGENE
	Q6AZ21	ENTREZGENE
	Q9JJ40	ENTREZGENE
UniProt Secondary	O35234	UniProtKB/Swiss-Prot
	Q6AZ21	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2002-07-09	Pdzk1	PDZ domain containing 1			Symbol and Name updated to reflect Human and Mouse nomenclature	70877	APPROVED

RGD Curation Notes

Note Type	Note	Reference

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD