Symbol:
Cit
Name:
citron rho-interacting serine/threonine kinase
RGD ID:
70878
Description:
Enables scaffold protein binding activity. Involved in several processes, including G2/M transition of mitotic cell cycle; gamma-aminobutyric acid signaling pathway; and postsynapse organization. Located in several cellular components, including GABA-ergic synapse; cleavage furrow; and postsynaptic density. Used to study epilepsy and microcephaly. Biomarker of traumatic brain injury. Human ortholog(s) of this gene implicated in primary autosomal recessive microcephaly 17 and primary microcephaly. Orthologous to human CIT (citron rho-interacting serine/threonine kinase); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; acetamide; ammonium chloride.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
citron; citron (rho-interacting, serine/threonine kinase 21); citron kinase; citron Rho-interacting kinase; citron-K; citron-K kinase; CRIK; LOC288698; postsynaptic density protein (citron); rho-interacting, serine/threonine-protein kinase 21
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Allele / Splice:
CitfhJjlo
Genetic Models:
WI-CitfhJjlo /Rrrc
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 46,263,881 - 46,425,642 (-) NCBI GRCr8 mRatBN7.2 12 40,603,073 - 40,764,846 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 40,605,563 - 40,763,860 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 41,778,820 - 41,938,342 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 42,392,543 - 42,552,063 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 41,453,005 - 41,612,527 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 46,334,669 - 46,494,152 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 46,334,665 - 46,494,174 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 48,136,329 - 48,295,119 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 41,858,134 - 42,019,601 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 41,721,050 - 41,801,648 (-) NCBI Celera 12 42,234,665 - 42,392,523 (-) NCBI Celera Cytogenetic Map 12 q16 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Cit Rat 1,2-dimethylhydrazine increases expression ISO Cit (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of CIT mRNA CTD PMID:22206623 Cit Rat 17beta-estradiol increases expression ISO Cit (Mus musculus) 6480464 Estradiol results in increased expression of CIT mRNA CTD PMID:25210133 Cit Rat 17beta-estradiol multiple interactions ISO Cit (Mus musculus) 6480464 ESR1 protein promotes the reaction [Estradiol results in increased expression of CIT mRNA] CTD PMID:25210133 Cit Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Cit (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of CIT mRNA CTD PMID:21570461 Cit Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of CIT mRNA CTD PMID:33387578 Cit Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO CIT (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of CIT mRNA CTD PMID:22574217 Cit Rat 3,4-methylenedioxymethamphetamine increases expression ISO Cit (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of CIT mRNA CTD PMID:20188158 and PMID:26251327 Cit Rat 4,4'-diaminodiphenylmethane increases expression ISO Cit (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of CIT mRNA CTD PMID:18648102 Cit Rat 4,4'-sulfonyldiphenol decreases methylation ISO Cit (Mus musculus) 6480464 bisphenol S results in decreased methylation of CIT exon CTD PMID:33297965 Cit Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of CIT mRNA CTD PMID:31881176 Cit Rat aflatoxin B1 affects expression ISO CIT (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of CIT protein CTD PMID:20106945 Cit Rat aflatoxin B1 increases methylation ISO CIT (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of CIT intron CTD PMID:30157460 Cit Rat Aflatoxin B2 alpha decreases methylation ISO CIT (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of CIT intron CTD PMID:30157460 Cit Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of CIT mRNA CTD PMID:16483693 Cit Rat arsane affects methylation ISO CIT (Homo sapiens) 6480464 Arsenic affects the methylation of CIT gene CTD PMID:25304211 Cit Rat arsenic atom affects methylation ISO CIT (Homo sapiens) 6480464 Arsenic affects the methylation of CIT gene CTD PMID:25304211 Cit Rat arsenite(3-) decreases expression ISO Cit (Mus musculus) 6480464 arsenite results in decreased expression of CIT mRNA CTD PMID:18929588 Cit Rat arsenite(3-) multiple interactions ISO CIT (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to CIT mRNA] CTD PMID:32406909 Cit Rat atrazine decreases expression ISO Cit (Mus musculus) 6480464 Atrazine results in decreased expression of CIT mRNA CTD PMID:27655631 Cit Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of CIT gene CTD PMID:28931070 Cit Rat azathioprine decreases expression ISO CIT (Homo sapiens) 6480464 Azathioprine results in decreased expression of CIT mRNA CTD PMID:22623647 Cit Rat benzo[a]pyrene increases expression ISO Cit (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of CIT mRNA CTD PMID:20504355 Cit Rat benzo[a]pyrene decreases expression ISO CIT (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of CIT mRNA CTD PMID:20064835 more ... Cit Rat benzo[a]pyrene diol epoxide I decreases expression ISO CIT (Homo sapiens) 6480464 7 more ... CTD PMID:20382639 Cit Rat benzo[e]pyrene increases methylation ISO CIT (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of CIT intron CTD PMID:30157460 Cit Rat bis(2-ethylhexyl) phthalate increases expression ISO Cit (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of CIT mRNA CTD PMID:34319233 Cit Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CIT mRNA CTD PMID:25181051 more ... Cit Rat bisphenol A decreases expression ISO Cit (Mus musculus) 6480464 bisphenol A results in decreased expression of CIT mRNA CTD PMID:38074096 Cit Rat bisphenol A decreases methylation ISO CIT (Homo sapiens) 6480464 bisphenol A results in decreased methylation of CIT gene CTD PMID:31601247 Cit Rat bisphenol A decreases methylation ISO Cit (Mus musculus) 6480464 bisphenol A results in decreased methylation of CIT promoter CTD PMID:27312807 Cit Rat bisphenol A increases methylation ISO Cit (Mus musculus) 6480464 bisphenol A results in increased methylation of CIT promoter CTD PMID:27312807 Cit Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of CIT protein CTD PMID:24552547 Cit Rat Bisphenol A diglycidyl ether affects splicing ISO Cit (Mus musculus) 6480464 bisphenol A diglycidyl ether affects the splicing of CIT mRNA CTD PMID:36464114 Cit Rat bisphenol AF affects splicing ISO Cit (Mus musculus) 6480464 bisphenol AF affects the splicing of CIT mRNA CTD PMID:36464114 Cit Rat butanal decreases expression ISO CIT (Homo sapiens) 6480464 butyraldehyde results in decreased expression of CIT mRNA CTD PMID:26079696 Cit Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of CIT mRNA CTD PMID:19167457 Cit Rat cadmium atom decreases expression ISO CIT (Homo sapiens) 6480464 Cadmium results in decreased expression of CIT mRNA CTD PMID:24376830 Cit Rat calcitriol decreases expression ISO CIT (Homo sapiens) 6480464 Calcitriol results in decreased expression of CIT mRNA CTD PMID:21592394 Cit Rat calcitriol multiple interactions ISO CIT (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of CIT mRNA CTD PMID:21592394 Cit Rat chromium(6+) multiple interactions ISO CIT (Homo sapiens) 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in decreased expression of CIT mRNA CTD PMID:38479592 Cit Rat cobalt dichloride decreases expression ISO CIT (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of CIT mRNA CTD PMID:19320972 Cit Rat copper atom multiple interactions ISO CIT (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of CIT mRNA CTD PMID:20971185 Cit Rat copper(0) multiple interactions ISO CIT (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of CIT mRNA CTD PMID:20971185 Cit Rat coumarin decreases phosphorylation ISO CIT (Homo sapiens) 6480464 coumarin results in decreased phosphorylation of CIT protein CTD PMID:35688186 Cit Rat coumestrol multiple interactions ISO CIT (Homo sapiens) 6480464 [Coumestrol co-treated with resveratrol] results in increased expression of CIT mRNA CTD PMID:19167446 Cit Rat CU-O LINKAGE decreases expression ISO CIT (Homo sapiens) 6480464 cupric oxide results in decreased expression of CIT mRNA CTD PMID:22077320 Cit Rat cyclosporin A decreases expression ISO CIT (Homo sapiens) 6480464 Cyclosporine results in decreased expression of CIT mRNA CTD PMID:21632981 and PMID:25562108 Cit Rat diallyl trisulfide decreases expression ISO CIT (Homo sapiens) 6480464 diallyl trisulfide results in decreased expression of CIT mRNA CTD PMID:34995734 Cit Rat dicrotophos increases expression ISO CIT (Homo sapiens) 6480464 dicrotophos results in increased expression of CIT mRNA CTD PMID:28302478 Cit Rat dieldrin affects expression EXP 6480464 Dieldrin affects the expression of CIT mRNA CTD PMID:22546817 Cit Rat dorsomorphin multiple interactions ISO CIT (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Cit Rat doxorubicin decreases expression ISO CIT (Homo sapiens) 6480464 Doxorubicin results in decreased expression of CIT mRNA CTD PMID:30031762 Cit Rat epoxiconazole increases expression ISO Cit (Mus musculus) 6480464 epoxiconazole results in increased expression of CIT mRNA CTD PMID:35436446 Cit Rat ethanol increases expression ISO Cit (Mus musculus) 6480464 Ethanol results in increased expression of CIT mRNA CTD PMID:30319688 Cit Rat ethanol affects splicing ISO Cit (Mus musculus) 6480464 Ethanol affects the splicing of CIT mRNA CTD PMID:30319688 Cit Rat ethanol affects expression ISO Cit (Mus musculus) 6480464 Ethanol affects the expression of CIT mRNA CTD PMID:30319688 Cit Rat folic acid multiple interactions ISO CIT (Homo sapiens) 6480464 [Folic Acid deficiency co-treated with Methotrexate] results in decreased expression of CIT mRNA CTD PMID:24657277 Cit Rat FR900359 decreases phosphorylation ISO CIT (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of CIT protein CTD PMID:37730182 Cit Rat furan increases methylation EXP 6480464 furan results in increased methylation of CIT gene CTD PMID:22079235 Cit Rat genistein affects expression ISO CIT (Homo sapiens) 6480464 Genistein affects the expression of CIT mRNA CTD PMID:18847459 Cit Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of CIT mRNA CTD PMID:33387578 Cit Rat geraniol decreases expression ISO CIT (Homo sapiens) 6480464 geraniol results in decreased expression of CIT mRNA CTD PMID:27683099 Cit Rat glyphosate increases methylation EXP 6480464 Glyphosate results in increased methylation of CIT gene CTD PMID:31011160 Cit Rat ivermectin decreases expression ISO CIT (Homo sapiens) 6480464 Ivermectin results in decreased expression of CIT protein CTD PMID:32959892 Cit Rat L-ascorbic acid multiple interactions ISO CIT (Homo sapiens) 6480464 [Quercetin co-treated with Ascorbic Acid] results in increased expression of CIT mRNA CTD PMID:17639512 Cit Rat leflunomide decreases expression ISO CIT (Homo sapiens) 6480464 leflunomide results in decreased expression of CIT mRNA CTD PMID:28988120 Cit Rat lucanthone decreases expression ISO CIT (Homo sapiens) 6480464 Lucanthone results in decreased expression of CIT mRNA CTD PMID:21148553 Cit Rat methapyrilene increases methylation ISO CIT (Homo sapiens) 6480464 Methapyrilene results in increased methylation of CIT intron CTD PMID:30157460 Cit Rat methotrexate multiple interactions ISO CIT (Homo sapiens) 6480464 [Folic Acid deficiency co-treated with Methotrexate] results in decreased expression of CIT mRNA CTD PMID:24657277 Cit Rat methotrexate decreases expression ISO CIT (Homo sapiens) 6480464 Methotrexate results in decreased expression of CIT mRNA CTD PMID:24657277 Cit Rat methotrexate increases expression ISO CIT (Homo sapiens) 6480464 Methotrexate results in increased expression of CIT protein CTD PMID:24736981 Cit Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of CIT gene CTD PMID:35440735 Cit Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of CIT gene CTD PMID:33148267 Cit Rat N-Nitrosopyrrolidine decreases expression ISO CIT (Homo sapiens) 6480464 N-Nitrosopyrrolidine results in decreased expression of CIT mRNA CTD PMID:32234424 Cit Rat nickel dichloride affects expression EXP 6480464 nickel chloride affects the expression of CIT mRNA CTD PMID:22546817 Cit Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of CIT mRNA CTD PMID:25729387 Cit Rat oxaliplatin decreases expression EXP 6480464 oxaliplatin results in decreased expression of CIT mRNA CTD PMID:25729387 Cit Rat ozone multiple interactions ISO Cit (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of CIT mRNA and [Air Pollutants results in increased abundance of Ozone] which results in increased expression of CIT mRNA CTD PMID:34911549 Cit Rat paracetamol increases expression ISO CIT (Homo sapiens) 6480464 Acetaminophen results in increased expression of CIT mRNA CTD PMID:22230336 Cit Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of CIT mRNA CTD PMID:33387578 Cit Rat paracetamol decreases expression ISO CIT (Homo sapiens) 6480464 Acetaminophen results in decreased expression of CIT mRNA CTD PMID:29067470 Cit Rat pentachlorophenol increases expression ISO Cit (Mus musculus) 6480464 Pentachlorophenol results in increased expression of CIT mRNA CTD PMID:23892564 Cit Rat pentanal decreases expression ISO CIT (Homo sapiens) 6480464 pentanal results in decreased expression of CIT mRNA CTD PMID:26079696 Cit Rat perfluorooctanoic acid decreases expression ISO CIT (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of CIT mRNA CTD PMID:36326898 Cit Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of CIT gene CTD PMID:33148267 Cit Rat phenylmercury acetate decreases expression ISO CIT (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of CIT mRNA CTD PMID:26272509 Cit Rat phenylmercury acetate multiple interactions ISO CIT (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of CIT mRNA CTD PMID:27188386 Cit Rat propanal decreases expression ISO CIT (Homo sapiens) 6480464 propionaldehyde results in decreased expression of CIT mRNA CTD PMID:26079696 Cit Rat quercetin multiple interactions ISO CIT (Homo sapiens) 6480464 [Quercetin co-treated with Ascorbic Acid] results in increased expression of CIT mRNA CTD PMID:17639512 Cit Rat resveratrol multiple interactions ISO CIT (Homo sapiens) 6480464 [Coumestrol co-treated with resveratrol] results in increased expression of CIT mRNA CTD PMID:19167446 Cit Rat resveratrol decreases expression ISO CIT (Homo sapiens) 6480464 resveratrol results in decreased expression of CIT protein CTD PMID:18089832 Cit Rat rotenone decreases expression ISO CIT (Homo sapiens) 6480464 Rotenone results in decreased expression of CIT mRNA CTD PMID:29955902 Cit Rat SB 431542 multiple interactions ISO CIT (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Cit Rat silver atom decreases expression ISO Cit (Mus musculus) 6480464 Silver results in decreased expression of CIT mRNA CTD PMID:27131904 Cit Rat silver(0) decreases expression ISO Cit (Mus musculus) 6480464 Silver results in decreased expression of CIT mRNA CTD PMID:27131904 Cit Rat sodium arsenite increases expression ISO Cit (Mus musculus) 6480464 sodium arsenite results in increased expression of CIT mRNA CTD PMID:16014739 Cit Rat sodium arsenite increases expression ISO CIT (Homo sapiens) 6480464 sodium arsenite results in increased expression of CIT mRNA CTD PMID:29301061 Cit Rat T-2 toxin decreases expression ISO CIT (Homo sapiens) 6480464 T-2 Toxin results in decreased expression of CIT mRNA CTD PMID:34581912 Cit Rat testosterone multiple interactions ISO CIT (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of CIT mRNA CTD PMID:21592394 Cit Rat testosterone decreases expression ISO CIT (Homo sapiens) 6480464 Testosterone results in decreased expression of CIT mRNA CTD PMID:21592394 Cit Rat thiram decreases expression ISO CIT (Homo sapiens) 6480464 Thiram results in decreased expression of CIT mRNA CTD PMID:38568856 Cit Rat titanium dioxide increases expression ISO Cit (Mus musculus) 6480464 titanium dioxide results in increased expression of CIT mRNA CTD PMID:29264374 Cit Rat titanium dioxide decreases methylation ISO CIT (Homo sapiens) 6480464 titanium dioxide results in decreased methylation of CIT gene CTD PMID:34973136 Cit Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of CIT mRNA CTD PMID:25729387 Cit Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of CIT mRNA CTD PMID:25729387 Cit Rat trimellitic anhydride increases expression ISO Cit (Mus musculus) 6480464 trimellitic anhydride results in increased expression of CIT mRNA CTD PMID:19042947 Cit Rat triphenyl phosphate affects expression ISO CIT (Homo sapiens) 6480464 triphenyl phosphate affects the expression of CIT mRNA CTD PMID:37042841 Cit Rat triptonide affects expression ISO Cit (Mus musculus) 6480464 triptonide affects the expression of CIT mRNA CTD PMID:33045310 Cit Rat troglitazone decreases expression ISO CIT (Homo sapiens) 6480464 troglitazone results in decreased expression of CIT mRNA CTD PMID:19140230 Cit Rat trovafloxacin decreases expression ISO Cit (Mus musculus) 6480464 trovafloxacin results in decreased expression of CIT mRNA CTD PMID:35537566 Cit Rat valproic acid increases methylation ISO CIT (Homo sapiens) 6480464 Valproic Acid results in increased methylation of CIT gene CTD PMID:29154799 Cit Rat valproic acid multiple interactions ISO CIT (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of CIT mRNA CTD PMID:27188386 Cit Rat valproic acid decreases expression ISO CIT (Homo sapiens) 6480464 Valproic Acid results in decreased expression of CIT mRNA CTD PMID:23179753 more ... Cit Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of CIT mRNA CTD PMID:19015723 Cit Rat xylitol increases expression ISO CIT (Homo sapiens) 6480464 Xylitol results in increased expression of CIT mRNA CTD PMID:32275922
1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) acetamide (EXP) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) ammonium chloride (EXP) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) atrazine (EXP,ISO) azathioprine (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) benzo[e]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) Bisphenol A diglycidyl ether (ISO) bisphenol AF (ISO) butanal (ISO) C60 fullerene (EXP) cadmium atom (ISO) calcitriol (ISO) chromium(6+) (ISO) cobalt dichloride (ISO) copper atom (ISO) copper(0) (ISO) coumarin (ISO) coumestrol (ISO) CU-O LINKAGE (ISO) cyclosporin A (ISO) diallyl trisulfide (ISO) dicrotophos (ISO) dieldrin (EXP) dorsomorphin (ISO) doxorubicin (ISO) epoxiconazole (ISO) ethanol (ISO) folic acid (ISO) FR900359 (ISO) furan (EXP) genistein (ISO) gentamycin (EXP) geraniol (ISO) glyphosate (EXP) ivermectin (ISO) L-ascorbic acid (ISO) leflunomide (ISO) lucanthone (ISO) methapyrilene (ISO) methotrexate (ISO) methoxychlor (EXP) N,N-diethyl-m-toluamide (EXP) N-Nitrosopyrrolidine (ISO) nickel dichloride (EXP) oxaliplatin (EXP) ozone (ISO) paracetamol (EXP,ISO) pentachlorophenol (ISO) pentanal (ISO) perfluorooctanoic acid (ISO) permethrin (EXP) phenylmercury acetate (ISO) propanal (ISO) quercetin (ISO) resveratrol (ISO) rotenone (ISO) SB 431542 (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) T-2 toxin (ISO) testosterone (ISO) thiram (ISO) titanium dioxide (ISO) topotecan (EXP) trimellitic anhydride (ISO) triphenyl phosphate (ISO) triptonide (ISO) troglitazone (ISO) trovafloxacin (ISO) valproic acid (ISO) vinclozolin (EXP) xylitol (ISO)
1.
CIT, a gene involved in neurogenic cytokinesis, is mutated in human primary microcephaly.
Basit S, etal., Hum Genet. 2016 Oct;135(10):1199-207. doi: 10.1007/s00439-016-1724-0. Epub 2016 Aug 12.
2.
Citron-N is a neuronal Rho-associated protein involved in Golgi organization through actin cytoskeleton regulation.
Camera P, etal., Nat Cell Biol 2003 Dec;5(12):1071-8. Epub 2003 Nov 2.
3.
Defective neurogenesis in citron kinase knockout mice by altered cytokinesis and massive apoptosis.
Di Cunto F, etal., Neuron 2000 Oct;28(1):115-27.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
Citron Kinase Is a Cell Cycle-dependent, Nuclear Protein Required for G2/M Transition of Hepatocytes.
Liu H, etal., J Biol Chem 2003 Jan 24;278(4):2541-2548.
6.
Citron kinase is a cell cycle-dependent, nuclear protein required for G2/M transition of hepatocytes.
Liu H, etal., J Biol Chem 2003 Jan 24;278(4):2541-8.
7.
Gene Data Set
MGD Curation, June 12, 2002
8.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
9.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
10.
ASPM and citron kinase co-localize to the midbody ring during cytokinesis.
Paramasivam M, etal., Cell Cycle. 2007 Jul 1;6(13):1605-12. Epub 2007 Apr 27.
11.
Traumatic brain injury-induced acute gene expression changes in rat cerebral cortex identified by GeneChip analysis.
Raghavendra Rao VL, etal., J Neurosci Res. 2003 Jan 15;71(2):208-19.
12.
GOA pipeline
RGD automated data pipeline
13.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
14.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
15.
Information Derived from GenBank Report
RGD, Sept. 2003
16.
Characterization of seizures in the flathead rat: a new genetic model of epilepsy in early postnatal development.
Sarkisian MR, etal., Epilepsia. 1999 Apr;40(4):394-400.
17.
Citron-kinase, a protein essential to cytokinesis in neuronal progenitors, is deleted in the flathead mutant rat.
Sarkisian MR, etal., J Neurosci. 2002 Apr 15;22(8):RC217. Epub 2002 Apr 2.
18.
Mutations in CIT, encoding citron rho-interacting serine/threonine kinase, cause severe primary microcephaly in humans.
Shaheen R, etal., Hum Genet. 2016 Oct;135(10):1191-7. doi: 10.1007/s00439-016-1722-2. Epub 2016 Aug 8.
19.
Citron binds to PSD-95 at glutamatergic synapses on inhibitory neurons in the hippocampus.
Zhang W, etal., J Neurosci 1999 Jan 1;19(1):96-108.
Cit Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 46,263,881 - 46,425,642 (-) NCBI GRCr8 mRatBN7.2 12 40,603,073 - 40,764,846 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 40,605,563 - 40,763,860 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 41,778,820 - 41,938,342 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 42,392,543 - 42,552,063 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 41,453,005 - 41,612,527 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 46,334,669 - 46,494,152 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 46,334,665 - 46,494,174 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 48,136,329 - 48,295,119 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 41,858,134 - 42,019,601 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 41,721,050 - 41,801,648 (-) NCBI Celera 12 42,234,665 - 42,392,523 (-) NCBI Celera Cytogenetic Map 12 q16 NCBI
CIT Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 119,685,791 - 119,877,320 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 119,685,791 - 119,877,320 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 120,123,596 - 120,315,124 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 118,607,981 - 118,799,475 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 118,586,317 - 118,777,812 NCBI Celera 12 119,756,651 - 119,948,207 (-) NCBI Celera Cytogenetic Map 12 q24.23 NCBI HuRef 12 117,131,727 - 117,325,161 (-) NCBI HuRef CHM1_1 12 120,091,103 - 120,282,752 (-) NCBI CHM1_1 T2T-CHM13v2.0 12 119,673,075 - 119,864,647 (-) NCBI T2T-CHM13v2.0
Cit Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 115,983,284 - 116,147,012 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 115,983,337 - 116,147,006 (+) Ensembl GRCm39 Ensembl GRCm38 5 115,845,224 - 116,008,953 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 115,845,278 - 116,008,947 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 116,295,665 - 116,456,352 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 116,106,655 - 116,267,342 (+) NCBI MGSCv36 mm8 Celera 5 112,946,512 - 113,107,010 (+) NCBI Celera Cytogenetic Map 5 F NCBI cM Map 5 56.1 NCBI
Cit Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955455 11,704,964 - 11,872,419 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955455 11,705,015 - 11,871,762 (+) NCBI ChiLan1.0 ChiLan1.0
CIT Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 127,751,423 - 127,942,873 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 127,747,802 - 127,939,251 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 117,264,627 - 117,456,069 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 120,641,747 - 120,832,511 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 120,641,747 - 120,832,511 (-) Ensembl panpan1.1 panPan2
CIT Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 26 15,721,500 - 15,885,133 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 26 15,723,690 - 15,884,343 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 26 15,726,097 - 15,891,228 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 26 15,988,829 - 16,154,093 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 26 15,989,170 - 16,153,050 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 26 15,958,883 - 16,123,644 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 26 16,027,058 - 16,192,182 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 26 16,068,008 - 16,233,213 (-) NCBI UU_Cfam_GSD_1.0
Cit Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 146,492,141 - 146,649,860 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936668 991,036 - 1,146,294 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936668 991,043 - 1,146,578 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CIT Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 33,009,877 - 33,196,286 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 33,009,828 - 33,195,985 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 14 34,987,299 - 35,141,860 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CIT Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 11 115,026,809 - 115,220,558 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 11 115,025,045 - 115,219,356 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 129,885,578 - 130,080,578 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Cit
.
Assembly: mRatBN7.2 Assembly: RGSC_v3.4 Assembly: Rnor_5.0 Assembly: Rnor_6.0
Predicted Target Of
Count of predictions: 173 Count of miRNA genes: 113 Interacting mature miRNAs: 124 Transcripts: ENSRNOT00000041281, ENSRNOT00000057036 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
631560 Apr1 Acute phase response QTL 1 6.1 orosomucoid 1 amount (VT:0010541) plasma orosomucoid 1 level (CMO:0001467) 12 19144362 46669029 Rat 8552964 Pigfal17 Plasma insulin-like growth factor 1 level QTL 17 3.5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 8693635 Alc28 Alcohol consumption QTL 28 2.7 0.439 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 12 23081340 44726024 Rat 7411641 Foco19 Food consumption QTL 19 27.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 7411643 Foco20 Food consumption QTL 20 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 20328819 46669029 Rat 61324 Eae5 Experimental allergic encephalomyelitis QTL 5 14 nervous system integrity trait (VT:0010566) percentage of study population developing relapsing-remitting experimental autoimmune encephalomyelitis during a period of time (CMO:0001402) 12 19610870 46669029 Rat 5684888 Pia42 Pristane induced arthritis QTL 42 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 19610870 42828880 Rat 1549912 Bp268 Blood pressure QTL 268 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 13182736 46669029 Rat 2302060 Pia37 Pristane induced arthritis QTL 37 6.1 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 13198157 46669029 Rat 9590147 Scort7 Serum corticosterone level QTL 7 13.61 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 12 1 42110980 Rat 1641928 Alcrsp5 Alcohol response QTL 5 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 12 12812385 46669029 Rat 1300162 Bp188 Blood pressure QTL 188 3.19 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 32103174 45899022 Rat 8552912 Pigfal6 Plasma insulin-like growth factor 1 level QTL 6 5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564498 46669029 Rat 1549829 Scl48 Serum cholesterol level QTL 48 5 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 12 9603277 46669029 Rat 10059594 Kidm46 Kidney mass QTL 46 3.79 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 12 6107579 46669029 Rat 9590086 Insglur6 Insulin/glucose ratio QTL 6 18.97 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 12 1 42110980 Rat 8552918 Pigfal7 Plasma insulin-like growth factor 1 level QTL 7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 1549902 Bp269 Blood pressure QTL 269 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 13182736 46669029 Rat 1600386 Calcic2 Intracellular calcium level QTL 2 0.001 platelet physiology trait (VT:0005464) platelet intracellular calcium level (CMO:0000922) 12 28064433 46669029 Rat 1302792 Scl21 Serum cholesterol level QTL 21 3.8 0.0011 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 12 7196730 46669029 Rat 61404 Bw120 Body weight QTL 120 5.1 body mass (VT:0001259) body mass index (BMI) (CMO:0000105) 12 12351619 46669029 Rat 1300175 Cm5 Cardiac mass QTL 5 3.78 heart mass (VT:0007028) heart left ventricle weight to body weight ratio (CMO:0000530) 12 28064433 45899022 Rat 8693658 Alc33 Alcohol consumption QTL 33 2.1 0.68 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 12 23081340 43551788 Rat 2293699 Bss49 Bone structure and strength QTL 49 5.61 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 12 10474137 46669029 Rat 1331761 Bp218 Blood pressure QTL 218 2.973 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 12 11073825 45055165 Rat 634351 Apr5 Acute phase response QTL 5 6.7 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 12 1 44503507 Rat 8694179 Bw150 Body weight QTL 150 2.9 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 634350 Apr4 Acute phase response QTL 4 6 orosomucoid 1 amount (VT:0010541) plasma orosomucoid 1 level (CMO:0001467) 12 1172005 46172005 Rat 7411545 Bw128 Body weight QTL 128 5.2 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 7411547 Bw129 Body weight QTL 129 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 6 5564495 46669029 Rat 737979 Pia22 Pristane induced arthritis QTL 22 53.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 1 44465750 Rat 2303569 Gluco44 Glucose level QTL 44 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 12812385 46669029 Rat 7411586 Foco5 Food consumption QTL 5 5.4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 2303575 Insul14 Insulin level QTL 14 4 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 12 1 42450532 Rat 7411588 Foco6 Food consumption QTL 6 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 2302042 Pia38 Pristane induced arthritis QTL 38 3.5 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 1 44503507 Rat 2300186 Bmd59 Bone mineral density QTL 59 7.1 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 12 10474137 46669029 Rat 7411595 Foco9 Food consumption QTL 9 4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 7411597 Foco10 Food consumption QTL 10 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 7411660 Foco28 Food consumption QTL 28 10.9 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat
D12Wox25
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 40,684,742 - 40,684,904 (+) MAPPER mRatBN7.2 Rnor_6.0 12 46,413,872 - 46,414,033 NCBI Rnor6.0 Rnor_5.0 12 48,215,043 - 48,215,204 UniSTS Rnor5.0 RGSC_v3.4 12 41,937,698 - 41,937,859 UniSTS RGSC3.4 Celera 12 42,313,353 - 42,313,514 UniSTS Cytogenetic Map 12 q16 UniSTS
RH131289
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 40,684,880 - 40,685,083 (+) MAPPER mRatBN7.2 Rnor_6.0 12 46,414,010 - 46,414,212 NCBI Rnor6.0 Rnor_5.0 12 48,215,181 - 48,215,383 UniSTS Rnor5.0 RGSC_v3.4 12 41,937,836 - 41,938,038 UniSTS RGSC3.4 Celera 12 42,313,491 - 42,313,693 UniSTS Cytogenetic Map 12 q16 UniSTS
G29083
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 40,641,796 - 40,641,911 (+) MAPPER mRatBN7.2 Rnor_6.0 12 46,370,930 - 46,371,044 NCBI Rnor6.0 Rnor_5.0 12 48,172,101 - 48,172,215 UniSTS Rnor5.0 RGSC_v3.4 12 41,894,755 - 41,894,869 UniSTS RGSC3.4 Celera 12 42,270,857 - 42,270,971 UniSTS Cytogenetic Map 12 q16 UniSTS
This gene Cit is modified in the following models/strains:
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000041281 ⟹ ENSRNOP00000043901
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 40,605,563 - 40,763,860 (-) Ensembl Rnor_6.0 Ensembl 12 46,334,688 - 46,414,434 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000057036 ⟹ ENSRNOP00000053869
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 40,605,563 - 40,763,860 (-) Ensembl Rnor_6.0 Ensembl 12 46,335,160 - 46,493,203 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000086716 ⟹ ENSRNOP00000069808
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 40,605,563 - 40,763,860 (-) Ensembl Rnor_6.0 Ensembl 12 46,334,665 - 46,494,174 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000118447 ⟹ ENSRNOP00000077575
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 40,605,563 - 40,763,860 (-) Ensembl
RefSeq Acc Id:
NM_001029911 ⟹ NP_001025082
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 46,266,369 - 46,424,656 (-) NCBI mRatBN7.2 12 40,605,563 - 40,763,860 (-) NCBI Rnor_6.0 12 46,335,160 - 46,493,203 (-) NCBI Rnor_5.0 12 48,136,329 - 48,295,119 (-) NCBI RGSC_v3.4 12 41,858,134 - 42,019,601 (-) RGD Celera 12 42,234,665 - 42,392,523 (-) RGD
Sequence:
CCTCCTGGTCGTGATCTCTTTAGGGAGATACGACTCTGCCAGGCCCCTCCTGCCTCAAATGTCAGTACACACTTGACTCTTTCCAATGTTCCTTCAGCGGTAGCGGAGAGATGTTGAAGTTCAAGTAT
hide sequence
RefSeq Acc Id:
XM_006249469 ⟹ XP_006249531
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 46,263,881 - 46,425,642 (-) NCBI mRatBN7.2 12 40,603,073 - 40,764,846 (-) NCBI Rnor_6.0 12 46,334,669 - 46,494,152 (-) NCBI Rnor_5.0 12 48,136,329 - 48,295,119 (-) NCBI
Sequence:
CCTTCAAACGCTGGGGCGGGAGACTCAGGGCGGAGCGGAGCGGGGACAGTCAAGGTCGGGGGTC
hide sequence
RefSeq Acc Id:
XM_006249471 ⟹ XP_006249533
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 46,263,881 - 46,425,642 (-) NCBI mRatBN7.2 12 40,603,073 - 40,764,846 (-) NCBI Rnor_6.0 12 46,334,669 - 46,494,152 (-) NCBI Rnor_5.0 12 48,136,329 - 48,295,119 (-) NCBI
Sequence:
CCTTCAAACGCTGGGGCGGGAGACTCAGGGCGGAGCGGAGCGGGGACAGTCAAGGTCGGGGGTCTGCGGAGTCGGTAGCGGAGAGATGTTGAAGTTCAAGTATGGAGTGCGGAACCCGTCCGAGGCCA
hide sequence
RefSeq Acc Id:
XM_006249472 ⟹ XP_006249534
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 46,263,881 - 46,425,642 (-) NCBI mRatBN7.2 12 40,603,073 - 40,764,846 (-) NCBI Rnor_6.0 12 46,334,669 - 46,494,152 (-) NCBI Rnor_5.0 12 48,136,329 - 48,295,119 (-) NCBI
Sequence:
CCTTCAAACGCTGGGGCGGGAGACTCAGGGCGGAGCGGAGCGGGGACAGTCAAGGTCGGGGGTC
hide sequence
RefSeq Acc Id:
XM_008769269 ⟹ XP_008767491
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 46,263,881 - 46,425,642 (-) NCBI mRatBN7.2 12 40,603,073 - 40,764,846 (-) NCBI Rnor_6.0 12 46,334,669 - 46,494,152 (-) NCBI
Sequence:
CCTTCAAACGCTGGGGCGGGAGACTCAGGGCGGAGCGGAGCGGGGACAGTCAAGGTCGGGGGTC
hide sequence
RefSeq Acc Id:
XM_039089818 ⟹ XP_038945746
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 46,263,881 - 46,425,642 (-) NCBI mRatBN7.2 12 40,603,073 - 40,764,846 (-) NCBI
RefSeq Acc Id:
XM_039089819 ⟹ XP_038945747
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 46,263,881 - 46,425,570 (-) NCBI mRatBN7.2 12 40,603,073 - 40,764,805 (-) NCBI
RefSeq Acc Id:
XM_039089820 ⟹ XP_038945748
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 46,263,881 - 46,425,642 (-) NCBI mRatBN7.2 12 40,603,073 - 40,764,846 (-) NCBI
RefSeq Acc Id:
XM_039089821 ⟹ XP_038945749
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 46,263,881 - 46,425,642 (-) NCBI mRatBN7.2 12 40,603,073 - 40,764,846 (-) NCBI
RefSeq Acc Id:
XM_039089822 ⟹ XP_038945750
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 46,263,881 - 46,425,642 (-) NCBI mRatBN7.2 12 40,603,073 - 40,764,846 (-) NCBI
RefSeq Acc Id:
XM_039089823 ⟹ XP_038945751
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 46,263,881 - 46,425,642 (-) NCBI mRatBN7.2 12 40,603,073 - 40,764,846 (-) NCBI
RefSeq Acc Id:
XM_039089824 ⟹ XP_038945752
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 46,263,881 - 46,425,642 (-) NCBI mRatBN7.2 12 40,603,073 - 40,764,846 (-) NCBI
RefSeq Acc Id:
XM_039089825 ⟹ XP_038945753
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 46,263,881 - 46,425,642 (-) NCBI mRatBN7.2 12 40,603,073 - 40,764,846 (-) NCBI
RefSeq Acc Id:
XM_039089826 ⟹ XP_038945754
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 46,263,881 - 46,425,642 (-) NCBI mRatBN7.2 12 40,603,073 - 40,764,846 (-) NCBI
RefSeq Acc Id:
XM_039089829 ⟹ XP_038945757
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 46,263,881 - 46,363,223 (-) NCBI mRatBN7.2 12 40,603,073 - 40,702,541 (-) NCBI
RefSeq Acc Id:
XM_039089830 ⟹ XP_038945758
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 46,263,881 - 46,383,983 (-) NCBI mRatBN7.2 12 40,603,073 - 40,723,296 (-) NCBI
RefSeq Acc Id:
XM_039089831 ⟹ XP_038945759
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 46,263,881 - 46,345,638 (-) NCBI mRatBN7.2 12 40,603,073 - 40,684,840 (-) NCBI
RefSeq Acc Id:
XM_039089832 ⟹ XP_038945760
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 46,263,881 - 46,345,575 (-) NCBI mRatBN7.2 12 40,603,073 - 40,684,774 (-) NCBI
RefSeq Acc Id:
XM_039089834 ⟹ XP_038945762
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 46,285,111 - 46,425,642 (-) NCBI mRatBN7.2 12 40,624,947 - 40,764,846 (-) NCBI
RefSeq Acc Id:
XM_039089835 ⟹ XP_038945763
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 46,263,881 - 46,328,704 (-) NCBI mRatBN7.2 12 40,603,073 - 40,667,924 (-) NCBI
RefSeq Acc Id:
XM_039089836 ⟹ XP_038945764
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 46,293,206 - 46,425,642 (-) NCBI mRatBN7.2 12 40,633,778 - 40,764,846 (-) NCBI
RefSeq Acc Id:
XM_063271705 ⟹ XP_063127775
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 46,263,881 - 46,425,642 (-) NCBI
RefSeq Acc Id:
XM_063271706 ⟹ XP_063127776
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 46,263,881 - 46,425,642 (-) NCBI
RefSeq Acc Id:
XM_063271707 ⟹ XP_063127777
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 46,263,881 - 46,425,642 (-) NCBI
RefSeq Acc Id:
XM_063271709 ⟹ XP_063127779
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 46,263,881 - 46,345,595 (-) NCBI
RefSeq Acc Id:
XM_063271711 ⟹ XP_063127781
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 46,263,881 - 46,345,638 (-) NCBI
RefSeq Acc Id:
XM_063271712 ⟹ XP_063127782
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 46,263,881 - 46,318,945 (-) NCBI
RefSeq Acc Id:
NP_001025082 ⟸ NM_001029911
- UniProtKB:
A0A0G2JWA9 (UniProtKB/Swiss-Prot), Q9QX19 (UniProtKB/Swiss-Prot), E9PSL7 (UniProtKB/TrEMBL), A0A8L2QNW2 (UniProtKB/TrEMBL)
- Sequence:
MLKFKYGVRNPSEASAPEPIASRASRLNLFFQGKPPLMTQQQMSALSREGVLDALFVLLEECSQPALMKIKHVSSFVRKYSDTIAELRELQPSVRDFEVRSLVGCGHFAEVQVVREKATGDVYAMKIM
hide sequence
RefSeq Acc Id:
XP_006249534 ⟸ XM_006249472
- Peptide Label:
isoform X12
- UniProtKB:
A0A0G2JWA9 (UniProtKB/Swiss-Prot), Q9QX19 (UniProtKB/Swiss-Prot), E9PSL7 (UniProtKB/TrEMBL), A0A8L2QNW2 (UniProtKB/TrEMBL)
- Sequence:
MLKFKYGVRNPSEASAPEPIASRASRLNLFFQGKPPLMTQQQMSALSREGVLDALFVLLEECSQ
hide sequence
RefSeq Acc Id:
XP_006249533 ⟸ XM_006249471
- Peptide Label:
isoform X11
- UniProtKB:
A0A8L2QQI1 (UniProtKB/TrEMBL), A0A8L2QNW2 (UniProtKB/TrEMBL)
- Sequence:
MLKFKYGVRNPSEASAPEPIASRASRLNLFFQGKPPLMTQQQMSALSREGVLDALFVLLEECSQPALMKIKHVSSFVRKYSDTIAELRELQPSVRDFEVRSLVGCGHFAEVQVVREKATGDVYAMKIM
hide sequence
RefSeq Acc Id:
XP_006249531 ⟸ XM_006249469
- Peptide Label:
isoform X7
- UniProtKB:
A0A8L2QNW2 (UniProtKB/TrEMBL)
- Sequence:
MLKFKYGVRNPSEASAPEPIASRASRLNLFFQGKPPLMTQQQMSALSREGVLDALFVLLEECSQ
hide sequence
RefSeq Acc Id:
XP_008767491 ⟸ XM_008769269
- Peptide Label:
isoform X6
- UniProtKB:
A0A8L2QNW2 (UniProtKB/TrEMBL)
- Sequence:
MLKFKYGVRNPSEASAPEPIASRASRLNLFFQGKPPLMTQQQMSALSREGVLDALFVLLEECSQPALMKIKHVSSFVRKYSDTIAELRELQPSVRDFEVRSLVGCGHFAEVQVVREKATGDVYAMKIM
hide sequence
Ensembl Acc Id:
ENSRNOP00000043901 ⟸ ENSRNOT00000041281
Ensembl Acc Id:
ENSRNOP00000053869 ⟸ ENSRNOT00000057036
Ensembl Acc Id:
ENSRNOP00000069808 ⟸ ENSRNOT00000086716
RefSeq Acc Id:
XP_038945754 ⟸ XM_039089826
- Peptide Label:
isoform X15
- UniProtKB:
A0A8L2QNW2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038945753 ⟸ XM_039089825
- Peptide Label:
isoform X14
- UniProtKB:
A0A8L2QNW2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038945752 ⟸ XM_039089824
- Peptide Label:
isoform X13
- UniProtKB:
A0A8I5YCF2 (UniProtKB/TrEMBL), A0A8L2QNW2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038945751 ⟸ XM_039089823
- Peptide Label:
isoform X10
- UniProtKB:
A0A8L2QNW2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038945749 ⟸ XM_039089821
- Peptide Label:
isoform X3
- UniProtKB:
A0A8L2QNW2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038945750 ⟸ XM_039089822
- Peptide Label:
isoform X4
- UniProtKB:
A0A8L2QNW2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038945748 ⟸ XM_039089820
- Peptide Label:
isoform X2
- UniProtKB:
A0A8L2QNW2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038945746 ⟸ XM_039089818
- Peptide Label:
isoform X1
- UniProtKB:
A0A8L2QNW2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038945747 ⟸ XM_039089819
- Peptide Label:
isoform X1
- UniProtKB:
A0A8L2QNW2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038945758 ⟸ XM_039089830
- Peptide Label:
isoform X16
RefSeq Acc Id:
XP_038945757 ⟸ XM_039089829
- Peptide Label:
isoform X16
RefSeq Acc Id:
XP_038945759 ⟸ XM_039089831
- Peptide Label:
isoform X17
RefSeq Acc Id:
XP_038945760 ⟸ XM_039089832
- Peptide Label:
isoform X18
RefSeq Acc Id:
XP_038945763 ⟸ XM_039089835
- Peptide Label:
isoform X21
RefSeq Acc Id:
XP_038945762 ⟸ XM_039089834
- Peptide Label:
isoform X20
RefSeq Acc Id:
XP_038945764 ⟸ XM_039089836
- Peptide Label:
isoform X22
Ensembl Acc Id:
ENSRNOP00000077575 ⟸ ENSRNOT00000118447
RefSeq Acc Id:
XP_063127777 ⟸ XM_063271707
- Peptide Label:
isoform X9
- UniProtKB:
A0A8L2QNW2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063127776 ⟸ XM_063271706
- Peptide Label:
isoform X8
- UniProtKB:
A0A8L2QNW2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063127775 ⟸ XM_063271705
- Peptide Label:
isoform X5
- UniProtKB:
A0A8L2QNW2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063127781 ⟸ XM_063271711
- Peptide Label:
isoform X19
RefSeq Acc Id:
XP_063127779 ⟸ XM_063271709
- Peptide Label:
isoform X18
RefSeq Acc Id:
XP_063127782 ⟸ XM_063271712
- Peptide Label:
isoform X23
- UniProtKB:
A6J1R9 (UniProtKB/TrEMBL)
RGD ID: 13698691 Promoter ID: EPDNEW_R9208 Type: multiple initiation site Name: Cit_1 Description: citron rho-interacting serine/threonine kinase SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 12 46,494,132 - 46,494,192 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2014-05-01
Cit
citron rho-interacting serine/threonine kinase
Cit
citron
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2014-04-30
Cit
citron
Cit
citron (rho-interacting, serine/threonine kinase 21)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2013-04-17
Cit
citron (rho-interacting, serine/threonine kinase 21)
LOC288698
Citron-K kinase
Data merged from RGD:735091
737654 PROVISIONAL
2012-01-09
Cit
citron (rho-interacting, serine/threonine kinase 21)
Cit
citron
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2009-11-05
Cit
citron
Cit
citron (rho-interacting, serine/threonine kinase 21)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-02-18
Cit
citron (rho-interacting, serine/threonine kinase 21)
Cit
citron
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-07-09
Cit
citron
Symbol and Name updated to reflect Human and Mouse nomenclature
70877 APPROVED
Note Type
Note
Reference
gene_cellular_localization
localized to interphase nuclei and the cytoplasm
632407
gene_cellular_localization
present in interphase nuclei dispersing into cytoplasm at prophase
628497
gene_expression
expression starts at late S and/or early G2 phase; high expression in embryonic liver and gradually decreases after birth
628497
gene_function
serine/thronine kinase
628497
gene_function
phosphorylates regultory myosin light chain (RMLC)
628497
gene_mutations_overexpression
loss of protein results in increase of G2 tetraploid nuclei in one week old rat
628497
gene_process
cell cycle dependent protein regulating G2/M transition in hepatocytes
628497
gene_process
participates in cytokinesis control as a downstream target of Rho-GTPase and may function in regulation of G2/M transition
628497
