Advanced Search (OLGA)

Gene: Dusp12 (dual specificity phosphatase 12) Rattus norvegicus

Analyze

Symbol:

Dusp12

Name:

dual specificity phosphatase 12

RGD ID:

68375

Description:

Enables kinase binding activity and phosphoprotein phosphatase activity. Predicted to be located in cytoplasm. Predicted to be active in nucleus. Orthologous to human DUSP12 (dual specificity phosphatase 12); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3-chloropropane-1,2-diol; ammonium chloride.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

dual specificity protein phosphatase 12; GKAP; glucokinase-associated dual specificity phosphatase; glucokinase-associated phosphatase

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	DUSP12 (dual specificity phosphatase 12)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Dusp12 (dual specificity phosphatase 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Dusp12 (dual specificity phosphatase 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	DUSP12 (dual specificity phosphatase 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	DUSP12 (dual specificity phosphatase 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Dusp12 (dual specificity phosphatase 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	DUSP12 (dual specificity phosphatase 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	DUSP12 (dual specificity phosphatase 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Dusp12 (dual specificity phosphatase 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Dusp12 (dual specificity phosphatase 12)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	SRP9 (signal recognition particle 9)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	DUSP12 (dual specificity phosphatase 12)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Dusp12 (dual specificity phosphatase 12)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	dusp12 (dual specificity phosphatase 12)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	C24F3.2	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	C24F3.2	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	MKP-4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	MKP-4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	YVH1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	YVH1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	dusp12	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	dusp12	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	85,654,914 - 85,666,431 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	13	85,654,914 - 85,664,007 (-)	Ensembl				GRCr8
mRatBN7.2	13	83,122,192 - 83,131,800 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	83,122,193 - 83,131,285 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	13	85,742,087 - 85,751,158 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	87,035,555 - 87,044,626 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	84,273,518 - 84,282,500 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	89,258,309 - 89,267,402 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	89,258,310 - 89,267,402 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	13	93,870,679 - 93,879,772 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	13	86,737,093 - 86,746,186 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	13	82,775,073 - 82,784,182 (-)	NCBI		Celera
RGSC_v3.1	13	86,751,281 - 86,760,374 (-)	NCBI
Cytogenetic Map	13	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-catechin (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3-chloropropane-1,2-diol (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

cadmium atom (EXP,ISO)

cadmium dichloride (EXP,ISO)

calyculin A (ISO)

CGP 52608 (ISO)

chromium(6+) (ISO)

ciguatoxin CTX1B (ISO)

cobalt dichloride (EXP,ISO)

cyclosporin A (ISO)

cylindrospermopsin (ISO)

dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate (ISO)

endosulfan (EXP)

folic acid (ISO)

gentamycin (EXP)

ivermectin (ISO)

lead diacetate (EXP)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

methyl methanesulfonate (ISO)

paracetamol (ISO)

perfluorononanoic acid (ISO)

sodium arsenite (ISO)

sodium dichromate (EXP)

sunitinib (ISO)

titanium dioxide (ISO)

triptonide (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

dephosphorylation (ISO)

positive regulation of hexokinase activity (IDA)

protein dephosphorylation (IDA)

Cellular Component

cytoplasm (IEA,ISO)

cytosol (IEA)

nucleoplasm (IEA,ISO)

nucleus (IBA,IEA,ISO,ISS)

Molecular Function

hydrolase activity (IEA)

kinase binding (IPI)

metal ion binding (IEA)

phosphatase activity (IEA,ISO)

phosphoprotein phosphatase activity (IDA,IEA)

protein binding (ISO)

protein serine/threonine phosphatase activity (IEA)

protein tyrosine phosphatase activity (IEA)

protein tyrosine/serine/threonine phosphatase activity (IBA,IEA,ISO)

zinc ion binding (IEA,ISO,ISS)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	A novel cytosolic dual specificity phosphatase, interacting with glucokinase, increases glucose phosphorylation rate.	Munoz-Alonso MJ, etal., J Biol Chem 2000 Oct 20;275(42):32406-12.
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	GOA pipeline	RGD automated data pipeline
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data

Additional References at PubMed

PMID:10446167	PMID:11432789	PMID:24531476	PMID:36644958

Genomics

Comparative Map Data

Dusp12
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	85,654,914 - 85,666,431 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	13	85,654,914 - 85,664,007 (-)	Ensembl				GRCr8
mRatBN7.2	13	83,122,192 - 83,131,800 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	83,122,193 - 83,131,285 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	13	85,742,087 - 85,751,158 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	87,035,555 - 87,044,626 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	84,273,518 - 84,282,500 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	89,258,309 - 89,267,402 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	89,258,310 - 89,267,402 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	13	93,870,679 - 93,879,772 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	13	86,737,093 - 86,746,186 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	13	82,775,073 - 82,784,182 (-)	NCBI		Celera
RGSC_v3.1	13	86,751,281 - 86,760,374 (-)	NCBI
Cytogenetic Map	13	q24	NCBI

DUSP12
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	161,749,786 - 161,757,238 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	161,749,758 - 161,757,238 (+)	Ensembl			hg38	GRCh38
GRCh37	1	161,719,576 - 161,727,028 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	159,986,205 - 159,993,576 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	1	158,451,238 - 158,458,609	NCBI
Celera	1	134,823,009 - 134,830,369 (+)	NCBI		Celera
Cytogenetic Map	1	q23.3	NCBI
HuRef	1	132,964,136 - 132,971,867 (+)	NCBI		HuRef
CHM1_1	1	163,141,376 - 163,148,736 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	161,094,105 - 161,101,566 (+)	NCBI		T2T-CHM13v2.0

Dusp12
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	170,701,756 - 170,713,109 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	170,701,067 - 170,713,109 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	1	170,874,187 - 170,885,540 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	170,873,498 - 170,885,540 (-)	Ensembl			mm10	GRCm38
MGSCv37	1	172,804,319 - 172,815,671 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	1	172,710,863 - 172,722,215 (-)	NCBI		MGSCv36	mm8
Celera	1	179,989,219 - 180,000,689 (+)	NCBI		Celera
Cytogenetic Map	1	H3	NCBI
cM Map	1	77.27	NCBI

Dusp12
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955462	14,556,094 - 14,565,840 (-)	Ensembl
ChiLan1.0	NW_004955462	14,555,919 - 14,565,046 (-)	NCBI	ChiLan1.0	ChiLan1.0

DUSP12
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	88,029,384 - 88,037,407 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	87,697,674 - 87,706,594 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	137,161,774 - 137,169,503 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	140,959,867 - 140,968,821 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	140,959,867 - 140,968,821 (+)	Ensembl			panPan2	panpan1.1

DUSP12
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	38	20,912,543 - 20,921,137 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	38	20,912,546 - 20,921,125 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	38	20,964,899 - 20,973,061 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	38	20,995,914 - 21,004,157 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	38	20,995,394 - 21,004,163 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	38	20,967,831 - 20,975,985 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	38	21,320,983 - 21,328,971 (-)	NCBI		UNSW_CanFamBas_1.0

Dusp12
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	7,636,761 - 7,643,999 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004937131	156,201 - 163,153 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004937131	156,175 - 163,392 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

DUSP12
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	88,809,565 - 88,818,411 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	4	88,811,565 - 88,818,513 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	96,827,001 - 96,834,199 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

DUSP12
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	2,316,668 - 2,319,972 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666038	1,353,582 - 1,363,032 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Dusp12
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624826	168,103 - 182,593 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624826	167,966 - 182,844 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Dusp12
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	10	50,069,732 - 50,079,765 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Dusp12
49 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	139
Count of miRNA genes:	112
Interacting mature miRNAs:	121
Transcripts:	ENSRNOT00000004179
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1298066	Bp159	Blood pressure QTL 159		0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	48639634	93639634	Rat
10755495	Bp387	Blood pressure QTL 387	3.78		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	37216241	90057603	Rat
1354655	Bp241	Blood pressure QTL 241	3.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	38975045	103588154	Rat
8655951	Rf63	Renal function QTL 63	12.2		blood urea nitrogen amount (VT:0005265)	plasma urea nitrogen level (CMO:0000586)	13	71610804	109350286	Rat
4889606	Gluco63	Glucose level QTL 63	2.86	0.003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	13	83286150	109350286	Rat
8655945	Rf61	Renal function QTL 61	3.6		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	13	71610804	89333251	Rat
71119	Thym2	Thymus enlargement QTL 2	3.8		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	13	48749814	87285480	Rat
1331783	Bp221	Blood pressure QTL 221	3.72886		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	71610804	89333251	Rat
8655959	Pur32	Proteinuria QTL 32	8.4		urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	13	72984506	99745408	Rat
2293687	Bss26	Bone structure and strength QTL 26	4.6	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	13	67635937	109350286	Rat
1300166	Kidm6	Kidney mass QTL 6	3.93		kidney mass (VT:0002707)	single kidney wet weight to body weight ratio (CMO:0000622)	13	71610804	89333251	Rat
619615	Bp80	Blood pressure QTL 80		0.0354	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	7421791	87286911	Rat
1581573	Uae36	Urinary albumin excretion QTL 36			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	6002008	88706694	Rat
1549897	Stresp12	Stress response QTL 12	3.35		stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	13	40983585	85983585	Rat
724564	Uae11	Urinary albumin excretion QTL 11	5.7		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	13	47354258	94285672	Rat
7207885	Glom27	Glomerulus QTL 27	3.9		kidney glomerulus integrity trait (VT:0010546)	kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139)	13	21120177	109350286	Rat
738027	Lnnr6	Liver neoplastic nodule remodeling QTL 6	3.3		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	13	65613454	109350286	Rat
7387280	Uae43	Urinary albumin excretion QTL 43	5.69	0.4174	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	68983334	109350286	Rat
738026	Lnnr5	Liver neoplastic nodule remodeling QTL 5	3.29		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	13	62424592	88113509	Rat
2293702	Bss34	Bone structure and strength QTL 34	4.61	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	13	67635937	109350286	Rat
1576318	Schws5	Schwannoma susceptibility QTL 5		0.0351	nervous system integrity trait (VT:0010566)	post-insult time to trigeminal nerve neurilemmoma formation (CMO:0002019)	13	64497900	109350286	Rat
1354621	Rf47	Renal function QTL 47	3.7		kidney renin amount (VT:0010559)	kidney renin level (CMO:0002166)	13	11081740	103588154	Rat
1581554	Pur11	Proteinuria QTL 11			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	6002008	88706694	Rat
12879475	Bp400	Blood pressure QTL 400			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	64375743	109350286	Rat
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	1	103588154	Rat
2293341	Glom15	Glomerulus QTL 15	9.1		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	13	67635937	109350286	Rat

Markers in Region

BE113649

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	13	83,130,919 - 83,131,137 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	89,267,037 - 89,267,254	NCBI	Rnor6.0
Rnor_5.0	13	93,879,407 - 93,879,624	UniSTS	Rnor5.0
RGSC_v3.4	13	86,745,821 - 86,746,038	UniSTS	RGSC3.4
Celera	13	82,783,817 - 82,784,034	UniSTS
RH 3.4 Map	13	551.5	UniSTS
Cytogenetic Map	13	q24	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	164	91	90	59	92	59	6	356	192	11	143	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_022248	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039091059	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC111734	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF217233	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473958	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000013	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000004179 ⟹ ENSRNOP00000004179

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	13	85,654,914 - 85,664,007 (-)	Ensembl
mRatBN7.2 Ensembl	13	83,122,193 - 83,131,285 (-)	Ensembl
Rnor_6.0 Ensembl	13	89,258,310 - 89,267,402 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000095378 ⟹ ENSRNOP00000089203

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	13	85,654,914 - 85,663,989 (-)	Ensembl
mRatBN7.2 Ensembl	13	83,122,193 - 83,131,267 (-)	Ensembl

RefSeq Acc Id:

NM_022248 ⟹ NP_071584

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	85,654,914 - 85,664,007 (-)	NCBI
mRatBN7.2	13	83,122,192 - 83,131,285 (-)	NCBI
Rnor_6.0	13	89,258,309 - 89,267,402 (-)	NCBI
Rnor_5.0	13	93,870,679 - 93,879,772 (-)	NCBI
RGSC_v3.4	13	86,737,093 - 86,746,186 (-)	RGD
Celera	13	82,775,073 - 82,784,182 (-)	RGD

Sequence:

show sequence

TGGCTTCCTGGCGCCGCCATGTTGGAAGTACAGAGCTCTAACCATGGCTGCGAGCGTCAGGCTC
CGACTACCAGCCCCGCCAGCTCGGCAGGGCACGCGGTGGAAGTGCGGCCCGGGCTGTATCTGGG
TGGGGCGGCGGCAGTGGCTGGACCGGACTACCTGAGGGAGGCGGGCATCACCGCCGTGCTGACG
GTGGACTCGGAACCGGCTTTCCCGGCCGGGGCTGGTTTCGAAGGTCTCCAGAGCCTCTTCGTGC
CCGCGCTGGACAAACCCGAGACCGACCTGCTCAGTCACTTGGATCGGTGCGTGGCTTTCATCGG
CCAGGCTCGCTCCGAAGGCCGTGCGGTGTTGGTGCACTGTCATGCAGGAGTCAGCCGCAGTGTT
GCTGTAGTGACGGCTTTCATAATGAAGACCGAACAGCTTACCTTTGAAAAAGCCTATGAAAACC
TCCAGACCATCAAGCCAGAGGCTAAGATGAATGAGGGGTTCGAGTGGCAACTGAAGCTCTATGA
GGCGATGGGACACGAAGTCCATACCTCCAGTGCCGTTTACAAGCAGTACCGTTTGCAAAAGGTG
ACTGAGAAGTATCCAGAACTTCGGAATTTGCCTCGAGAACTCTTTGCTGTCGACCCAACTACCG
TTTCACAAGGATTAAAAGATGACATCCTCTACAAATGTAGAAAGTGCAGGCGATCTTTATTTAG
ACGTTCCAGCATTTTGGATCATAGTGAAGGAAGTGGGCCAGTAGCCTTTGCTCACAAGAGAACA
GGACTGTCTTCCGTACTTACCACAGGGAATCAGGCTCAGTGTACATCTTACTTCATCGAACCTG
TGCAGTGGATGGAGTCTGCTTTGTTGGGGGTTATGGATGGACAGCTTCTTTGCCCAAAATGCAG
TGCCAAGTTGGGTTCCTTTAACTGGTATGGTGAACAGTGCTCGTGTGGCCGATGGATAACCCCT
GCTTTCCAAATCCACAAGAACAGAGTGGATGAAGTGAAAACATTGCCAGCGCTGGGATCACAAA
CAAAGAAACCATGAACTTAGGACTCAGCTTGGGATGGACCCTGGGAAAGGCGCTTCTCCATTGG
CATCTTTCATGGCGATGTCAAATTTCAGTTGGATGTCCAAGGATAATTACTGACTGTAACAGCT
GTGGGGTGGTGGCTTATTATGTCACACACACACACACACACACACACACACACACACGGTACTC
TGCTTGGCCATCCAGACTGTTAGTCATGTAAATTGGATTTGATATTAAAATCTTTTGGGCTGGA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039091059 ⟹ XP_038946987

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	85,655,240 - 85,666,431 (-)	NCBI
mRatBN7.2	13	83,122,518 - 83,131,800 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_071584	(Get FASTA)	NCBI Sequence Viewer
	XP_038946987	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAF87971	(Get FASTA)	NCBI Sequence Viewer
	EDM09243	(Get FASTA)	NCBI Sequence Viewer
	EDM09244	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000004179
	ENSRNOP00000004179.2
GenBank Protein	Q9JIM4	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_071584 ⟸ NM_022248

- UniProtKB:

Q9JIM4 (UniProtKB/Swiss-Prot), A0A8I6AB94 (UniProtKB/TrEMBL), A6IDQ3 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MLEVQSSNHGCERQAPTTSPASSAGHAVEVRPGLYLGGAAAVAGPDYLREAGITAVLTVDSEPA
FPAGAGFEGLQSLFVPALDKPETDLLSHLDRCVAFIGQARSEGRAVLVHCHAGVSRSVAVVTAF
IMKTEQLTFEKAYENLQTIKPEAKMNEGFEWQLKLYEAMGHEVHTSSAVYKQYRLQKVTEKYPE
LRNLPRELFAVDPTTVSQGLKDDILYKCRKCRRSLFRRSSILDHSEGSGPVAFAHKRTGLSSVL
TTGNQAQCTSYFIEPVQWMESALLGVMDGQLLCPKCSAKLGSFNWYGEQCSCGRWITPAFQIHK
NRVDEVKTLPALGSQTKKP

hide sequence

Ensembl Acc Id:

ENSRNOP00000004179 ⟸ ENSRNOT00000004179

RefSeq Acc Id:	XP_038946987 ⟸ XM_039091059
- Peptide Label:	isoform X1
- UniProtKB:	A6IDQ4 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000089203 ⟸ ENSRNOT00000095378

Protein Domains

Tyrosine specific protein phosphatases Tyrosine-protein phosphatase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9JIM4-F1-model_v2	AlphaFold	Q9JIM4	1-339	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698988

Promoter ID:

EPDNEW_R9513

Type:

initiation region

Name:

Dusp12_1

Description:

dual specificity phosphatase 12

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	13	89,267,387 - 89,267,447	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:68375	AgrOrtholog
BioCyc Gene	G2FUF-17465	BioCyc
Ensembl Genes	ENSRNOG00000003100	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000004179	ENTREZGENE
	ENSRNOT00000004179.4	UniProtKB/Swiss-Prot
Gene3D-CATH	3.90.190.10	UniProtKB/Swiss-Prot
InterPro	Dual-sp_phosphatase_cat-dom	UniProtKB/Swiss-Prot
	DUSP12	UniProtKB/Swiss-Prot
	Prot-tyrosine_phosphatase-like	UniProtKB/Swiss-Prot
	TYR_PHOSPHATASE_dom	UniProtKB/Swiss-Prot
	TYR_PHOSPHATASE_DUAL_dom	UniProtKB/Swiss-Prot
KEGG Report	rno:64014	UniProtKB/Swiss-Prot
NCBI Gene	Dusp12	ENTREZGENE
PANTHER	DUAL SPECIFICITY PROTEIN PHOSPHATASE 12	UniProtKB/Swiss-Prot
	DUAL SPECIFICITY PROTEIN PHOSPHATASE 12 FAMILY MEMBER	UniProtKB/Swiss-Prot
Pfam	DSPc	UniProtKB/Swiss-Prot
PhenoGen	Dusp12	PhenoGen
PIRSF	DUSP12	UniProtKB/Swiss-Prot
PROSITE	TYR_PHOSPHATASE_2	UniProtKB/Swiss-Prot
	TYR_PHOSPHATASE_DUAL	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000003100	RatGTEx
SMART	DSPc	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF52799	UniProtKB/Swiss-Prot
TIGR	TC209833
UniProt	A0A8I6AB94	ENTREZGENE, UniProtKB/TrEMBL
	A6IDQ3	ENTREZGENE, UniProtKB/TrEMBL
	A6IDQ4	ENTREZGENE, UniProtKB/TrEMBL
	DUS12_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2002-06-10	Dusp12	dual specificity phosphatase 12			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_cellular_localization	localized to the cytosol and not the nucleus	68242
gene_function	interacts with liver glucokinase	68242
gene_function	dephosphorylates recombinant glucokinase	68242
gene_protein	339 amino acids	68242

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message