Advanced Search (OLGA)

Gene: St8sia2 (ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2) Rattus norvegicus

Analyze

Symbol:

St8sia2

Name:

ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2

RGD ID:

621843

Description:

Enables sialyltransferase activity. Involved in several processes, including neuron projection extension; positive regulation of synapse assembly; and response to cocaine. Located in perinuclear region of cytoplasm. Orthologous to human ST8SIA2 (ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2); INTERACTS WITH 6-propyl-2-thiouracil; ammonium chloride; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

alpha-2,8-sialyltransferase 8B; sialyltransferase 8 (alpha-2 8-sialytransferase) B; sialyltransferase 8 (alpha-2, 8-sialyltransferase) B; sialyltransferase 8 (alpha-2, 8-sialytransferase) B; sialyltransferase 8B; sialyltransferase St8Sia II; sialyltransferase X; sialytransferase St8Sia II; SIAT8-B; Siat8b; ST8 alpha-N-acetylneuraminate alpha-2,8-sialyltransferase 2; ST8Sia II; ST8SiaII; STX

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Is Marker For:

Strains: WKY.SHRSP-(D1Rat25-St8sia2)/Izm

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	137,172,354 - 137,247,796 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	137,172,354 - 137,247,792 (-)	Ensembl				GRCr8
mRatBN7.2	1	127,762,573 - 127,838,017 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	127,762,573 - 127,838,091 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	135,709,155 - 135,780,162 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	142,879,281 - 142,950,280 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	135,752,974 - 135,824,111 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	135,336,374 - 135,406,699 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	135,336,374 - 135,406,700 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	136,353,283 - 136,423,629 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	129,158,717 - 129,191,810 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	119,890,482 - 119,961,512 (-)	NCBI		Celera
RGSC_v3.1	1	129,237,058 - 129,270,153 (+)	NCBI
Cytogenetic Map	1	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autistic disorder (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,4,4'-trichlorobiphenyl (ISO)

2-methylcholine (ISO)

4,4'-sulfonyldiphenol (ISO)

5-azacytidine (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (ISO)

afimoxifene (ISO)

ammonium chloride (EXP)

antirheumatic drug (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

CGP 52608 (ISO)

chloroprene (ISO)

chlorpyrifos (ISO)

choline (ISO)

dibutyl phthalate (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

entinostat (ISO)

folic acid (ISO)

hydralazine (ISO)

L-methionine (ISO)

lead(0) (ISO)

lead(II) chloride (EXP)

methapyrilene (ISO)

methotrexate (ISO)

methylmercury chloride (ISO)

nitrofen (EXP)

ozone (ISO)

panobinostat (ISO)

PCB138 (ISO)

perfluorohexanesulfonic acid (ISO)

phenylmercury acetate (ISO)

pyrogallol (ISO)

SB 431542 (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (EXP,ISO)

sunitinib (ISO)

titanium dioxide (ISO)

trichostatin A (ISO)

tunicamycin (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

ganglioside biosynthetic process (IEA,ISO)

glycoprotein biosynthetic process (IEA,ISO)

N-glycan processing (IBA,IEA,ISO)

neuron differentiation (IEP)

neuron projection extension (IMP)

oligosaccharide metabolic process (IBA,IEA,ISO)

positive regulation of neuron apoptotic process (IDA)

positive regulation of synapse assembly (IMP)

response to cocaine (IEP)

sialylation (IEA,ISO,ISS)

Cellular Component

early endosome (IEA,ISO)

extracellular region (IEA,ISO,ISS)

Golgi apparatus (IEA,ISO,ISS)

Golgi membrane (IEA)

perinuclear region of cytoplasm (IDA)

plasma membrane (IEA)

recycling endosome (IEA,ISO)

Molecular Function

alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity (IBA,IEA,ISO,ISS)

glycosyltransferase activity (IEA)

nucleotide binding (IEA)

protein binding (ISO)

sialyltransferase activity (IEA,IMP,TAS)

transferase activity (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Differential regulation of polysialyltransferase expression during hippocampus development: Implications for neuronal survival.	Brocco M, etal., J Neurosci Res. 2003 Dec 1;74(5):744-53. doi: 10.1002/jnr.10781.
2.	Interfering polysialyltransferase ST8SiaII/STX mRNA inhibits neurite growth during early hippocampal development.	Brocco MA and Frasch AC, FEBS Lett. 2006 Aug 21;580(19):4723-6. doi: 10.1016/j.febslet.2006.07.058. Epub 2006 Jul 26.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Biosynthesis and expression of polysialic acid on the neural cell adhesion molecule is predominantly directed by ST8Sia II/STX during in vitro neuronal differentiation.	Kojima N, etal., J Biol Chem. 1996 Sep 6;271(36):22058-62. doi: 10.1074/jbc.271.36.22058.
5.	Polymerase chain reaction cloning of a developmentally regulated member of the sialyltransferase gene family.	Livingston BD and Paulson JC, J Biol Chem 1993 Jun 5;268(16):11504-7.
6.	Cocaine enhances ST8SiaII mRNA expression and neural cell adhesion molecule polysialylation in the rat medial prefrontal cortex.	Maćkowiak M, etal., Neuroscience. 2011 Jul 14;186:21-31. doi: 10.1016/j.neuroscience.2011.04.030. Epub 2011 Apr 19.
7.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
8.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.	GOA pipeline	RGD automated data pipeline
10.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:7875291	PMID:10766765	PMID:23303939	PMID:24753009	PMID:26844880

Genomics

Comparative Map Data

St8sia2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	137,172,354 - 137,247,796 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	137,172,354 - 137,247,792 (-)	Ensembl				GRCr8
mRatBN7.2	1	127,762,573 - 127,838,017 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	127,762,573 - 127,838,091 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	135,709,155 - 135,780,162 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	142,879,281 - 142,950,280 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	135,752,974 - 135,824,111 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	135,336,374 - 135,406,699 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	135,336,374 - 135,406,700 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	136,353,283 - 136,423,629 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	129,158,717 - 129,191,810 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	119,890,482 - 119,961,512 (-)	NCBI		Celera
RGSC_v3.1	1	129,237,058 - 129,270,153 (+)	NCBI
Cytogenetic Map	1	q31	NCBI

ST8SIA2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	15	92,393,881 - 92,468,728 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	15	92,393,881 - 92,468,728 (+)	Ensembl			hg38	GRCh38
GRCh37	15	92,937,111 - 93,011,958 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	15	90,738,144 - 90,812,962 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	15	90,738,143 - 90,812,960	NCBI
Celera	15	69,348,987 - 69,423,804 (+)	NCBI		Celera
Cytogenetic Map	15	q26.1	NCBI
HuRef	15	69,073,963 - 69,148,782 (+)	NCBI		HuRef
CHM1_1	15	92,778,223 - 92,853,016 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	15	90,156,330 - 90,231,154 (+)	NCBI		T2T-CHM13v2.0

St8sia2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	73,588,867 - 73,663,408 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	73,588,867 - 73,663,438 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	7	73,939,119 - 74,013,727 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	73,939,119 - 74,013,690 (-)	Ensembl			mm10	GRCm38
MGSCv37	7	81,084,005 - 81,158,568 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	7	73,812,634 - 73,887,174 (-)	NCBI		MGSCv36	mm8
Celera	7	71,386,077 - 71,460,843 (-)	NCBI		Celera
Cytogenetic Map	7	D1	NCBI
cM Map	7	42.27	NCBI

St8sia2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955416	20,697,651 - 20,767,112 (+)	Ensembl
ChiLan1.0	NW_004955416	20,697,651 - 20,763,975 (+)	NCBI	ChiLan1.0	ChiLan1.0

ST8SIA2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	16	81,944,128 - 82,019,429 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	15	85,644,544 - 85,725,911 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	15	71,082,491 - 71,158,038 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	15	90,279,509 - 90,354,173 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	15	90,279,509 - 90,354,173 (+)	Ensembl			panPan2	panpan1.1

ST8SIA2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	3	47,588,804 - 47,654,853 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	3	47,588,797 - 47,655,593 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	3	50,295,210 - 50,356,703 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	3	48,001,090 - 48,073,258 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	3	48,001,047 - 48,073,994 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	3	47,521,309 - 47,582,785 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	3	47,753,561 - 47,815,049 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	3	48,085,662 - 48,147,171 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

St8sia2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	135,991,306 - 136,055,640 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936483	10,278,838 - 10,313,905 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936483	10,278,843 - 10,343,177 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ST8SIA2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	86,446,149 - 86,514,393 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	7	86,450,302 - 86,514,232 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	92,389,280 - 92,455,864 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ST8SIA2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	29	10,966,738 - 11,039,014 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	29	11,000,989 - 11,041,634 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666059	35,633,373 - 35,710,140 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

St8sia2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624768	11,234,281 - 11,302,237 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624768	11,238,134 - 11,302,280 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

St8sia2
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	2	126,483,780 - 126,556,680 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in St8sia2
534 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	146
Count of miRNA genes:	116
Interacting mature miRNAs:	122
Transcripts:	ENSRNOT00000016427
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61442	Strs1	Sensitivity to stroke QTL 1	7.4		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	1	131179947	176179947	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	51940904	168768703	Rat
1554320	Bmd1	Bone mineral density QTL 1	12.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	101228864	146228864	Rat
1598866	Bp287	Blood pressure QTL 287	5.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	130419227	175419227	Rat
1578770	Stresp23	Stress response QTL 23			kidney sympathetic nerve activity (VT:0004050)	stimulated renal sympathetic nerve activity to basal renal sympathetic nerve activity ratio (CMO:0001786)	1	132760429	191848948	Rat
631684	Bp117	Blood pressure QTL 117	8.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	120082258	165082258	Rat
9590300	Scort16	Serum corticosterone level QTL 16	4.39	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	1	112521556	157521556	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	66009857	160501508	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	51511344	153680016	Rat
1598850	Bp297	Blood pressure QTL 297	2.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	130419227	175419227	Rat
631570	Bp94	Blood pressure QTL 94		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	132889797	152403053	Rat
152025235	Bw194	Body weight QTL 194	4.86		body mass (VT:0001259)		1	132966869	252856240	Rat
152025232	Bw192	Body weight QTL 192	3.93		body mass (VT:0001259)		1	127329268	206393015	Rat
61344	Bp29	Blood pressure QTL 29	7.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	132760602	142582180	Rat
724521	Uae1	Urinary albumin excretion QTL 1	3.8	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	99645382	182701046	Rat
1358902	Bw47	Body weight QTL 47	1.67		body mass (VT:0001259)	body weight (CMO:0000012)	1	99645382	221502378	Rat
8655649	Arrd1	Age-related retinal degeneration QTL 1	4.89		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	109493780	193400781	Rat
2317833	Alcrsp19	Alcohol response QTL 19	12.4	0.001	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	1	110389869	155389869	Rat
1300153	Bp171	Blood pressure QTL 171	3.37		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	124975316	152612788	Rat
731168	Bp154	Blood pressure QTL 154	3.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	103779152	223964440	Rat
631205	Bp196	Blood pressure QTL 196	4	0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	98879955	208479939	Rat
1641897	Alcrsp1	Alcohol response QTL 1			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	1	110389869	155389869	Rat
1331749	Hrtrt11	Heart rate QTL 11	2.973		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	92683681	137683681	Rat
737977	Bp160	Blood pressure QTL 160		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	97582336	142582336	Rat
1331751	Bp199	Blood pressure QTL 199	3.60022		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	116099376	191260518	Rat
2293142	Bp314	Blood pressure QTL 314			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	101594089	146594089	Rat
2293140	Bp313	Blood pressure QTL 313			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	131243790	176243790	Rat
724529	Cm16	Cardiac mass QTL 16	2.7		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	1	96717367	160111531	Rat
61370	Mcs3	Mammary carcinoma susceptibility QTL 3	2.15		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	1	111404407	142582336	Rat
737974	Bp161	Blood pressure QTL 161		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	129182274	174182274	Rat
1641895	Bp298	Blood pressure QTL 298			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	132760429	191848948	Rat
631496	Bp97	Blood pressure QTL 97	3.08		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	115183611	176289080	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	51941022	208479811	Rat
1331793	Bp200	Blood pressure QTL 200	3.71601		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	102780511	182384005	Rat
1354591	Cm36	Cardiac mass QTL 36	4.1		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	111949780	210707719	Rat
1331800	Scl25	Serum cholesterol level QTL 25	3.013		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	87785026	142582336	Rat
7421630	Bp362	Blood pressure QTL 362		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	128019551	173019551	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34184556	172281316	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34565911	208798288	Rat
631519	Pia11	Pristane induced arthritis QTL 11	5.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	93903998	191260518	Rat
61399	Tcat1	Tongue tumor resistance QTL 1	3.3		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 5 mm (CMO:0001879)	1	108680016	153680016	Rat
724567	Tcas6	Tongue tumor susceptibility QTL 6	6.85		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	1	102359314	153680016	Rat
1354615	Cm32	Cardiac mass QTL 32	5.2		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	111949780	210707719	Rat
634348	Bp138	Blood pressure QTL 138			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	135021436	178317588	Rat
8694370	Bw154	Body weight QTL 154	8.91	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	1	112521556	157521556	Rat
1354623	Rf46	Renal function QTL 46	3.8		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	1	111949780	160574007	Rat
738022	Anxrr13	Anxiety related response QTL 13	4.6	0.00039	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of, or within a discrete space in an open field apparatus (CMO:0001514)	1	92683681	137683681	Rat
631654	Bp107	Blood pressure QTL 107			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	135021436	180021436	Rat
631544	Bp84	Blood pressure QTL 84	5.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	132760429	191190115	Rat
152025212	Bw190	Body weight QTL 190	5.7		body mass (VT:0001259)		1	132966869	206393015	Rat
631549	Bp89	Blood pressure QTL 89	5.7		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	132760429	152404087	Rat
61433	Cia2	Collagen induced arthritis QTL 2	5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	100345976	145345976	Rat
1358189	Cstrr1	Cold stress response QTL 1		0.0001	catecholamine amount (VT:0010543)	urine norepinephrine level (CMO:0001629)	1	132760429	191848948	Rat
1354606	Bp246	Blood pressure QTL 246	3.6		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	111949780	228180370	Rat
2325726	Eae30	Experimental allergic encephalomyelitis QTL 30			nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	1	132463342	138003629	Rat

Markers in Region

STS-L29556

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	127,766,718 - 127,766,950 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	135,336,424 - 135,336,655	NCBI	Rnor6.0
Rnor_5.0	1	136,353,333 - 136,353,564	UniSTS	Rnor5.0
RGSC_v3.4	1	129,191,529 - 129,191,760	UniSTS	RGSC3.4
Celera	1	119,890,532 - 119,890,763	UniSTS
Cytogenetic Map	1	q31	UniSTS

D1Bda26

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	127,766,672 - 127,766,934 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	135,336,378 - 135,336,639	NCBI	Rnor6.0
Rnor_5.0	1	136,353,287 - 136,353,548	UniSTS	Rnor5.0
RGSC_v3.4	1	129,191,545 - 129,191,806	UniSTS	RGSC3.4
Celera	1	119,890,486 - 119,890,747	UniSTS
Cytogenetic Map	1	q31	UniSTS

AU047261

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	1	137,245,754 - 137,245,898 (+)	Marker Load Pipeline
mRatBN7.2	1	127,835,974 - 127,836,118 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	135,404,863 - 135,405,006	NCBI	Rnor6.0
Rnor_5.0	1	136,421,850 - 136,421,993	UniSTS	Rnor5.0
RGSC_v3.4	1	129,266,325 - 129,266,468	UniSTS	RGSC3.4
Celera	1	119,959,752 - 119,959,887	UniSTS
Cytogenetic Map	1	q31	UniSTS

AU047260

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	1	137,245,720 - 137,245,997 (+)	Marker Load Pipeline
mRatBN7.2	1	127,835,940 - 127,836,217 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	135,404,829 - 135,405,105	NCBI	Rnor6.0
Rnor_5.0	1	136,421,816 - 136,422,092	UniSTS	Rnor5.0
RGSC_v3.4	1	129,266,291 - 129,266,567	UniSTS	RGSC3.4
Celera	1	119,959,718 - 119,959,986	UniSTS
Cytogenetic Map	1	q31	UniSTS

Related Rat Strains

The following Strains have been annotated to St8sia2

WKY.SHRSP-(D1Rat25-St8sia2)/Izm

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
11	12	64	147	71	71	40	33	40	6	240	129	11	127	52	92	31	16	16

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_057156	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063268334	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	L13445	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000016427

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	1	135,336,374 - 135,406,642 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000076348

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	1	135,336,374 - 135,406,642 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000079929

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	1	135,336,374 - 135,406,700 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000113519 ⟹ ENSRNOP00000092932

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	137,172,354 - 137,247,753 (-)	Ensembl
mRatBN7.2 Ensembl	1	127,762,573 - 127,838,091 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000143061 ⟹ ENSRNOP00000102202

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	137,172,354 - 137,247,792 (-)	Ensembl

RefSeq Acc Id:

NM_057156 ⟹ NP_476497

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	137,172,354 - 137,247,753 (-)	NCBI
mRatBN7.2	1	127,762,573 - 127,837,973 (-)	NCBI
Rnor_6.0	1	135,336,374 - 135,406,699 (-)	NCBI
Rnor_5.0	1	136,353,283 - 136,423,629 (-)	NCBI
RGSC_v3.4	1	129,158,717 - 129,191,810 (+)	RGD
Celera	1	119,890,482 - 119,961,512 (-)	RGD

Sequence:

show sequence

ATGCAGCTGCAGTTCCGGAGCTGGATGCTGGCCGCGCTCACGCTGCTCGTGGTCTTCCTCATCT
TCGCAGACATCTCAGAGATCGAAGAAGAAATCGGGAATTCTGGAGGCAGAGGTACAATCAGATC
AGCTGTGAACAGCTTACATAGCAAATCTAATAGAGCTGAAGTTGTAATAAATGGCTCTTCACTA
CCAGCCGTTGCTGACAGAAGTAATGAAAGCCTTAAGCACAGCATCCAGCCAGCCTCATCCAAGT
GGAGACACAACCAGACGCTCTCTCTGAGGATCAGGAAGCAAATTTTAAAGTTCCTGGATGCAGA
GAAGGATATTTCTGTCCTTAAGGGGACCCTGAAGCCTGGAGACATTATTCATTATATCTTTGAT
CGAGACAGCACAATGAACGTGTCCCAGAACCTCTATGAACTCCTCCCCAGAACCTCACCTCTGA
AGAATAAGCATTTCCAGACTTGTGCCATCGTGGGCAACTCAGGAGTCTTGCTCAACAGCGGCTG
TGGGCAGGAGATTGACACACACAGCTTTGTCATAAGGTGCAACCTGGCTCCAGTTCAGGAGTAT
GCCCGGGATGTGGGCCTCAAGACTGACCTAGTGACCATGAACCCCTCAGTCATCCAGCGGGCCT
TTGAGGACCTAGTGAATGCCACGTGGCGGGAGAAGCTACTGCAGCGACTGCATGGCCTCAATGG
GAGCATACTGTGGATACCTGCCTTCATGGCCCGGGGTGGCAAGGAGCGTGTGGAGTGGGTCAAT
GCTCTCATCCTGAAGCACCATGTCAACGTACGCACAGCTTACCCTTCCCTGCGCCTGCTGCACG
CAGTCCGAGGATATTGGCTGACCAACAAAGTCCACATCAAAAGACCAACCACTGGCCTCCTGAT
GTACACCCTGGCCACACGCTTCTGCAATCAGATCTACCTTTATGGCTTCTGGCCCTTCCCATTG
GATCAGAATCAGAACCCCGTCAAGTACCACTATTATGACAGCCTCAAGTATGGCTACACCTCCC
AGGCCAGCCCCCACACCATGCCCTTGGAATTCAAGGCCCTCAAGAGCCTACATGAACAGGGGGC
ATTGAAACTGACTGTCGGCCAGTGTGACGGGGCTACGTAA

hide sequence

RefSeq Acc Id:

XM_063268334 ⟹ XP_063124404

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	137,176,744 - 137,247,796 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_476497	(Get FASTA)	NCBI Sequence Viewer
	XP_063124404	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA42147	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000092932
	ENSRNOP00000092932.1
GenBank Protein	Q07977	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_476497 ⟸ NM_057156
- Peptide Label:	precursor
- UniProtKB:	Q64688 (UniProtKB/Swiss-Prot), Q07977 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MQLQFRSWMLAALTLLVVFLIFADISEIEEEIGNSGGRGTIRSAVNSLHSKSNRAEVVINGSSL PAVADRSNESLKHSIQPASSKWRHNQTLSLRIRKQILKFLDAEKDISVLKGTLKPGDIIHYIFD RDSTMNVSQNLYELLPRTSPLKNKHFQTCAIVGNSGVLLNSGCGQEIDTHSFVIRCNLAPVQEY ARDVGLKTDLVTMNPSVIQRAFEDLVNATWREKLLQRLHGLNGSILWIPAFMARGGKERVEWVN ALILKHHVNVRTAYPSLRLLHAVRGYWLTNKVHIKRPTTGLLMYTLATRFCNQIYLYGFWPFPL DQNQNPVKYHYYDSLKYGYTSQASPHTMPLEFKALKSLHEQGALKLTVGQCDGAT hide sequence

Ensembl Acc Id:

ENSRNOP00000092932 ⟸ ENSRNOT00000113519

RefSeq Acc Id:	XP_063124404 ⟸ XM_063268334
- Peptide Label:	isoform X1

Ensembl Acc Id:

ENSRNOP00000102202 ⟸ ENSRNOT00000143061

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q07977-F1-model_v2	AlphaFold	Q07977	1-375	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621843	AgrOrtholog
BioCyc Gene	G2FUF-58874	BioCyc
Ensembl Genes	ENSRNOG00000012031	Ensembl
	ENSRNOG00000065528	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000113519	ENTREZGENE
	ENSRNOT00000113519.1	UniProtKB/Swiss-Prot
Gene3D-CATH	3.90.1480.20	UniProtKB/Swiss-Prot
InterPro	Glyco_trans_29	UniProtKB/Swiss-Prot
	Glycosyltr_29_Sialyltrsf	UniProtKB/Swiss-Prot
	GT29-like_sf	UniProtKB/Swiss-Prot
	Sialyl_trans	UniProtKB/Swiss-Prot
KEGG Report	rno:117523	UniProtKB/Swiss-Prot
NCBI Gene	117523	ENTREZGENE
PANTHER	ALPHA-2,8-SIALYLTRANSFERASE	UniProtKB/Swiss-Prot
	ALPHA-2,8-SIALYLTRANSFERASE 8B	UniProtKB/Swiss-Prot
Pfam	Glyco_transf_29	UniProtKB/Swiss-Prot
PhenoGen	St8sia2	PhenoGen
PIRSF	Sialyl_trans	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000012031	RatGTEx
	ENSRNOG00000065528	RatGTEx
UniProt	A0ABK0LMC9_RAT	UniProtKB/TrEMBL
	Q07977	ENTREZGENE
	Q64688	ENTREZGENE
	SIA8B_RAT	UniProtKB/Swiss-Prot
UniProt Secondary	Q64688	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-05-05	St8sia2	ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2	St8sia2	ST8 alpha-N-acetylneuraminate alpha-2,8-sialyltransferase 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-03-15	St8sia2	ST8 alpha-N-acetylneuraminate alpha-2,8-sialyltransferase 2	St8sia2	ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	St8sia2	ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2	Siat8b	sialyltransferase 8 (alpha-2, 8-sialyltransferase) B	Symbol and Name updated	1299863	APPROVED
2005-01-20	Siat8b	sialyltransferase 8 (alpha-2, 8-sialyltransferase) B			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Siat8b				Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed specifically in newborn brain	729711

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD