Symbol:
Arf1
Name:
ARF GTPase 1 (Ensembl:ADP-ribosylation factor 1)
RGD ID:
621270
Description:
Enables guanyl ribonucleotide binding activity; magnesium ion binding activity; and phospholipase D activator activity. Involved in several processes, including Golgi to transport vesicle transport; positive regulation of transport; and postsynapse organization. Located in Golgi apparatus; cytoplasmic vesicle; and peroxisomal membrane. Is active in glutamatergic synapse and postsynaptic density. Human ortholog(s) of this gene implicated in periventricular nodular heterotopia. Orthologous to human ARF1 (ARF GTPase 1); PARTICIPATES IN Arf family mediated signaling pathway; phosphatidylinositol 3-kinase class I signaling pathway; vascular endothelial growth factor signaling pathway; INTERACTS WITH 2,4,6-trinitrotoluene; bexarotene; bisphenol A.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
ADP-ribosylation factor 1; MGC72830
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ARF1 (ARF GTPase 1) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, Panther, PhylomeDB
Mus musculus (house mouse):
Arf1 (ARF GTPase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Arf1 (ARF GTPase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ARF1 (ARF GTPase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ARF1 (ARF GTPase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Arf1 (ARF GTPase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ARF1 (ADP ribosylation factor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ARF1 (ARF GTPase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Arf1 (ARF GTPase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
ARF3 (ARF GTPase 3) HGNC
OrthoDB
Homo sapiens (human):
ABCC1 (ATP binding cassette subfamily C member 1 (ABCC1 blood group)) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
ARF1 (ARF GTPase 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Arf1 (ARF GTPase 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
arf1 (ADP-ribosylation factor 1)
Alliance
DIOPT (InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
ARF1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
ARF2
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Arf79F
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
arf-1.2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
ppp1r14c
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
arf5
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 44,497,543 - 44,513,994 (-) NCBI GRCr8 mRatBN7.2 10 43,997,983 - 44,014,461 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 43,997,986 - 44,014,434 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 48,692,668 - 48,708,202 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 48,183,026 - 48,198,560 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 43,686,624 - 43,702,158 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 45,562,700 - 45,579,214 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 45,563,547 - 45,579,029 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 45,318,170 - 45,334,673 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 45,516,609 - 45,532,091 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 45,529,387 - 45,545,841 (-) NCBI Celera 10 43,262,080 - 43,277,562 (-) NCBI Celera Cytogenetic Map 10 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Arf1 Rat (S)-nicotine multiple interactions ISO Arf1 (Mus musculus) 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Arf1 Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine decreases expression ISO Arf1 (Mus musculus) 6480464 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Arf1 Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine multiple interactions ISO Arf1 (Mus musculus) 6480464 [Caffeine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Arf1 Rat 17alpha-ethynylestradiol affects expression ISO Arf1 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of ARF1 mRNA CTD PMID:17555576 Arf1 Rat 17alpha-ethynylestradiol increases expression ISO Arf1 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of ARF1 mRNA CTD PMID:17942748 Arf1 Rat 17beta-estradiol increases expression ISO Arf1 (Mus musculus) 6480464 Estradiol results in increased expression of ARF1 mRNA CTD PMID:39298647 Arf1 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Arf1 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Arf1 Rat 2,4,6-trinitrotoluene affects expression EXP 6480464 Trinitrotoluene affects the expression of ARF1 mRNA CTD PMID:21346803 Arf1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO ARF1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of ARF1 mRNA CTD PMID:28628672 Arf1 Rat 4,4'-sulfonyldiphenol increases expression ISO Arf1 (Mus musculus) 6480464 bisphenol S results in increased expression of ARF1 mRNA CTD PMID:39298647 Arf1 Rat 5-fluorouracil multiple interactions ISO ARF1 (Homo sapiens) 6480464 ARF1 protein affects the susceptibility to [Fluorouracil co-treated with irinotecan analog] CTD PMID:18927307 Arf1 Rat aflatoxin B1 decreases expression ISO Arf1 (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of ARF1 mRNA CTD PMID:19770486 Arf1 Rat all-trans-retinoic acid decreases expression ISO ARF1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of ARF1 mRNA CTD PMID:21934132 Arf1 Rat Aroclor 1254 decreases expression ISO Arf1 (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of ARF1 mRNA CTD PMID:23650126 Arf1 Rat arsane multiple interactions ISO ARF1 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of ARF1 mRNA CTD PMID:32525701 Arf1 Rat arsane affects methylation ISO ARF1 (Homo sapiens) 6480464 Arsenic affects the methylation of ARF1 gene CTD PMID:25304211 Arf1 Rat arsenic atom multiple interactions ISO ARF1 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of ARF1 mRNA CTD PMID:32525701 Arf1 Rat arsenic atom affects methylation ISO ARF1 (Homo sapiens) 6480464 Arsenic affects the methylation of ARF1 gene CTD PMID:25304211 Arf1 Rat arsenous acid increases expression ISO ARF1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of ARF1 mRNA CTD PMID:20458559 Arf1 Rat benzo[a]pyrene decreases methylation ISO ARF1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of ARF1 5' UTR CTD PMID:27901495 Arf1 Rat bexarotene increases expression EXP 6480464 bexarotene results in increased expression of ARF1 mRNA CTD PMID:16648578 Arf1 Rat bis(2-ethylhexyl) phthalate increases expression ISO Arf1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of ARF1 mRNA CTD PMID:33754040 Arf1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ARF1 mRNA CTD PMID:25181051 and PMID:30816183 Arf1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ARF1 mRNA CTD PMID:33296240 Arf1 Rat bisphenol A affects expression ISO ARF1 (Homo sapiens) 6480464 bisphenol A affects the expression of ARF1 mRNA CTD PMID:30903817 Arf1 Rat bisphenol F multiple interactions ISO ARF1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of ARF1 mRNA CTD PMID:28628672 Arf1 Rat bisphenol F increases expression ISO Arf1 (Mus musculus) 6480464 bisphenol F results in increased expression of ARF1 mRNA CTD PMID:38685157 Arf1 Rat cadmium atom increases expression ISO ARF1 (Homo sapiens) 6480464 Cadmium results in increased expression of ARF1 mRNA CTD PMID:23369406 Arf1 Rat caffeine multiple interactions ISO Arf1 (Mus musculus) 6480464 [Caffeine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Arf1 Rat captan increases expression ISO Arf1 (Mus musculus) 6480464 Captan results in increased expression of ARF1 mRNA CTD PMID:31558096 Arf1 Rat carmustine affects response to substance ISO ARF1 (Homo sapiens) 6480464 ARF1 mRNA affects the susceptibility to Carmustine CTD PMID:16365179 Arf1 Rat chlorpyrifos increases expression ISO Arf1 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of ARF1 mRNA CTD PMID:37019170 Arf1 Rat choline multiple interactions ISO Arf1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of ARF1 gene CTD PMID:20938992 Arf1 Rat cisplatin decreases expression ISO ARF1 (Homo sapiens) 6480464 Cisplatin results in decreased expression of ARF1 mRNA CTD PMID:27594783 Arf1 Rat clofibrate decreases expression ISO Arf1 (Mus musculus) 6480464 Clofibrate results in decreased expression of ARF1 mRNA CTD PMID:17585979 Arf1 Rat copper atom multiple interactions ISO ARF1 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of ARF1 mRNA more ... CTD PMID:20971185 and PMID:21034850 Arf1 Rat copper(0) multiple interactions ISO ARF1 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of ARF1 mRNA more ... CTD PMID:20971185 and PMID:21034850 Arf1 Rat cyclosporin A increases expression ISO Arf1 (Mus musculus) 6480464 Cyclosporine results in increased expression of ARF1 mRNA CTD PMID:19770486 Arf1 Rat cyclosporin A increases expression ISO ARF1 (Homo sapiens) 6480464 Cyclosporine results in increased expression of ARF1 mRNA CTD PMID:20106945 and PMID:25562108 Arf1 Rat DDT decreases expression EXP 6480464 DDT results in decreased expression of ARF1 mRNA CTD PMID:19797855 Arf1 Rat dexamethasone multiple interactions ISO ARF1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of ARF1 mRNA CTD PMID:28628672 Arf1 Rat diarsenic trioxide increases expression ISO ARF1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of ARF1 mRNA CTD PMID:20458559 Arf1 Rat dichlorine multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in decreased expression of ARF1 mRNA CTD PMID:18636392 Arf1 Rat dorsomorphin multiple interactions ISO ARF1 (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ARF1 mRNA CTD PMID:27188386 Arf1 Rat enzyme inhibitor multiple interactions ISO ARF1 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of ARF1 protein CTD PMID:23301498 Arf1 Rat erlotinib hydrochloride decreases response to substance ISO ARF1 (Homo sapiens) 6480464 ARF1 mRNA results in decreased susceptibility to Erlotinib Hydrochloride CTD PMID:23125191 Arf1 Rat ethanol multiple interactions ISO ARF1 (Homo sapiens) 6480464 [[Gasoline co-treated with Ethanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in increased expression of ARF1 mRNA CTD PMID:29432896 Arf1 Rat ethanol affects splicing ISO Arf1 (Mus musculus) 6480464 Ethanol affects the splicing of ARF1 mRNA CTD PMID:30319688 Arf1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of ARF1 mRNA CTD PMID:24136188 Arf1 Rat folic acid multiple interactions ISO Arf1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of ARF1 gene CTD PMID:20938992 Arf1 Rat folic acid decreases expression ISO Arf1 (Mus musculus) 6480464 Folic Acid results in decreased expression of ARF1 mRNA CTD PMID:25629700 Arf1 Rat folpet increases expression ISO Arf1 (Mus musculus) 6480464 folpet results in increased expression of ARF1 mRNA CTD PMID:31558096 Arf1 Rat gemcitabine decreases expression ISO ARF1 (Homo sapiens) 6480464 Gemcitabine results in decreased expression of ARF1 mRNA CTD PMID:17039268 Arf1 Rat genistein decreases expression ISO ARF1 (Homo sapiens) 6480464 Genistein results in decreased expression of ARF1 mRNA CTD PMID:16705744 Arf1 Rat haloperidol decreases expression EXP 6480464 Haloperidol results in decreased expression of ARF1 mRNA CTD PMID:15860345 Arf1 Rat hydralazine multiple interactions ISO ARF1 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of ARF1 mRNA CTD PMID:17183730 Arf1 Rat hydrogen peroxide multiple interactions ISO ARF1 (Homo sapiens) 6480464 [Hydrogen Peroxide co-treated with Theophylline] results in increased expression of ARF1 protein CTD PMID:18951874 Arf1 Rat indometacin multiple interactions ISO ARF1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of ARF1 mRNA CTD PMID:28628672 Arf1 Rat irinotecan multiple interactions ISO ARF1 (Homo sapiens) 6480464 ARF1 protein affects the susceptibility to [Fluorouracil co-treated with Irinotecan analog] CTD PMID:18927307 Arf1 Rat irinotecan decreases expression ISO ARF1 (Homo sapiens) 6480464 Irinotecan analog results in decreased expression of ARF1 mRNA CTD PMID:18927307 Arf1 Rat ivermectin decreases expression ISO ARF1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of ARF1 protein CTD PMID:32959892 Arf1 Rat josamycin affects response to substance ISO ARF1 (Homo sapiens) 6480464 ARF1 protein affects the susceptibility to Josamycin CTD PMID:31915244 Arf1 Rat L-methionine multiple interactions ISO Arf1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of ARF1 gene CTD PMID:20938992 Arf1 Rat N-formyl-L-methionyl-L-leucyl-L-phenylalanine affects localization ISO ARF1 (Homo sapiens) 6480464 N-Formylmethionine Leucyl-Phenylalanine affects the localization of ARF1 protein CTD PMID:10931844 Arf1 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of ARF1 mRNA CTD PMID:24136188 Arf1 Rat nicotine multiple interactions ISO Arf1 (Mus musculus) 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 Arf1 Rat ozone multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in decreased expression of ARF1 mRNA CTD PMID:18636392 Arf1 Rat p-chloromercuribenzoic acid increases expression ISO ARF1 (Homo sapiens) 6480464 p-Chloromercuribenzoic Acid results in increased expression of ARF1 mRNA CTD PMID:26272509 Arf1 Rat p-chloromercuribenzoic acid multiple interactions ISO ARF1 (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ARF1 mRNA CTD PMID:27188386 Arf1 Rat paraquat affects expression EXP 6480464 Paraquat affects the expression of ARF1 mRNA CTD PMID:15206577 Arf1 Rat phorbol 13-acetate 12-myristate affects localization ISO ARF1 (Homo sapiens) 6480464 Tetradecanoylphorbol Acetate affects the localization of ARF1 protein CTD PMID:10931844 Arf1 Rat pyrogallol increases expression ISO Arf1 (Mus musculus) 6480464 Pyrogallol results in increased expression of ARF1 mRNA CTD PMID:20362636 Arf1 Rat resveratrol increases expression ISO Arf1 (Mus musculus) 6480464 resveratrol results in increased expression of ARF1 protein CTD PMID:25505154 Arf1 Rat SB 431542 multiple interactions ISO ARF1 (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ARF1 mRNA CTD PMID:27188386 Arf1 Rat sodium arsenate multiple interactions ISO ARF1 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of ARF1 mRNA CTD PMID:32525701 Arf1 Rat sodium arsenite multiple interactions ISO ARF1 (Homo sapiens) 6480464 sodium arsenite promotes the reaction [ARF1 protein binds to CAPRIN1 protein] CTD PMID:33939924 Arf1 Rat tamoxifen affects expression ISO Arf1 (Mus musculus) 6480464 Tamoxifen affects the expression of ARF1 mRNA CTD PMID:17555576 Arf1 Rat temozolomide affects response to substance ISO ARF1 (Homo sapiens) 6480464 ARF1 mRNA affects the susceptibility to temozolomide CTD PMID:16365179 Arf1 Rat tetrachloromethane increases expression ISO Arf1 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of ARF1 mRNA CTD PMID:31919559 Arf1 Rat theophylline multiple interactions ISO ARF1 (Homo sapiens) 6480464 [Hydrogen Peroxide co-treated with Theophylline] results in increased expression of ARF1 protein CTD PMID:18951874 Arf1 Rat titanium dioxide increases methylation ISO Arf1 (Mus musculus) 6480464 titanium dioxide results in increased methylation of ARF1 gene CTD PMID:35295148 Arf1 Rat titanium dioxide decreases methylation ISO Arf1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of ARF1 gene CTD PMID:35295148 Arf1 Rat trichostatin A increases expression ISO ARF1 (Homo sapiens) 6480464 trichostatin A results in increased expression of ARF1 mRNA CTD PMID:24935251 Arf1 Rat triphenyl phosphate affects expression ISO ARF1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of ARF1 mRNA CTD PMID:37042841 Arf1 Rat valproic acid affects expression ISO Arf1 (Mus musculus) 6480464 Valproic Acid affects the expression of ARF1 mRNA CTD PMID:17292431 and PMID:17963808 Arf1 Rat valproic acid increases expression ISO ARF1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of ARF1 mRNA CTD PMID:23179753 and PMID:27188386 Arf1 Rat valproic acid multiple interactions ISO ARF1 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of ARF1 mRNA CTD PMID:17183730 Arf1 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of ARF1 mRNA CTD PMID:23034163 Arf1 Rat vincristine increases expression ISO ARF1 (Homo sapiens) 6480464 Vincristine results in increased expression of ARF1 mRNA CTD PMID:23649840
Imported Annotations - PID (archival)
(S)-nicotine (ISO) 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,4,6-trinitrotoluene (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 5-fluorouracil (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) Aroclor 1254 (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) bexarotene (EXP) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) cadmium atom (ISO) caffeine (ISO) captan (ISO) carmustine (ISO) chlorpyrifos (ISO) choline (ISO) cisplatin (ISO) clofibrate (ISO) copper atom (ISO) copper(0) (ISO) cyclosporin A (ISO) DDT (EXP) dexamethasone (ISO) diarsenic trioxide (ISO) dichlorine (EXP) dorsomorphin (ISO) enzyme inhibitor (ISO) erlotinib hydrochloride (ISO) ethanol (ISO) flutamide (EXP) folic acid (ISO) folpet (ISO) gemcitabine (ISO) genistein (ISO) haloperidol (EXP) hydralazine (ISO) hydrogen peroxide (ISO) indometacin (ISO) irinotecan (ISO) ivermectin (ISO) josamycin (ISO) L-methionine (ISO) N-formyl-L-methionyl-L-leucyl-L-phenylalanine (ISO) nefazodone (EXP) nicotine (ISO) ozone (EXP) p-chloromercuribenzoic acid (ISO) paraquat (EXP) phorbol 13-acetate 12-myristate (ISO) pyrogallol (ISO) resveratrol (ISO) SB 431542 (ISO) sodium arsenate (ISO) sodium arsenite (ISO) tamoxifen (ISO) temozolomide (ISO) tetrachloromethane (ISO) theophylline (ISO) titanium dioxide (ISO) trichostatin A (ISO) triphenyl phosphate (ISO) valproic acid (ISO) vinclozolin (EXP) vincristine (ISO)
1.
ARF-induced lysosomal lysis in vitro.
Arai K, etal., J Biochem. 1998 Apr;123(4):637-43.
2.
Role of ADP ribosylation factor 1 in the assembly and secretion of ApoB-100-containing lipoproteins.
Asp L, etal., Arterioscler Thromb Vasc Biol. 2005 Mar;25(3):566-70. Epub 2004 Dec 23.
3.
Formation of nascent secretory vesicles from the trans-Golgi network of endocrine cells is inhibited by tyrosine kinase and phosphatase inhibitors.
Austin CD and Shields D, J Cell Biol. 1996 Dec;135(6 Pt 1):1471-83.
4.
Membrane curvature induced by Arf1-GTP is essential for vesicle formation.
Beck R, etal., Proc Natl Acad Sci U S A. 2008 Aug 19;105(33):11731-6. doi: 10.1073/pnas.0805182105. Epub 2008 Aug 8.
5.
Translocation of Arf1 to the secretory granules in rat parotid acinar cells.
Dohke Y, etal., Arch Biochem Biophys. 1998 Sep 1;357(1):147-54.
6.
Differential expression and targeting of endogenous Arf1 and Arf6 small GTPases in kidney epithelial cells in situ.
El-Annan J, etal., Am J Physiol Cell Physiol. 2004 Apr;286(4):C768-78. Epub 2003 Dec 18.
7.
A function for the AP3 coat complex in synaptic vesicle formation from endosomes.
Faundez V, etal., Cell. 1998 May 1;93(3):423-32.
8.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
9.
The structure of rat ADP-ribosylation factor-1 (ARF-1) complexed to GDP determined from two different crystal forms.
Greasley SE, etal., Nat Struct Biol. 1995 Sep;2(9):797-806.
10.
Binding and functions of ADP-ribosylation factor on mammalian and yeast peroxisomes.
Lay D, etal., J Biol Chem. 2005 Oct 14;280(41):34489-99. Epub 2005 Aug 12.
11.
Effect of protein kinase A activity on the association of ADP-ribosylation factor 1 to golgi membranes.
Martin ME, etal., J Biol Chem. 2000 Jun 23;275(25):19050-9.
12.
Activation of rat brain phospholipase D by ADP-ribosylation factors 1,5, and 6: separation of ADP-ribosylation factor-dependent and oleate-dependent enzymes.
Massenburg D, etal., Proc Natl Acad Sci U S A. 1994 Nov 22;91(24):11718-22.
13.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
14.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
15.
ADP-ribosylation factor 1 protein regulates trypsinogen activation via organellar trafficking of procathepsin B protein and autophagic maturation in acute pancreatitis.
Orlichenko L, etal., J Biol Chem. 2012 Jul 13;287(29):24284-93. doi: 10.1074/jbc.M111.328815. Epub 2012 May 8.
16.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
17.
Interspecies relationships among ADP-ribosylation factors (ARFs): evidence of evolutionary pressure to maintain individual identities.
Price SR, etal., Mol Cell Biochem 1996 Jun 7;159(1):15-23.
18.
GOA pipeline
RGD automated data pipeline
19.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
20.
The small GTPase Arf1 modulates Arp2/3-mediated actin polymerization via PICK1 to regulate synaptic plasticity.
Rocca DL, etal., Neuron. 2013 Jul 24;79(2):293-307. doi: 10.1016/j.neuron.2013.05.003.
21.
Arf-1 (ADP-ribosylation factor-1) is involved in the activation of a mammalian Na+-selective current.
Straube S and Parekh AB, Biochem J 2004 Jan 15;377(Pt 2):539-44.
22.
Effects of brefeldin A and accessory proteins on association of ADP-ribosylation factors 1, 3, and 5 with Golgi.
Tsai SC, etal., J Biol Chem. 1993 May 25;268(15):10820-5.
23.
Activation of exocytosis by cross-linking of the IgE receptor is dependent on ADP-ribosylation factor 1-regulated phospholipase D in RBL-2H3 mast cells: evidence that the mechanism of activation is via regulation of phosphatidylinositol 4,5-bisphosphate synthesis.
Way G, etal., Biochem J. 2000 Feb 15;346 Pt 1:63-70.
24.
Role of Arf1 in endosomal trafficking of protein-metal complexes and cadmium-metallothionein-1 toxicity in kidney proximal tubule cells.
Wolff NA, etal., Toxicol Lett. 2011 Jun 24;203(3):210-8. doi: 10.1016/j.toxlet.2011.03.014. Epub 2011 Mar 21.
25.
Expression of a dominant allele of human ARF1 inhibits membrane traffic in vivo.
Zhang CJ, etal., J Cell Biol. 1994 Feb;124(3):289-300.
Arf1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 44,497,543 - 44,513,994 (-) NCBI GRCr8 mRatBN7.2 10 43,997,983 - 44,014,461 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 43,997,986 - 44,014,434 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 48,692,668 - 48,708,202 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 48,183,026 - 48,198,560 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 43,686,624 - 43,702,158 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 45,562,700 - 45,579,214 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 45,563,547 - 45,579,029 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 45,318,170 - 45,334,673 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 45,516,609 - 45,532,091 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 45,529,387 - 45,545,841 (-) NCBI Celera 10 43,262,080 - 43,277,562 (-) NCBI Celera Cytogenetic Map 10 q22 NCBI
ARF1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 228,082,708 - 228,099,212 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 228,082,708 - 228,099,212 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 228,270,409 - 228,286,913 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 226,336,984 - 226,353,536 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 224,577,163 - 224,593,645 NCBI Celera 1 201,460,593 - 201,477,145 (+) NCBI Celera Cytogenetic Map 1 q42.13 NCBI HuRef 1 198,785,590 - 198,802,034 (+) NCBI HuRef CHM1_1 1 229,542,706 - 229,559,258 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 227,271,693 - 227,288,198 (+) NCBI T2T-CHM13v2.0
Arf1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 59,102,237 - 59,119,042 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 59,102,238 - 59,119,096 (-) Ensembl GRCm39 Ensembl GRCm38 11 59,211,412 - 59,228,267 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 59,211,412 - 59,228,270 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 59,024,914 - 59,041,769 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 59,027,608 - 59,044,381 (-) NCBI MGSCv36 mm8 Celera 11 63,976,432 - 63,993,249 (-) NCBI Celera Cytogenetic Map 11 B1.3 NCBI cM Map 11 37.05 NCBI
Arf1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955581 319,942 - 335,112 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955581 319,942 - 335,112 (-) NCBI ChiLan1.0 ChiLan1.0
ARF1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 21,507,248 - 21,523,835 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 21,445,519 - 21,462,037 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 203,484,803 - 203,501,395 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 208,695,615 - 208,712,105 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 208,695,615 - 208,712,105 (+) Ensembl panpan1.1 panPan2
ARF1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 14 835,476 - 836,424 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 14 835,476 - 836,424 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 14 315,387 - 316,334 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 14 554,686 - 568,903 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 14 554,687 - 568,881 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 14 746,548 - 747,495 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 14 527,341 - 528,288 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 14 513,272 - 514,220 (-) NCBI UU_Cfam_GSD_1.0
Arf1
ARF1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 51,219,667 - 51,237,639 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 51,219,597 - 51,237,640 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 53,874,559 - 53,892,570 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ARF1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 25 1,628,836 - 1,644,502 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 25 1,628,751 - 1,644,499 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666055 1,510,307 - 1,525,996 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Arf1
.
Predicted Target Of
Count of predictions: 137 Count of miRNA genes: 108 Interacting mature miRNAs: 125 Transcripts: ENSRNOT00000074900 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
61441 Btemp1 Thermal response to stress QTL 1 4 body temperature trait (VT:0005535) core body temperature (CMO:0001036) 10 35392457 63642539 Rat 9589136 Insul27 Insulin level QTL 27 10.46 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 10 11474010 56474010 Rat 152025229 Scl83 Serum cholesterol level QTL 83 4.33 blood cholesterol amount (VT:0000180) 10 35710580 68663659 Rat 1578779 Tcas10 Tongue tumor susceptibility QTL 10 3.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 10 31297439 76297439 Rat 631564 Apr3 Acute phase response QTL 3 3.9 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 10 15275955 60275955 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 631552 Vetf2 Vascular elastic tissue fragility QTL 2 4.5 0.0002 aorta elastic tissue integrity trait (VT:0010556) artery internal elastic lamina non-tumorous lesion count (CMO:0001913) 10 41142633 86142633 Rat 631554 Bp133 Blood pressure QTL 133 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 743364 63851208 Rat 631557 Bp136 Blood pressure QTL 136 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 30632053 75632053 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1298078 Stresp5 Stress response QTL 5 2.99 0.00025 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 42045676 104670812 Rat 1578761 Stresp21 Stress response QTL 21 3.3 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 6375746 51375746 Rat 2298544 Neuinf9 Neuroinflammation QTL 9 4.6 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 10 5801990 62146030 Rat 61332 Eau3 Experimental allergic uveoretinitis QTL 3 0.004 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 10 34490559 45579777 Rat 10401803 Kidm50 Kidney mass QTL 50 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 10 418344 45418344 Rat 61463 Bp12 Blood pressure QTL 12 6.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 41333258 86333258 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 1598852 Anxrr19 Anxiety related response QTL 19 5.07 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 10 18167841 63167841 Rat 1581497 Esta1 Estrogen-induced thymic atrophy QTL 1 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 21329805 61345413 Rat 2313095 Bss62 Bone structure and strength QTL 62 1.5 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 724527 Bp148 Blood pressure QTL 148 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 28453136 73453136 Rat 1358897 Stresp6 Stress response QTL 6 4.17 0.022 blood norepinephrine amount (VT:0005663) plasma norepinephrine level (CMO:0001010) 10 35392267 64155584 Rat 1331762 Rf40 Renal function QTL 40 3.873 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 10 29299504 64155584 Rat 2300171 Bmd58 Bone mineral density QTL 58 4.9 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 26944628 71944628 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2301967 Cm73 Cardiac mass QTL 73 4.55 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 10 14487011 89062041 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 70188 BpQTLcluster1 Blood pressure QTL cluster 1 4.864 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 42323132 87323132 Rat 2313104 Bss61 Bone structure and strength QTL 61 0.9 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 9590310 Scort19 Serum corticosterone level QTL 19 6.3 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 10402859 Bp381 Blood pressure QTL 381 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 70198 BpQTLcluster9 Blood pressure QTL cluster 9 2.94 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 42323132 87323132 Rat 6893352 Bw100 Body weight QTL 100 0.33 0.6 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 724556 Pur2 Proteinuria QTL 2 5.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 22427500 90627625 Rat 8662860 Vetf10 Vascular elastic tissue fragility QTL 10 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 10 6154182 73453136 Rat 2313066 Bss63 Bone structure and strength QTL 63 1.4 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 10 5387014 50387014 Rat 2313064 Bmd71 Bone mineral density QTL 71 0.9 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 10 5387014 50387014 Rat 70223 Bp57 Blood pressure QTL 57 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 1 80676123 Rat 1354587 Kidm21 Kidney mass QTL 21 3.3 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 10 15028513 60430477 Rat 6893350 Bw99 Body weight QTL 99 0.87 0.16 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 2317043 Aia7 Adjuvant induced arthritis QTL 7 3.82 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 37565079 82565079 Rat 70224 Eae3 Experimental allergic encephalomyelitis QTL 3 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 10 26521957 61345413 Rat 2317042 Aia20 Adjuvant induced arthritis QTL 20 3.38 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 37565079 82565079 Rat 2313081 Bss64 Bone structure and strength QTL 64 1.3 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 10 5387014 50387014 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 2313087 Bmd80 Bone mineral density QTL 80 3.2 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 10 19606483 64606483 Rat 1354614 Hpcl1 Hepatic cholesterol level QTL 1 3.3 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 35392267 51793994 Rat 631532 Cm50 Cardiac mass QTL 50 6.6 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 10 17907113 51786432 Rat 1576319 Cia29 Collagen induced arthritis QTL 29 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 33973921 78973921 Rat 8552805 Bw145 Body weight QTL 145 2.2 body mass (VT:0001259) change in body weight to body weight ratio (CMO:0002216) 10 41944526 78307017 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1600371 Mcs21 Mammary carcinoma susceptibility QTL 21 3 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 28875650 52200160 Rat 1576308 Schws1 Schwannoma susceptibility QTL 1 0.0041 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 40035094 102359817 Rat 631269 Cia22 Collagen induced arthritis QTL 22 8.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 9590268 Scort13 Serum corticosterone level QTL 13 3.26 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 1576311 Pia26 Pristane induced arthritis QTL 26 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 31224026 75632053 Rat 631270 Cia23 Collagen induced arthritis QTL 23 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 6893342 Cm78 Cardiac mass QTL 78 0.1 0.88 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 42876766 79813922 Rat 2292441 Bp308 Blood pressure QTL 308 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2313055 Bw96 Body weight QTL 96 3.6 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 10 19606483 64606483 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat
RH134612
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 43,997,921 - 43,998,116 (+) MAPPER mRatBN7.2 Rnor_6.0 10 45,562,639 - 45,562,833 NCBI Rnor6.0 Rnor_5.0 10 45,318,109 - 45,318,303 UniSTS Rnor5.0 RGSC_v3.4 10 45,515,701 - 45,515,895 UniSTS RGSC3.4 Celera 10 43,261,172 - 43,261,366 UniSTS RH 3.4 Map 10 503.4 UniSTS Cytogenetic Map 10 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000080028 ⟹ ENSRNOP00000072575
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 43,997,986 - 44,014,434 (-) Ensembl Rnor_6.0 Ensembl 10 45,563,547 - 45,579,029 (-) Ensembl
RefSeq Acc Id:
NM_001414037 ⟹ NP_001400966
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 44,497,543 - 44,513,994 (-) NCBI mRatBN7.2 10 43,997,983 - 44,014,434 (-) NCBI
RefSeq Acc Id:
NM_001414038 ⟹ NP_001400967
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 44,497,543 - 44,513,994 (-) NCBI mRatBN7.2 10 43,997,983 - 44,014,434 (-) NCBI
RefSeq Acc Id:
NM_022518 ⟹ NP_071963
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 44,497,543 - 44,513,994 (-) NCBI mRatBN7.2 10 43,997,983 - 44,014,434 (-) NCBI Rnor_6.0 10 45,563,547 - 45,579,029 (-) NCBI Rnor_5.0 10 45,318,170 - 45,334,673 (-) NCBI RGSC_v3.4 10 45,516,609 - 45,532,091 (-) RGD Celera 10 43,262,080 - 43,277,562 (-) RGD
Sequence:
GCGGCTGCTAAGGACCGAGTCTGGTCGGGCGGCCTGAGGTCTCTGGCCAGTATCGCTTCCACCTGTCCACAAACATGGGGAATATCTTTGCAAACCTCTTCAAGGGCCTTTTTGGCAAAAAAGAAATG
hide sequence
RefSeq Acc Id:
XM_063269815 ⟹ XP_063125885
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 44,497,546 - 44,507,204 (-) NCBI
RefSeq Acc Id:
NP_071963 ⟸ NM_022518
- UniProtKB:
P84079 (UniProtKB/Swiss-Prot), A6HEZ7 (UniProtKB/TrEMBL), A0A8I5ZKF2 (UniProtKB/TrEMBL)
- Sequence:
MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQ
hide sequence
Ensembl Acc Id:
ENSRNOP00000072575 ⟸ ENSRNOT00000080028
RefSeq Acc Id:
NP_001400967 ⟸ NM_001414038
- UniProtKB:
P84079 (UniProtKB/Swiss-Prot), A6HEZ7 (UniProtKB/TrEMBL), A0A8I5ZKF2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001400966 ⟸ NM_001414037
- UniProtKB:
P84079 (UniProtKB/Swiss-Prot), A6HEZ7 (UniProtKB/TrEMBL), A0A8I5ZKF2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063125885 ⟸ XM_063269815
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I5ZKF2 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2024-11-07
Arf1
ARF GTPase 1
Arf1
ADP-ribosylation factor 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-09-10
Arf1
ADP-ribosylation factor 1
Symbol and Name status set to approved
1299863 APPROVED
2002-08-07
Arf1
ADP-ribosylation factor 1
Symbol and Name status set to provisional
70820 PROVISIONAL
