Advanced Search (OLGA)

Gene: Max (MYC associated transcriptional regulator X) Rattus norvegicus

Analyze

Symbol:

Max

Name:

MYC associated transcriptional regulator X (Ensembl:MYC associated factor X)

RGD ID:

621101

Description:

Enables DNA-binding transcription factor activity; identical protein binding activity; and sequence-specific DNA binding activity. Involved in several processes, including cellular response to peptide hormone stimulus; regulation of gene expression; and response to insulin. Located in PML body and dendrite. Human ortholog(s) of this gene implicated in lung small cell carcinoma and pheochromocytoma. Orthologous to human MAX (MYC associated factor X); PARTICIPATES IN mitogen activated protein kinase signaling pathway; small cell lung carcinoma pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

MGC124611; MYC associated factor X; myc-associated factor X

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MAX (MYC associated transcriptional regulator X)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Max (Max protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Max (MYC associated transcriptional regulator X)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MAX (MYC associated transcriptional regulator X)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MAX (MYC associated factor X)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Max (MYC associated transcriptional regulator X)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	MAX (MYC associated factor X)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	MAX (MYC associated transcriptional regulator X)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Max (MYC associated transcriptional regulator X)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Max (MYC associated transcriptional regulator X)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	CRACR2B (calcium release activated channel regulator 2B)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	MAX (MYC associated transcriptional regulator X)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	MAX (MYC associated transcriptional regulator X)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Max (Max protein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Max (Max protein)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	max (myc associated factor X)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	mxl-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	mxl-1	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	Max	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Max	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	mxl-3	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	max	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	max	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Related Pseudogenes:

Max-ps1

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	101,369,989 - 101,395,333 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	6	101,369,988 - 101,395,549 (-)	Ensembl				GRCr8
mRatBN7.2	6	95,636,859 - 95,662,204 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	95,636,858 - 95,662,137 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	6	96,033,070 - 96,056,884 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	96,331,618 - 96,355,431 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	95,760,430 - 95,784,244 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	99,984,260 - 100,011,460 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	99,984,260 - 100,011,388 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	6	109,378,844 - 109,403,792 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	6	99,529,905 - 99,553,851 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	6	94,056,185 - 94,080,083 (-)	NCBI		Celera
RGSC_v3.1	6	99,533,360 - 99,557,307 (-)	NCBI
Cytogenetic Map	6	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Hereditary Neoplastic Syndromes (ISO)

Hereditary Paraganglioma-Pheochromocytoma Syndromes (ISO)

lung small cell carcinoma (ISO)

nephroblastoma (ISO)

paraganglioma (ISO)

pheochromocytoma (ISO)

Polydactyly-Macrocephaly Syndrome (ISO)

retinoblastoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17beta-estradiol (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (EXP)

all-trans-retinoic acid (ISO)

amitrole (EXP)

amphetamine (EXP)

antirheumatic drug (ISO)

Aroclor 1254 (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

atrazine (ISO)

benzo[a]pyrene diol epoxide I (ISO)

beta-lapachone (ISO)

bisphenol A (EXP,ISO)

cadmium dichloride (EXP,ISO)

casticin (ISO)

chlorpyrifos (ISO)

chromium(6+) (ISO)

copper atom (ISO)

copper(0) (ISO)

coumestrol (ISO)

cyclosporin A (ISO)

diarsenic trioxide (ISO)

dichlorine (EXP)

dorsomorphin (ISO)

doxorubicin (ISO)

elemental selenium (ISO)

endosulfan (ISO)

FR900359 (ISO)

fulvestrant (ISO)

genistein (ISO)

gentamycin (EXP)

indole-3-methanol (EXP)

lead(0) (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

mangiferin (ISO)

methoxychlor (EXP)

N-methyl-N'-nitro-N-nitrosoguanidine (ISO)

ozone (EXP)

paracetamol (ISO)

pirinixic acid (ISO)

resveratrol (ISO)

SB 431542 (ISO)

selenium atom (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

sunitinib (ISO)

thapsigargin (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

valproic acid (ISO)

vincristine (ISO)

zinc atom (EXP)

zinc(0) (EXP)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to peptide hormone stimulus (IEP)

cellular response to starvation (IEP)

negative regulation of gene expression (IDA)

negative regulation of transcription by RNA polymerase II (ISO)

neuron apoptotic process (IEP)

positive regulation of DNA-templated transcription (ISO)

positive regulation of transcription by RNA polymerase II (IBA,ISO)

protein-containing complex assembly (IDA)

regulation of DNA-templated transcription (IEA,IMP,ISO)

regulation of transcription by RNA polymerase II (ISO)

response to axon injury (IEP)

response to insulin (IEP)

retina development in camera-type eye (IEP)

Cellular Component

chromatin (ISO)

dendrite (IDA,IEA)

Mad-Max complex (ISO)

MLL1 complex (ISO,ISS)

Myc-Max complex (ISO)

nucleoplasm (ISO)

nucleus (IDA,IEA,ISO)

PML body (IDA)

protein-DNA complex (ISO)

RNA polymerase II transcription regulator complex (IBA,ISO)

RNA polymerase II transcription repressor complex (ISO)

Molecular Function

DNA binding (IEA,ISO)

DNA-binding transcription factor activity (IBA,IEA,IMP)

DNA-binding transcription factor activity, RNA polymerase II-specific (ISO)

DNA-binding transcription factor binding (ISO)

DNA-binding transcription repressor activity, RNA polymerase II-specific (ISO,ISS)

E-box binding (ISO)

identical protein binding (IPI,ISO)

protein binding (IPI,ISO)

protein dimerization activity (IEA)

protein-containing complex binding (IDA,IPI)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (ISO)

RNA polymerase II transcription regulatory region sequence-specific DNA binding (ISO)

sequence-specific DNA binding (IDA)

sequence-specific double-stranded DNA binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

mitogen activated protein kinase signaling pathway (IEA)

small cell lung carcinoma pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Involvement of c-myc and max in CNS beta-endorphin modulation of hepatic ornithine decarboxylase responsiveness to insulin in rat pups.	Bartolome JV, etal., Life Sci. 1999;64(5):PL87-91.
2.	Small-molecule antagonists of Myc/Max dimerization inhibit Myc-induced transformation of chicken embryo fibroblasts.	Berg T, etal., Proc Natl Acad Sci U S A. 2002 Mar 19;99(6):3830-5. Epub 2002 Mar 12.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	The nerve growth factor-responsive PC12 cell line does not express the Myc dimerization partner Max.	Hopewell R and Ziff EB, Mol Cell Biol. 1995 Jul;15(7):3470-8.
5.	Molecular cloning and sequencing of rat Max cDNA: castration-induced expression of the 2 kb transcript in male accessory sex organs of rats.	Izawa M Biochim Biophys Acta 1993 Dec 14;1216(3):492-4.
6.	c-Myc and ChREBP regulate glucose-mediated expression of the L-type pyruvate kinase gene in INS-1-derived 832/13 cells.	Jason Collier J, etal., Am J Physiol Endocrinol Metab. 2007 Jul;293(1):E48-56. Epub 2007 Mar 6.
7.	Induction of a novel histone deacetylase 1/c-Myc/Mnt/Max complex formation is implicated in parity-induced refractoriness to mammary carcinogenesis.	Matsuoka Y, etal., Cancer Sci. 2008 Feb;99(2):309-15.
8.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
9.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
10.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
11.	Early nuclear exclusion of the transcription factor max is associated with retinal ganglion cell death independent of caspase activity.	Petrs-Silva H, etal., J Cell Physiol. 2004 Feb;198(2):179-87.
12.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
13.	Abelson interacting protein 1 (Abi-1) is essential for dendrite morphogenesis and synapse formation.	Proepper C, etal., EMBO J. 2007 Mar 7;26(5):1397-409. Epub 2007 Feb 15.
14.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
15.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
16.	MAX inactivation in small cell lung cancer disrupts MYC-SWI/SNF programs and is synthetic lethal with BRG1.	Romero OA, etal., Cancer Discov. 2014 Mar;4(3):292-303. doi: 10.1158/2159-8290.CD-13-0799. Epub 2013 Dec 20.
17.	Induction of max by adrenomedullin and calcitonin gene-related peptide antagonizes endothelial apoptosis.	Shichiri M, etal., Mol Endocrinol. 1999 Aug;13(8):1353-63.
18.	c-Myc localization within the nucleus: evidence for association with the PML nuclear body.	Smith KP, etal., J Cell Biochem. 2004 Dec 15;93(6):1282-96.
19.	Expression and subcellular localization of the Myc superfamily proteins: c-Myc, Max, Mad1 and Mxi1 in the epiphyseal plate cartilage chondrocytes of growing rats.	Wang Y, etal., Cell Mol Biol (Noisy-le-grand). 1997 Mar;43(2):175-88.

Additional References at PubMed

PMID:8425219	PMID:8521822	PMID:9399572	PMID:10601024	PMID:12477932	PMID:12837246	PMID:12970171	PMID:15358760	PMID:15960975	PMID:16150871	PMID:16171389	PMID:18601921
PMID:20197614	PMID:22770845	PMID:26070438	PMID:35103748

Genomics

Comparative Map Data

Max
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	101,369,989 - 101,395,333 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	6	101,369,988 - 101,395,549 (-)	Ensembl				GRCr8
mRatBN7.2	6	95,636,859 - 95,662,204 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	95,636,858 - 95,662,137 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	6	96,033,070 - 96,056,884 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	96,331,618 - 96,355,431 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	95,760,430 - 95,784,244 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	99,984,260 - 100,011,460 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	99,984,260 - 100,011,388 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	6	109,378,844 - 109,403,792 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	6	99,529,905 - 99,553,851 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	6	94,056,185 - 94,080,083 (-)	NCBI		Celera
RGSC_v3.1	6	99,533,360 - 99,557,307 (-)	NCBI
Cytogenetic Map	6	q24	NCBI

MAX
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	65,006,101 - 65,102,695 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	14	65,006,174 - 65,102,695 (-)	Ensembl			hg38	GRCh38
GRCh37	14	65,472,819 - 65,569,413 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	64,542,645 - 64,638,980 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	14	64,542,644 - 64,638,980	NCBI
Celera	14	45,527,481 - 45,623,823 (-)	NCBI		Celera
Cytogenetic Map	14	q23.3	NCBI
HuRef	14	45,642,154 - 45,738,669 (-)	NCBI		HuRef
CHM1_1	14	65,411,018 - 65,507,560 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	14	59,210,965 - 59,307,534 (-)	NCBI		T2T-CHM13v2.0

Max
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	12	76,984,045 - 77,009,123 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	12	76,984,043 - 77,008,975 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	12	76,937,269 - 76,962,323 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	12	76,937,269 - 76,962,201 (-)	Ensembl			mm10	GRCm38
MGSCv37	12	78,038,256 - 78,063,235 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	12	77,856,109 - 77,881,025 (-)	NCBI		MGSCv36	mm8
Celera	12	78,019,503 - 78,044,521 (-)	NCBI		Celera
Cytogenetic Map	12	C3	NCBI
cM Map	12	33.78	NCBI

Max
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955466	4,816,568 - 4,842,659 (+)	Ensembl
ChiLan1.0	NW_004955466	4,816,568 - 4,842,659 (+)	NCBI	ChiLan1.0	ChiLan1.0

MAX
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	15	66,113,395 - 66,216,485 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	14	65,329,908 - 65,432,998 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	14	45,588,366 - 45,683,828 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	14	64,467,753 - 64,562,671 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	14	64,535,120 - 64,562,671 (-)	Ensembl			panPan2	panpan1.1

MAX
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	8	39,441,216 - 39,465,703 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	8	39,380,686 - 39,465,959 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	8	39,133,226 - 39,157,709 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	8	39,664,047 - 39,688,532 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	8	39,603,427 - 39,688,561 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	8	39,284,778 - 39,309,267 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	8	39,357,282 - 39,381,777 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	8	39,716,473 - 39,740,975 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Max
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	65,435,802 - 65,462,758 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936495	8,728,940 - 8,755,799 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936495	8,728,941 - 8,755,742 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MAX
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	89,142,969 - 89,168,201 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	7	89,142,966 - 89,168,265 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	95,519,256 - 95,544,583 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MAX
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	24	42,288,891 - 42,314,711 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	24	42,291,106 - 42,314,605 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666053	30,463,237 - 30,488,861 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Max
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624734	35,925,827 - 35,952,375 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Max
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	7	91,069,908 - 91,095,141 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Max
104 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	746
Count of miRNA genes:	267
Interacting mature miRNAs:	322
Transcripts:	ENSRNOT00000010954, ENSRNOT00000041442
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
4145119	Mcs25	Mammary carcinoma susceptibility QTL 25		0.0001	mammary gland integrity trait (VT:0010552)	ratio of deaths to total study population during a period of time (CMO:0001023)	6	71278722	116278722	Rat
12801411	Schws8	Schwannoma susceptibility QTL 8			nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	100704576	101593851	Rat
70176	Mcsm1	Mammary carcinoma susceptibility modifier QTL 1			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	64367996	109367996	Rat
2293088	Iddm28	Insulin dependent diabetes mellitus QTL 28	5.21		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	6	68767270	135411972	Rat
1331799	Bp211	Blood pressure QTL 211	3.66407		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	88019181	136741135	Rat
10054138	Gmadr3	Adrenal mass QTL 3	3.68	0.00045	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	6	90871046	135871046	Rat
1581563	Uae33	Urinary albumin excretion QTL 33			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	93560258	136550638	Rat
1641917	Colcr5	Colorectal carcinoma resistance QTL 5	3.18	0.0009	intestine integrity trait (VT:0010554)	benign colorectal tumor number (CMO:0001795)	6	98944780	143944780	Rat
61414	Pia3	Pristane induced arthritis QTL 3	4.5		joint integrity trait (VT:0010548)	post-insult time to onset of experimental arthritis (CMO:0001450)	6	100704576	136029228	Rat
724524	Uae2	Urinary albumin excretion QTL 2	2.7	0.0005	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	79198463	144254945	Rat
737827	Hcar11	Hepatocarcinoma resistance QTL 11	4.4		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	6	46050607	116278722	Rat
2303624	Vencon5	Ventilatory control QTL 5	4.45		respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	6	93778632	138778632	Rat
1576309	Emca7	Estrogen-induced mammary cancer QTL 7	4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	20859430	113082285	Rat
2293837	Kiddil1	Kidney dilation QTL 1	3.7		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	86867923	110125012	Rat
61329	Eae9	Experimental allergic encephalomyelitis QTL 9	3.7		body mass (VT:0001259)	change in body weight (CMO:0002045)	6	84490437	129490437	Rat
2293842	Kiddil3	Kidney dilation QTL 3	4.3		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	86867923	110125012	Rat
10054123	Srcrt6	Stress Responsive Cort QTL 6	2.5	0.0043	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	90871046	135871046	Rat
724536	Uae7	Urinary albumin excretion QTL 7	3.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	6	93560258	136550638	Rat
1576302	Schws4	Schwannoma susceptibility QTL 4		0.0078	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	78204640	123204640	Rat
1581550	Pur8	Proteinuria QTL 8			urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	6	93560258	136550638	Rat
1300075	Glom7	Glomerulus QTL 7	5.6	0.0000002	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	6	76937178	121937178	Rat
1331789	Rf37	Renal function QTL 37	3.224		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	6	86494122	112380234	Rat
1331725	Bp212	Blood pressure QTL 212	3.52475		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	99437079	125323237	Rat
1331722	Thshl1	Thyroid stimulating hormone level QTL 1	11.7	0.0001	blood thyroid-stimulating hormone amount (VT:0005119)	serum thyroid stimulating hormone level (CMO:0001248)	6	99708426	112483760	Rat

Markers in Region

D6Got122

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	95,646,538 - 95,646,660 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	99,995,804 - 99,995,925	NCBI	Rnor6.0
Rnor_5.0	6	109,388,151 - 109,388,272	UniSTS	Rnor5.0
RGSC_v3.4	6	99,538,348 - 99,538,470	RGD	RGSC3.4
RGSC_v3.4	6	99,538,349 - 99,538,470	UniSTS	RGSC3.4
Celera	6	94,064,677 - 94,064,798	UniSTS
RGSC_v3.1	6	99,541,805 - 99,541,926	RGD
RH 3.4 Map	6	673.4	RGD
RH 3.4 Map	6	673.4	UniSTS
Cytogenetic Map	6	q24	UniSTS

BI277538

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	52,947,739 - 52,948,041 (+)	MAPPER	mRatBN7.2
mRatBN7.2	6	95,636,962 - 95,637,145 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	99,984,365 - 99,984,547	NCBI	Rnor6.0
Rnor_6.0	6	55,706,624 - 55,706,925	NCBI	Rnor6.0
Rnor_5.0	6	65,321,005 - 65,321,306	UniSTS	Rnor5.0
Rnor_5.0	6	109,378,949 - 109,379,131	UniSTS	Rnor5.0
RGSC_v3.4	6	54,941,318 - 54,941,619	UniSTS	RGSC3.4
RGSC_v3.4	6	99,528,751 - 99,528,933	UniSTS	RGSC3.4
Celera	6	94,055,031 - 94,055,213	UniSTS
Celera	6	52,090,030 - 52,090,333	UniSTS
RH 3.4 Map	6	669.3	UniSTS
Cytogenetic Map	6	q16	UniSTS
Cytogenetic Map	6	q24	UniSTS

RH128859

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	95,636,903 - 95,637,083 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	99,984,306 - 99,984,485	NCBI	Rnor6.0
Rnor_5.0	6	109,378,890 - 109,379,069	UniSTS	Rnor5.0
RGSC_v3.4	6	99,528,692 - 99,528,871	UniSTS	RGSC3.4
Celera	6	94,054,972 - 94,055,151	UniSTS
Cytogenetic Map	6	q24	UniSTS

AI237355

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	52,949,383 - 52,949,578 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	55,708,268 - 55,708,458	NCBI	Rnor6.0
RH 3.4 Map	6	362.7	UniSTS
Cytogenetic Map	6	q24	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001411963	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_022210	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NR_177987	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NR_177988	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NR_177989	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063262440	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063262441	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063262442	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_593084	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC099778	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473947	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D14447	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D14448	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212266	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220892	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000010954 ⟹ ENSRNOP00000010954

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	6	101,369,988 - 101,395,257 (-)	Ensembl
mRatBN7.2 Ensembl	6	95,636,858 - 95,662,128 (-)	Ensembl
Rnor_6.0 Ensembl	6	99,984,260 - 100,011,388 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000041442 ⟹ ENSRNOP00000040275

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	6	99,985,519 - 100,011,226 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000083286 ⟹ ENSRNOP00000072268

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	6	99,985,519 - 100,011,226 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000106817 ⟹ ENSRNOP00000086002

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	6	101,369,989 - 101,395,290 (-)	Ensembl
mRatBN7.2 Ensembl	6	95,636,862 - 95,662,137 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000107085 ⟹ ENSRNOP00000082617

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	6	101,369,989 - 101,395,290 (-)	Ensembl
mRatBN7.2 Ensembl	6	95,636,862 - 95,662,137 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000154227 ⟹ ENSRNOP00000112679

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	6	101,369,989 - 101,395,549 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000155514 ⟹ ENSRNOP00000109547

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	6	101,369,989 - 101,387,244 (-)	Ensembl

RefSeq Acc Id:

NM_001411963 ⟹ NP_001398892

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	101,369,989 - 101,395,290 (-)	NCBI
mRatBN7.2	6	95,636,859 - 95,662,161 (-)	NCBI

RefSeq Acc Id:

NM_022210 ⟹ NP_071546

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	101,369,989 - 101,395,290 (-)	NCBI
mRatBN7.2	6	95,636,859 - 95,662,161 (-)	NCBI
Rnor_6.0	6	99,985,519 - 100,011,226 (-)	NCBI
Rnor_5.0	6	109,378,844 - 109,403,792 (-)	NCBI
RGSC_v3.4	6	99,529,905 - 99,553,851 (-)	RGD
Celera	6	94,056,185 - 94,080,083 (-)	RGD

Sequence:

show sequence

ATGAGCGATAACGATGACATCGAGGTGGAGAGCGACGAAGAGCAACCGAGGTTTCAATCTGCGG
CTGACAAACGGGCTCACCATAATGCACTGGAACGAAAACGTAGGGACCACATCAAAGACAGCTT
TCACAGTTTGCGGGACTCAGTCCCATCACTCCAAGGAGAGAAGGCATCCCGGGCCCAAATCCTA
GACAAAGCAACAGAGTATATCCAGTATATGCGAAGGAAAAACCATACGCACCAGCAAGACATTG
ATGACCTCAAGCGGCAGAATGCTCTTCTGGAGCAACAAGTCCGTGCACTGGAGAAGGCAAGATC
AAGTGCCCAACTGCAGACCAACTACCCCTCCTCAGACAACAGCCTCTACACCAACGCCAAGGGC
GGCACCATCTCTGCCTTCGATGGGGGTTCAGACTCCAGCTCAGAGTCCGAGCCTGAGGAGCCCC
AGAACAGGAAGAAACTGCGGATGGAGGCCAGCTAA

hide sequence

RefSeq Acc Id:

NR_177987

RefSeq Status:

VALIDATED

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	101,369,989 - 101,395,290 (-)	NCBI
mRatBN7.2	6	95,636,859 - 95,662,161 (-)	NCBI

RefSeq Acc Id:

NR_177988

RefSeq Status:

VALIDATED

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	101,369,989 - 101,395,290 (-)	NCBI
mRatBN7.2	6	95,636,859 - 95,662,161 (-)	NCBI

RefSeq Acc Id:

NR_177989

RefSeq Status:

VALIDATED

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	101,369,989 - 101,395,290 (-)	NCBI
mRatBN7.2	6	95,636,859 - 95,662,161 (-)	NCBI

RefSeq Acc Id:

XM_063262440 ⟹ XP_063118510

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	101,369,989 - 101,395,333 (-)	NCBI

RefSeq Acc Id:

XM_063262441 ⟹ XP_063118511

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	101,369,989 - 101,395,001 (-)	NCBI

RefSeq Acc Id:

XM_063262442 ⟹ XP_063118512

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	101,369,989 - 101,395,325 (-)	NCBI

RefSeq Acc Id:

XR_593084

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	101,371,268 - 101,395,333 (-)	NCBI
mRatBN7.2	6	95,638,138 - 95,662,204 (-)	NCBI
Rnor_6.0	6	99,985,511 - 100,011,460 (-)	NCBI

Sequence:

show sequence

CCCGGTCACGTGTTAGGGGGCCGATCGGGCGTGCGTGCCGCCGTTGATCCGGTGCTACAGTGAG
GTGGTTGTCGCCCGTGTTGTGTGTGTGTGAGTGTGTGAGTGAGTGAGCGAGTGAGTGAGTGAGT
GTGTGCGTGGGGGCACTCGGCTTGTTGTTGTCGGTGACTTCCCCCTTCCCTCCACCCCTCCCCT
CCCCGGCCGCCGCTGCAGTGGCCGCTCCCTGGGCCGTAGGAAATGAGCGATAACGATGACATCG
AGGTGGAGAGCGACGAAGAGCAACCGAGGTTTCAATCTGCGGCTGACAAACGGGCTCACCATAA
TGCACTGGAACGAAAACGTAGGGACCACATCAAAGACAGCTTTCACAGTTTGCGGGACTCAGTC
CCATCACTCCAAGGAGAGAAGGCATCCCGGGCCCAAATCCTAGACAAAGCAACAGAGTATATCC
AGTATATGCGAAGGAAAAACCATACGCACCAGCAAGACATTGATGACCTCAAGCGGCAGAATGC
TCTTCTGGAGCAACAAGGGGAAAGCGAGAGCTGATCAAGTTCTTTGTTCCTGGGGAATTCACTT
CTCTTCCTCCCTCATGGAAGATGCAAGTAAAAGGAAATGCAAGTAACCACCTGGTCCGTGCACT
GGAGAAGGCAAGATCAAGTGCCCAACTGCAGACCAACTACCCCTCCTCAGACAACAGCCTCTAC
ACCAACGCCAAGGGCGGCACCATCTCTGCCTTCGATGGGGGTTCAGACTCCAGCTCAGAGTCCG
AGCCTGAGGAGCCCCAGAACAGGAAGAAACTGCGGATGGAGGCCAGCTAAGCCATGCG

hide sequence

Protein Sequences


Protein RefSeqs	NP_001398892	(Get FASTA)	NCBI Sequence Viewer
	NP_071546	(Get FASTA)	NCBI Sequence Viewer
	XP_063118510	(Get FASTA)	NCBI Sequence Viewer
	XP_063118511	(Get FASTA)	NCBI Sequence Viewer
	XP_063118512	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH99778	(Get FASTA)	NCBI Sequence Viewer
	BAA03337	(Get FASTA)	NCBI Sequence Viewer
	BAA03338	(Get FASTA)	NCBI Sequence Viewer
	EDM03679	(Get FASTA)	NCBI Sequence Viewer
	EDM03680	(Get FASTA)	NCBI Sequence Viewer
	EDM03681	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000010954
	ENSRNOP00000086002
	ENSRNOP00000086002.1
GenBank Protein	P52164	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_071546 ⟸ NM_022210
- Peptide Label:	isoform 1
- UniProtKB:	P52164 (UniProtKB/Swiss-Prot), A6HCC6 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQIL DKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDNSLYTNAKG GTISAFDGGSDSSSESEPEEPQNRKKLRMEAS hide sequence

Ensembl Acc Id:

ENSRNOP00000040275 ⟸ ENSRNOT00000041442

Ensembl Acc Id:

ENSRNOP00000072268 ⟸ ENSRNOT00000083286

Ensembl Acc Id:

ENSRNOP00000010954 ⟸ ENSRNOT00000010954

Ensembl Acc Id:

ENSRNOP00000086002 ⟸ ENSRNOT00000106817

Ensembl Acc Id:

ENSRNOP00000082617 ⟸ ENSRNOT00000107085

RefSeq Acc Id:	NP_001398892 ⟸ NM_001411963
- Peptide Label:	isoform 2
- UniProtKB:	A6HCC5 (UniProtKB/TrEMBL), A0A8I5ZV85 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063118510 ⟸ XM_063262440
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_063118512 ⟸ XM_063262442
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_063118511 ⟸ XM_063262441
- Peptide Label:	isoform X2
- UniProtKB:	Q499S8 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000112679 ⟸ ENSRNOT00000154227

Ensembl Acc Id:

ENSRNOP00000109547 ⟸ ENSRNOT00000155514

Protein Domains

bHLH

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P52164-F1-model_v2	AlphaFold	P52164	1-160	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13694690

Promoter ID:

EPDNEW_R5208

Type:

initiation region

Name:

Max_1

Description:

MYC associated factor X

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	6	100,011,404 - 100,011,464	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621101	AgrOrtholog
BioCyc Gene	G2FUF-37040	BioCyc
Ensembl Genes	ENSRNOG00000008049	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000010954	ENTREZGENE
	ENSRNOT00000106817	ENTREZGENE
	ENSRNOT00000106817.1	UniProtKB/Swiss-Prot
	ENSRNOT00000107085	ENTREZGENE
Gene3D-CATH	4.10.280.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7933028	IMAGE-MGC_LOAD
InterPro	bHLH_dom	UniProtKB/Swiss-Prot
	HLH_DNA-bd_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:60661	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:124611	IMAGE-MGC_LOAD
NCBI Gene	60661	ENTREZGENE
PANTHER	PROTEIN MAX	UniProtKB/Swiss-Prot
	PTHR10328	UniProtKB/Swiss-Prot
Pfam	HLH	UniProtKB/Swiss-Prot
PharmGKB	MAX	RGD
PhenoGen	Max	PhenoGen
PROSITE	BHLH	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000008049	RatGTEx
SMART	HLH	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF47459	UniProtKB/Swiss-Prot
UniProt	A0A0H2UHG2_RAT	UniProtKB/TrEMBL
	A0A8I5ZV85	ENTREZGENE, UniProtKB/TrEMBL
	A0ABK0M0I6_RAT	UniProtKB/TrEMBL
	A0ABK0M2W3_RAT	UniProtKB/TrEMBL
	A6HCC4_RAT	UniProtKB/TrEMBL
	A6HCC5	ENTREZGENE, UniProtKB/TrEMBL
	A6HCC6	ENTREZGENE, UniProtKB/TrEMBL
	MAX_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q499S8	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2025-11-13	Max	MYC associated transcriptional regulator X	Max	MYC associated factor X	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-10-24	Max	MYC associated factor X	Max	Max protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Max	Max protein		Max	Name updated	1299863	APPROVED
2002-08-07	Max	Max			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)