Advanced Search (OLGA)

Gene: Gtpbp4 (GTP binding protein 4) Rattus norvegicus

Analyze

Symbol:

Gtpbp4

Name:

GTP binding protein 4

RGD ID:

620783

Description:

Predicted to enable several functions, including GTP binding activity; GTPase activity; and preribosome binding activity. Predicted to be involved in several processes, including negative regulation of G2/M transition of mitotic cell cycle; negative regulation of macromolecule metabolic process; and protein stabilization. Predicted to act upstream of or within maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA). Predicted to be located in nucleus and perinuclear region of cytoplasm. Predicted to be active in nucleolus. Used to study end stage renal disease. Orthologous to human GTPBP4 (GTP binding protein 4); PARTICIPATES IN ribosome biogenesis pathway; INTERACTS WITH (+)-schisandrin B; 2,4-dinitrotoluene; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

chronic renal failure gene protein; Crfg; G protein-binding protein CRFG; GTP-binding protein 4; LOC498786; LOC683324; LOC689822; nucleolar GTP-binding protein 1; RGD1563564; similar to GTP-binding protein NGB; similar to Nucleolar GTP-binding protein 1 (Chronic renal failure gene protein) (GTP-binding protein NGB)

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GTPBP4 (GTP binding protein 4)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, Panther
Mus musculus (house mouse):	Gtpbp4 (GTP binding protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Gtpbp4 (GTP binding protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GTPBP4 (GTP binding protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GTPBP4 (GTP binding protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Gtpbp4 (GTP binding protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GTPBP4 (GTP binding protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GTPBP4 (GTP binding protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Gtpbp4 (GTP binding protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Gtpbp4 (GTP binding protein 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	IGFBP1 (insulin like growth factor binding protein 1)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	GTPBP4 (GTP binding protein 4)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Gtpbp4 (GTP binding protein 4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gtpbp4 (GTP binding protein 4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	NOG1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Non1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Non1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	nog-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	gtpbp4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	gtpbp4	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Related Pseudogenes:

Gtpbp4-ps2 Gtpbp4-ps3

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	65,997,472 - 66,019,530 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	17	66,276,566 - 66,289,637 (+)	Ensembl				GRCr8
mRatBN7.2	17	61,308,033 - 61,328,184 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	61,308,014 - 61,418,009 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	X	1,432,978 - 1,435,292 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	X	4,908,673 - 4,910,987 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	X	1,224,016 - 1,226,329 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	63,111,086 - 63,145,618 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	63,110,254 - 63,145,577 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	17	64,910,285 - 64,916,648 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Rnor_5.0	17	59,576,852 - 59,621,031 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Rnor_5.0	17	64,882,150 - 64,895,590 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	17	72,100,899 - 72,120,636 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	17	59,257,948 - 59,272,929 (-)	NCBI		Celera
RGSC_v3.1	17	72,111,731 - 72,131,468 (+)	NCBI
Cytogenetic Map	17	q12.1	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

end stage renal disease (IDA)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

2-butoxyethanol (ISO)

4,4'-sulfonyldiphenol (ISO)

4-amino-2,6-dinitrotoluene (EXP)

5-fluorouracil (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

Aroclor 1254 (ISO)

arsane (ISO)

arsenic atom (ISO)

benzatropine (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

beta-naphthoflavone (ISO)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

caffeine (ISO)

chromium(6+) (ISO)

cisplatin (ISO)

copper(II) sulfate (ISO)

cyclosporin A (EXP,ISO)

DDE (ISO)

deoxynivalenol (ISO)

dibutyl phthalate (EXP)

dicrotophos (ISO)

diethylstilbestrol (ISO)

dioxygen (ISO)

disodium selenite (ISO)

epoxiconazole (ISO)

ethanol (ISO)

fluoranthene (ISO)

flutamide (EXP)

glyphosate (ISO)

hydrogen peroxide (ISO)

isobutanol (ISO)

ivermectin (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

menadione (ISO)

methotrexate (ISO)

microcystin-LR (ISO)

Nivalenol (ISO)

ozone (ISO)

paracetamol (ISO)

paraquat (EXP)

pentachlorophenol (ISO)

perfluorooctanoic acid (ISO)

pirinixic acid (ISO)

poly(I:C) (ISO)

resveratrol (ISO)

SB 431542 (ISO)

sirolimus (EXP)

sodium arsenite (ISO)

sulforaphane (ISO)

tacrolimus hydrate (EXP)

tamoxifen (ISO)

tetrachloromethane (EXP,ISO)

tetrahydropalmatine (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trichloroethene (EXP)

triphenyl phosphate (EXP,ISO)

Triptolide (ISO)

urethane (ISO)

valproic acid (ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (ISO)

negative regulation of cell migration (ISO,ISS)

negative regulation of cell population proliferation (ISO,ISS)

negative regulation of cell-cell adhesion (ISO,ISS)

negative regulation of DNA replication (ISO,ISS)

negative regulation of G2/M transition of mitotic cell cycle (ISO,ISS)

negative regulation of protein ubiquitination (ISO,ISS)

protein stabilization (ISO,ISS)

ribosomal large subunit biogenesis (IBA,ISO,ISS)

ribosome biogenesis (IEA)

Cellular Component

cytoplasm (ISO,ISS)

nucleolus (IBA,IEA,ISO)

nucleus (ISO,ISS)

perinuclear region of cytoplasm (ISO,ISS)

Molecular Function

GTP binding (IEA,ISO,ISS)

GTPase activity (IBA,ISO,ISS)

nucleotide binding (IEA)

preribosome binding (ISO,ISS)

protein binding (ISO)

RNA binding (IBA)

Molecular Pathway Annotations Click to see Annotation Detail View

ribosome biogenesis pathway (IEA)

External Pathway Database Links

KEGG Pathway

Ribosome biogenesis in eukaryotes

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Identification of a novel nuclear guanosine triphosphate-binding protein differentially expressed in renal disease.	Laping NJ, etal., J Am Soc Nephrol 2001 May;12(5):883-90.
3.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
4.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
5.	GOA pipeline	RGD automated data pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:8889548	PMID:16210410	PMID:17210637	PMID:19946888	PMID:21630459	PMID:22658674	PMID:22681889	PMID:25190460

Genomics

Comparative Map Data

Gtpbp4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	65,997,472 - 66,019,530 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	17	66,276,566 - 66,289,637 (+)	Ensembl				GRCr8
mRatBN7.2	17	61,308,033 - 61,328,184 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	61,308,014 - 61,418,009 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	X	1,432,978 - 1,435,292 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	X	4,908,673 - 4,910,987 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	X	1,224,016 - 1,226,329 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	63,111,086 - 63,145,618 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	63,110,254 - 63,145,577 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	17	64,910,285 - 64,916,648 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Rnor_5.0	17	59,576,852 - 59,621,031 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Rnor_5.0	17	64,882,150 - 64,895,590 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	17	72,100,899 - 72,120,636 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	17	59,257,948 - 59,272,929 (-)	NCBI		Celera
RGSC_v3.1	17	72,111,731 - 72,131,468 (+)	NCBI
Cytogenetic Map	17	q12.1	NCBI

GTPBP4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	10	988,434 - 1,019,932 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	10	988,418 - 1,019,932 (+)	Ensembl			hg38	GRCh38
GRCh37	10	1,034,374 - 1,065,872 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	10	1,024,349 - 1,053,708 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	10	1,024,348 - 1,053,707	NCBI
Celera	10	984,242 - 1,013,986 (+)	NCBI		Celera
Cytogenetic Map	10	p15.3	NCBI
HuRef	10	973,776 - 1,003,177 (+)	NCBI		HuRef
CHM1_1	10	1,033,522 - 1,062,866 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	10	985,662 - 1,017,099 (+)	NCBI		T2T-CHM13v2.0

Gtpbp4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	13	9,016,039 - 9,046,080 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	13	9,016,367 - 9,046,119 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	13	8,972,070 - 8,996,116 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	13	8,966,331 - 8,996,083 (-)	Ensembl			mm10	GRCm38
MGSCv37	13	8,971,710 - 8,995,258 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	13	8,971,710 - 8,995,258 (-)	NCBI		MGSCv36	mm8
Celera	13	8,914,114 - 8,937,545 (-)	NCBI		Celera
Cytogenetic Map	13	A1	NCBI
cM Map	13	3.64	NCBI

Gtpbp4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955492	5,594 - 34,111 (-)	Ensembl
ChiLan1.0	NW_004955492	5,594 - 33,558 (-)	NCBI	ChiLan1.0	ChiLan1.0

GTPBP4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	8	13,504,820 - 13,542,455 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	10	13,516,580 - 13,547,712 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	10	1,023,295 - 1,055,818 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	10	1,071,809 - 1,103,527 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	10	1,071,809 - 1,103,521 (+)	Ensembl			panPan2	panpan1.1

GTPBP4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	33,936,629 - 33,955,947 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	33,936,637 - 34,024,769 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	30,973,045 - 30,991,292 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	34,322,186 - 34,341,038 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	34,322,193 - 34,340,957 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	31,405,444 - 31,424,272 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	32,245,151 - 32,263,987 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	32,992,243 - 33,011,090 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Gtpbp4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	36,936,100 - 36,961,994 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936484	13,101,348 - 13,127,139 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936484	13,101,328 - 13,127,211 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GTPBP4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	10	68,547,319 - 68,568,713 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	10	68,547,316 - 68,566,040 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	10	75,547,092 - 75,575,126 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GTPBP4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	9	953,062 - 981,213 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	9	952,663 - 981,353 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666051	6,007,162 - 6,035,503 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gtpbp4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624775	9,933,339 - 9,965,761 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624775	9,933,500 - 9,965,816 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Gtpbp4
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	14	23,152,897 - 23,172,556 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Gtpbp4
67 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	121
Count of miRNA genes:	93
Interacting mature miRNAs:	101
Transcripts:	ENSRNOT00000051390, ENSRNOT00000074389
Prediction methods:	Miranda, Pita, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
70210	Cm15	Cardiac mass QTL 15	6.5		heart right ventricle mass (VT:0007033)	heart right ventricle wet weight (CMO:0000072)	17	30066472	75066472	Rat
152023626	Bp403	Blood pressure QTL 403	3.86		arterial blood pressure trait (VT:2000000)		17	24136127	84432719	Rat
2301412	Kidm40	Kidney mass QTL 40		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	17	42388164	87388164	Rat
1354588	Bvd4	Brain ventricular dilatation QTL 4	5.31	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	17	58194064	87388164	Rat
9590107	Sffal7	Serum free fatty acids level QTL 7	4.81	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	17	33104645	78104645	Rat
1354654	Spl7	Serum phospholipid level QTL 7	5.5		blood phospholipid amount (VT:0006084)	blood phospholipid level (CMO:0001169)	17	38031354	83031354	Rat
2317038	Ginf3	Gastrointestinal inflammation QTL 3	2.89	0.005	liver integrity trait (VT:0010547)	liver granuloma severity score (CMO:0002157)	17	54829503	93515804	Rat
1598871	Memor5	Memory QTL 5	5.3		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	17	40968017	89341781	Rat
1581512	Cm55	Cardiac mass QTL 55	2.8	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	17	27233445	83975845	Rat
1354629	Scl31	Serum cholesterol level QTL 31	4.1		blood cholesterol amount (VT:0000180)	blood total cholesterol level (CMO:0000051)	17	38031354	83031354	Rat
2317045	Aia11	Adjuvant induced arthritis QTL 11	4.06		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	17	26522051	71522051	Rat
1600398	Edcs5	Endometrial carcinoma susceptibility QTL 5	2.2		uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	17	35446949	75762341	Rat
10450503	Bp386	Blood pressure QTL 386		0.28	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	22019705	67019705	Rat
1559055	Bp278	Blood pressure QTL 278		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	23858926	68858926	Rat
152025238	Slep14	Serum leptin concentration QTL 14	4.62		blood leptin amount (VT:0005667)		17	24390595	84432719	Rat
1354638	Insul1	Insulin level QTL 1	4.8		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	17	38031354	83031354	Rat
61466	Niddm12	Non-insulin dependent diabetes mellitus QTL 12	3.2	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	17	65154872	93515804	Rat
1354635	Bp245	Blood pressure QTL 245	6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	38031354	83031354	Rat
8552928	Pigfal9	Plasma insulin-like growth factor 1 level QTL 9	9		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	17	33104645	78104645	Rat
12904736	Cm121	Cardiac mass QTL 121		0.043	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	17	42388164	87388164	Rat
7394837	Memor18	Memory QTL 18			exploratory behavior trait (VT:0010471)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	17	61091446	68550213	Rat
1300148	Bp192	Blood pressure QTL 192	3.47		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	17	46050126	91050126	Rat
12903980	Cm120	Cardiac mass QTL 120		0.002	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	17	23858926	68858926	Rat
12903981	Am17	Aortic mass QTL 17		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	17	23858926	68858926	Rat
4889891	Eae32	Experimental allergic encephalomyelitis QTL 32	4.8	0.0002	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	17	27233445	72233445	Rat
12903982	Kidm70	Kidney mass QTL 70		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	17	23858926	68858926	Rat
4889894	Eae33	Experimental allergic encephalomyelitis QTL 33	5.2	0.0001	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	17	55604597	93006569	Rat
12903978	Cm118	Cardiac mass QTL 118		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	17	23858926	68858926	Rat
2324621	Coatc5	Coat color QTL 5			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	17	42654895	87654895	Rat
12903979	Cm119	Cardiac mass QTL 119		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	17	23858926	68858926	Rat
1354619	Bp242	Blood pressure QTL 242	6.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	37687877	82687877	Rat
7488963	Bp369	Blood pressure QTL 369		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	63697147	82818564	Rat
1300129	Rf25	Renal function QTL 25	3.03		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	17	41062352	86062352	Rat
152023740	Bp406	Blood pressure QTL 406	6.06		arterial blood pressure trait (VT:2000000)		17	24136127	84432719	Rat
1354663	Bvd5	Brain ventricular dilatation QTL 5	3.51	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	17	32199534	86201342	Rat
7488966	Bp370	Blood pressure QTL 370		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	23858926	68858926	Rat
152023737	Bp405	Blood pressure QTL 405	5.06		arterial blood pressure trait (VT:2000000)			24136127	84432719	Rat
152023736	Bp404	Blood pressure QTL 404	3.78		arterial blood pressure trait (VT:2000000)		17	24136127	84432719	Rat
724528	Uae4	Urinary albumin excretion QTL 4	4.9	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	17	36045537	81045537	Rat
2302365	Gluco40	Glucose level QTL 40	4.79		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	17	64569820	86954580	Rat

Markers in Region

RH137031

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	61,328,594 - 61,328,807 (-)	MAPPER	mRatBN7.2
mRatBN7.2	17	61,328,594 - 61,328,807 (+)	MAPPER	mRatBN7.2
mRatBN7.2	17	61,417,889 - 61,418,102 (+)	MAPPER	mRatBN7.2
mRatBN7.2	17	61,417,889 - 61,418,102 (-)	MAPPER	mRatBN7.2
Rnor_6.0	17	57,811,450 - 57,811,662	NCBI	Rnor6.0
Rnor_6.0	17	63,110,347 - 63,110,559	NCBI	Rnor6.0
Rnor_5.0	17	64,881,240 - 64,881,452	UniSTS	Rnor5.0
Rnor_5.0	17	59,620,726 - 59,620,938	UniSTS	Rnor5.0
Cytogenetic Map	17	q12.1	UniSTS

AU049302

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	61,400,626 - 61,400,896 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	57,788,636 - 57,788,919	NCBI	Rnor6.0
Rnor_6.0	17	57,643,170 - 57,643,435	NCBI	Rnor6.0
Rnor_5.0	17	59,597,912 - 59,598,195	UniSTS	Rnor5.0
Rnor_5.0	17	59,456,474 - 59,456,739	UniSTS	Rnor5.0
Cytogenetic Map	17	q12.1	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053689	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063276017	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF325355	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CD371777	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000017	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000074389 ⟹ ENSRNOP00000064860

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	17	61,308,046 - 61,328,891 (+)	Ensembl
Rnor_6.0 Ensembl	17	63,110,254 - 63,145,577 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000095348 ⟹ ENSRNOP00000085242

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	17	66,276,566 - 66,289,637 (+)	Ensembl
mRatBN7.2 Ensembl	17	61,308,056 - 61,418,009 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000095660 ⟹ ENSRNOP00000087877

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	17	66,276,566 - 66,289,637 (+)	Ensembl
mRatBN7.2 Ensembl	17	61,308,056 - 61,418,009 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000097067 ⟹ ENSRNOP00000092243

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	17	61,308,014 - 61,328,357 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000109185 ⟹ ENSRNOP00000088986

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	17	61,310,668 - 61,328,891 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000110840 ⟹ ENSRNOP00000085602

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	17	61,308,046 - 61,328,891 (+)	Ensembl

RefSeq Acc Id:

NM_053689 ⟹ NP_446141

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	65,999,383 - 66,019,530 (+)	NCBI
mRatBN7.2	17	61,308,033 - 61,328,184 (+)	NCBI
Rnor_6.0	17	63,111,086 - 63,145,618 (-)	NCBI
Rnor_5.0	17	64,910,285 - 64,916,648 (-)	NCBI
RGSC_v3.4	17	72,100,899 - 72,120,636 (+)	RGD
Celera	17	59,257,948 - 59,272,929 (-)	NCBI

Sequence:

show sequence

CCTCCGCTTCTCCAGGTTTCCTCGTGCGTTCCACCGCCGGCATGGCGCATTACAACTTCAAGAA
GATTACGGTGGTGCCGTCAGCCAAGGACTTTATTGACCTGACATTATCCAAGACACAACGAAAG
ACTCCAACGGTTATTCATAAACATTATCAAATTCATCGAATTCGACATTTTTATATGAGAAAAG
TCAAATTTACTCAACAGAATTATCATGACAGACTGTCACAGATTCTGTCCGATTTCCCCAAATT
GGATGATATCCATCCATTTTATGCTGACTTGATGAATATTCTCTATGACAAGGATCACTACAAG
TTGGCTCTAGGACAAATAAATATTGCCAAAAACTTGGTGGACAATGTTGCTAAAGATTACGTGC
GACTTATGAAGTATGGTGATTCTCTCTACCGATGCAAGCAGCTGAAGCGCGCTGCCCTGGGGCG
AATGTGTACGATTATCAAGAGGCAGAGGCAGAGTTTGGAGTACTTGGAACAAGTACGTCAACAT
CTATCCCGCTTGCCAACCATTGATCCAAATACAAGGACTCTACTTTTGTGTGGGTATCCAAATG
TTGGGAAATCCAGCTTCATCAATAAGGTGACAAGAGCAGATGTGGATGTTCAGCCCTATGCATT
TACCACCAAGTCTCTGTTTGTCGGGCACATGGATTATAAGTATCTGCGCTGGCAGGTTGTAGAT
ACTCCAGGGATTTCGGATCATCCTTTGGAGGATCGGAACACCATTGAGATGCAGGCCATCACAG
CCCTGGCCCAGCCCCGAGCTGCAGTTCTGTATGTGATGGATTTGTCTGAGCAGTGTGGACATGG
GTTGAAGGAGCAATTAGAACTCTTCCAGAATATCAGACCCCTGTTTATCAACAAGCCTCTTATT
GTTGTAGCAAACAAATGTGATGTGAAGAGAATAGCTGAACTTTCTGAAGAAGATCAGAAAATAT
TTCTAGACTTGCAGGCTGAAGGATTTCCTGTCATCGAGACCAGCACCCTGACTGAGGAAGGTGT
CATTCAAGTTAAAACGGAGGCTTGTGATAGGCTTTTGGCTCACCGAGTAGAAACGAAAATGAAA
GGAAATAAAGTGAATGAGGTTCTGAACAGATTGCACTTAGCTGTGCCCAACAAGAGAGATGACA
AGGAGAGACCCCCGTTCATCCCAGAAGGAGTGGTAGCTCGTCGGAAGAGAATGGAGATCGCAGA
ACCCAAGAAGAAGAGGGAACGAGATCTTGAGCTGGAAATGGGAGATGATTATATTTTGGATCTT
CAGAAATACTGGGACTTAATGAATTCATCTGAGAAGTATGATAAGATACCAGAGATTTGGGAAG
GCCACAATGTTGCTGATTATATCGATCCTGCTATCATGAAGAAATTAGAAGAGTTGGAAAAGGA
AGAAGAGCTCCGAACAGCTGCTGGGGAGTATGACAGTGAGTCTGAGAGTGAAGACGAGGAAATG
GTGGAAATCCGACAGCTGGCAAAACAAATTAGAGAGAAGAAGAAGTTGAAAATTCTACAGTCCA
AAGAAAAGAACACACAGGGACCCCGCATGCCCCGGACTGCTAAGAAGGTTCAACGGGCAGATTT
AGAGAATGAGATGCGTAGTCTTGGCGTGGACATGGATGATAAAGACAATGCCCACTATGCAGTC
CAGGCCAGAAGATCTCGGAGTGTCACCAGGAAAAGAAAACGAGAAGAGTCTGTTCCTCCCTCTT
CCATAGCCCGCAGTCGCAGTCGGAGTTGCTCTAAAACGCCACGTGATGTTTCTGGTCTTCGGGA
TGTCAAGATGGTGAAGAAAGCCAAGACCATGATGAAGAAAGCCCAGAAGAAGATGAATCGCTTG
GGGAAGAAGGGGGAAGCAGATAGGCATGTGTTTGATATGAAGCCCAAGCACCTACTCTCTGGGA
AGAGGAAAGCTGGTAAAAAGGACAGGAGATAATGTCCTCTTCGGTCGGAGTAGTTTAACTAGAC
CCGTGATTATTTCTGAGTGTGTGATGGTGTGTTTTATAGAATTTGGGATCAACATCTGTTAACC
AAAGAAACGATGGAAATGACTTTTAAATGCTTGTTGCTGTGCTGAAAACTGGTAAAGCCGAGTA
AGCGTGTGGTGCCGTGGCCCTGTGCAGTCAGATGTTACCTGCAGAGCGCTCTGTACTGGATGAC
GCGCTTCTTTCACAGCCAAGGGACTCATTTTGCAGAAAAGATGTATTGGTGTAAGGAGGCTGCT
TTGGTGGGGGAAAACTTTTGTAGTAGATCTTTTGACACCCAAAATACCTATTTTTGTTAAGAAA
GTATTCCTGCTGGGAG

hide sequence

RefSeq Acc Id:

XM_063276017 ⟹ XP_063132087

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	65,997,472 - 66,017,555 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_446141	(Get FASTA)	NCBI Sequence Viewer
	XP_063132087	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAK13446	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000064860
GenBank Protein	Q99P77	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_446141 ⟸ NM_053689

- UniProtKB:

M0R623 (UniProtKB/TrEMBL), A0A8I6A3Y7 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAHYNFKKITVVPSAKDFIDLTLSKTQRKTPTVIHKHYQIHRIRHFYMRKVKFTQQNYHDRLSQ
ILSDFPKLDDIHPFYADLMNILYDKDHYKLALGQINIAKNLVDNVAKDYVRLMKYGDSLYRCKQ
LKRAALGRMCTIIKRQRQSLEYLEQVRQHLSRLPTIDPNTRTLLLCGYPNVGKSSFINKVTRAD
VDVQPYAFTTKSLFVGHMDYKYLRWQVVDTPGISDHPLEDRNTIEMQAITALAQPRAAVLYVMD
LSEQCGHGLKEQLELFQNIRPLFINKPLIVVANKCDVKRIAELSEEDQKIFLDLQAEGFPVIET
STLTEEGVIQVKTEACDRLLAHRVETKMKGNKVNEVLNRLHLAVPNKRDDKERPPFIPEGVVAR
RKRMEIAEPKKKRERDLELEMGDDYILDLQKYWDLMNSSEKYDKIPEIWEGHNVADYIDPAIMK
KLEELEKEEELRTAAGEYDSESESEDEEMVEIRQLAKQIREKKKLKILQSKEKNTQGPRMPRTA
KKVQRADLENEMRSLGVDMDDKDNAHYAVQARRSRSVTRKRKREESVPPSSIARSRSRSCSKTP
RDVSGLRDVKMVKKAKTMMKKAQKKMNRLGKKGEADRHVFDMKPKHLLSGKRKAGKKDRR

hide sequence

Ensembl Acc Id:

ENSRNOP00000064860 ⟸ ENSRNOT00000074389

Ensembl Acc Id:

ENSRNOP00000087877 ⟸ ENSRNOT00000095660

Ensembl Acc Id:

ENSRNOP00000088986 ⟸ ENSRNOT00000109185

Ensembl Acc Id:

ENSRNOP00000085602 ⟸ ENSRNOT00000110840

Ensembl Acc Id:

ENSRNOP00000085242 ⟸ ENSRNOT00000095348

Ensembl Acc Id:

ENSRNOP00000092243 ⟸ ENSRNOT00000097067

RefSeq Acc Id:	XP_063132087 ⟸ XM_063276017
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6A3N8 (UniProtKB/TrEMBL)

Protein Domains

OBG-type G

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q99P77-F1-model_v2	AlphaFold	Q99P77	1-637	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13700535

Promoter ID:

EPDNEW_R11059

Type:

initiation region

Name:

Gtpbp4_1

Description:

GTP binding protein 4

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	17	63,145,626 - 63,145,686	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620783	AgrOrtholog
BioCyc Gene	G2FUF-8899	BioCyc
Ensembl Genes	ENSRNOG00000016217	Ensembl
	ENSRNOG00000085666	ENTREZGENE
Ensembl Transcript	ENSRNOT00000074389	ENTREZGENE
Gene3D-CATH	1.20.120.1190	UniProtKB/Swiss-Prot
	3.40.50.300	UniProtKB/Swiss-Prot
InterPro	G_OBG	UniProtKB/Swiss-Prot
	GTP_binding_domain	UniProtKB/Swiss-Prot
	NOG1	UniProtKB/Swiss-Prot
	NOG1_N	UniProtKB/Swiss-Prot
	NOG1_Rossman_fold_dom	UniProtKB/Swiss-Prot
	NOG_C	UniProtKB/Swiss-Prot
	P-loop_NTPase	UniProtKB/Swiss-Prot
NCBI Gene	114300	ENTREZGENE
PANTHER	NUCLEOLAR GTP-BINDING PROTEIN 1	UniProtKB/Swiss-Prot
Pfam	NOG1	UniProtKB/Swiss-Prot
	NOG1_N	UniProtKB/Swiss-Prot
	NOGCT	UniProtKB/Swiss-Prot
PhenoGen	Gtpbp4	PhenoGen
PIRSF	NOG1	UniProtKB/Swiss-Prot
PRINTS	GTP1OBG	UniProtKB/Swiss-Prot
PROSITE	G_OBG	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000016217	RatGTEx
	ENSRNOG00000085666	RatGTEx
Superfamily-SCOP	SSF52540	UniProtKB/Swiss-Prot
UniProt	A0A8I5ZZR1_RAT	UniProtKB/TrEMBL
	A0A8I6A3N8	ENTREZGENE
	A0A8I6A3Y7	ENTREZGENE, UniProtKB/TrEMBL
	M0R623	ENTREZGENE, UniProtKB/TrEMBL
	NOG1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-07-29	Gtpbp4	GTP binding protein 4	LOC689822	similar to Nucleolar GTP-binding protein 1 (Chronic renal failure gene protein) (GTP-binding protein NGB)	Data merged from RGD:1587558	737654	PROVISIONAL
2015-07-29	Gtpbp4	GTP binding protein 4	RGD1563564	similar to GTP-binding protein NGB	Data merged from RGD:1563564	737654	PROVISIONAL
2013-04-17	Gtpbp4	GTP binding protein 4	LOC683324	similar to Nucleolar GTP-binding protein 1 (Chronic renal failure gene protein) (GTP-binding protein NGB)	Data merged from RGD:1588045	737654	PROVISIONAL
2008-04-30	RGD1563564	similar to GTP-binding protein NGB	RGD1563564_predicted	similar to GTP-binding protein NGB (predicted)	'predicted' is removed	2292626	APPROVED
2006-11-19	LOC689822	similar to Nucleolar GTP-binding protein 1 (Chronic renal failure gene protein) (GTP-binding protein NGB)			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-19	LOC683324	similar to Nucleolar GTP-binding protein 1 (Chronic renal failure gene protein) (GTP-binding protein NGB)			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-03-07	RGD1563564_predicted	similar to GTP-binding protein NGB (predicted)	LOC498786	similar to GTP-binding protein NGB	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC498786	similar to GTP-binding protein NGB			Symbol and Name status set to provisional	70820	PROVISIONAL
2005-11-17	Gtpbp4	GTP binding protein 4			Name updated	1299863	APPROVED
2004-09-10	Gtpbp4	G protein-binding protein CRFG	Crfg		Symbol and Name updated	1299863	APPROVED
2002-08-07	Crfg	G protein-binding protein CRFG			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in outer medulla of kidney, enriched in epithelial cells	632611

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Annotations - KEGG (archival)

External Pathway Database Links

External Pathway Database Links