Symbol:
Sf1
Name:
splicing factor 1
RGD ID:
620645
Description:
Predicted to enable identical protein binding activity and mRNA binding activity. Involved in negative regulation of smooth muscle cell proliferation. Predicted to be located in nuclear body. Predicted to be part of U2AF complex and spliceosomal complex. Predicted to be active in nucleus. Used to study ischemia. Orthologous to human SF1 (splicing factor 1); PARTICIPATES IN spliceosome pathway; INTERACTS WITH (+)-schisandrin B; 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane; 17alpha-ethynylestradiol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Zfp162; zinc finger protein 162
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SF1 (splicing factor 1) HGNC
EggNOG, Ensembl, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Sf1 (splicing factor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Sf1 (splicing factor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SF1 (splicing factor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SF1 (splicing factor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Sf1 (splicing factor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SF1 (splicing factor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SF1 (splicing factor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Sf1 (splicing factor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
SF1 (splicing factor 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Sf1 (splicing factor 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
sf1 (splicing factor 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
MSL5
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
SF1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
sfa-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
sf1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 213,090,256 - 213,112,688 (+) NCBI GRCr8 mRatBN7.2 1 203,670,016 - 203,683,432 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 203,670,018 - 203,684,330 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 212,018,848 - 212,032,153 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 219,115,356 - 219,128,639 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 211,806,411 - 211,819,694 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 221,735,512 - 221,749,216 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 221,735,517 - 221,749,086 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 228,723,282 - 228,737,009 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 209,146,177 - 209,159,459 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 209,312,189 - 209,313,441 (+) NCBI Celera 1 201,203,443 - 201,216,725 (+) NCBI Celera Cytogenetic Map 1 q43 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Sf1 Rat (+)-catechin decreases expression ISO SF1 (Homo sapiens) 6480464 Catechin results in decreased expression of SF1 mRNA CTD PMID:15465739 Sf1 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of SF1 mRNA] CTD PMID:31150632 Sf1 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO SF1 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of SF1 mRNA CTD PMID:22079256 Sf1 Rat 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane increases expression ISO Sf1 (Mus musculus) 6480464 o and p'-DDT results in increased expression of SF1 mRNA CTD PMID:24096037 Sf1 Rat 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane increases expression EXP 6480464 o and p'-DDT results in increased expression of SF1 mRNA CTD PMID:24096037 Sf1 Rat 1,2-dimethylhydrazine affects expression ISO Sf1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine affects the expression of SF1 mRNA CTD PMID:22206623 Sf1 Rat 14-Deoxy-11,12-didehydroandrographolide decreases expression ISO SF1 (Homo sapiens) 6480464 14-deoxy-11 and 12-didehydroandrographolide results in decreased expression of SF1 mRNA CTD PMID:22101062 Sf1 Rat 17alpha-ethynylestradiol increases expression ISO Sf1 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of SF1 mRNA CTD PMID:24096037 Sf1 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of SF1 mRNA CTD PMID:24096037 Sf1 Rat 17beta-estradiol multiple interactions ISO SF1 (Homo sapiens) 6480464 Estradiol promotes the reaction [SF1 protein binds to ESR1 protein] CTD PMID:27156127 Sf1 Rat 17beta-estradiol increases expression ISO SF1 (Homo sapiens) 6480464 Estradiol results in increased expression of SF1 mRNA CTD PMID:31614463 Sf1 Rat 17beta-hydroxy-5alpha-androstan-3-one decreases expression ISO SF1 (Homo sapiens) 6480464 Dihydrotestosterone results in decreased expression of SF1 mRNA CTD PMID:29556062 Sf1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of SF1 mRNA CTD PMID:21215274 Sf1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of SF1 mRNA CTD PMID:34747641 Sf1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Sf1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of SF1 mRNA CTD PMID:21570461 Sf1 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of SF1 mRNA CTD PMID:21346803 Sf1 Rat 2,6-dimethoxyphenol multiple interactions ISO SF1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with pyrogallol 1 more ... CTD PMID:38598786 Sf1 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of SF1 mRNA CTD PMID:21346803 Sf1 Rat 2-methylcholine affects expression ISO SF1 (Homo sapiens) 6480464 beta-methylcholine affects the expression of SF1 mRNA CTD PMID:21179406 Sf1 Rat 3,4-methylenedioxymethamphetamine increases expression EXP 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of SF1 mRNA CTD PMID:30071829 Sf1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO SF1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of SF1 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of SF1 mRNA CTD PMID:28628672 Sf1 Rat 4,4'-sulfonyldiphenol multiple interactions ISO SF1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of SF1 mRNA CTD PMID:28628672 Sf1 Rat 4,4'-sulfonyldiphenol increases expression ISO SF1 (Homo sapiens) 6480464 bisphenol S results in increased expression of SF1 protein CTD PMID:34186270 Sf1 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of SF1 mRNA CTD PMID:36041667 Sf1 Rat 4,4'-sulfonyldiphenol decreases methylation ISO SF1 (Homo sapiens) 6480464 bisphenol S results in decreased methylation of SF1 gene CTD PMID:31601247 Sf1 Rat 4,4'-sulfonyldiphenol affects expression ISO Sf1 (Mus musculus) 6480464 bisphenol S affects the expression of SF1 mRNA CTD PMID:39298647 Sf1 Rat 4-amino-2,6-dinitrotoluene affects expression EXP 6480464 4-amino-2 and 6-dinitrotoluene affects the expression of SF1 mRNA CTD PMID:21346803 Sf1 Rat 8-Br-cAMP increases expression ISO SF1 (Homo sapiens) 6480464 8-Bromo Cyclic Adenosine Monophosphate results in increased expression of SF1 mRNA CTD PMID:22079614 Sf1 Rat acrolein multiple interactions ISO SF1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of and results in increased oxidation of SF1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of and results in increased oxidation of SF1 mRNA CTD PMID:32699268 Sf1 Rat actinomycin D multiple interactions ISO SF1 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of SF1 protein CTD PMID:38460933 Sf1 Rat alpha-pinene multiple interactions ISO SF1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of and results in increased oxidation of SF1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of and results in increased oxidation of SF1 mRNA CTD PMID:32699268 Sf1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of SF1 mRNA CTD PMID:16483693 Sf1 Rat benzatropine decreases expression ISO SF1 (Homo sapiens) 6480464 Benztropine results in decreased expression of SF1 protein CTD PMID:34122009 Sf1 Rat benzo[a]pyrene decreases methylation ISO SF1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of SF1 5' UTR CTD PMID:27901495 Sf1 Rat beta-lapachone decreases expression ISO SF1 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of SF1 mRNA CTD PMID:38218311 Sf1 Rat bis(2-chloroethyl) sulfide increases phosphorylation ISO SF1 (Homo sapiens) 6480464 Mustard Gas results in increased phosphorylation of SF1 protein CTD PMID:19845377 Sf1 Rat bis(2-ethylhexyl) phthalate decreases expression ISO SF1 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in decreased expression of SF1 mRNA CTD PMID:31163220 Sf1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of SF1 mRNA CTD PMID:25181051 and PMID:34947998 Sf1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of SF1 mRNA CTD PMID:36041667 Sf1 Rat bisphenol A affects expression ISO SF1 (Homo sapiens) 6480464 bisphenol A affects the expression of SF1 mRNA CTD PMID:30903817 Sf1 Rat bisphenol A multiple interactions ISO SF1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of SF1 mRNA CTD PMID:28628672 Sf1 Rat bisphenol F decreases expression ISO Sf1 (Mus musculus) 6480464 bisphenol F results in decreased expression of SF1 mRNA CTD PMID:38685157 Sf1 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of SF1 mRNA CTD PMID:36041667 Sf1 Rat caffeine affects phosphorylation ISO SF1 (Homo sapiens) 6480464 Caffeine affects the phosphorylation of SF1 protein CTD PMID:35688186 Sf1 Rat carmustine affects response to substance ISO SF1 (Homo sapiens) 6480464 SF1 mRNA affects the susceptibility to Carmustine CTD PMID:16365179 Sf1 Rat chromium(6+) decreases expression EXP 6480464 chromium hexavalent ion results in decreased expression of SF1 protein CTD PMID:32679048 Sf1 Rat cisplatin decreases expression ISO SF1 (Homo sapiens) 6480464 Cisplatin results in decreased expression of SF1 mRNA CTD PMID:27594783 Sf1 Rat cisplatin multiple interactions ISO SF1 (Homo sapiens) 6480464 Cisplatin promotes the reaction [jinfukang results in decreased expression of SF1 mRNA] and jinfukang promotes the reaction [Cisplatin results in decreased expression of SF1 mRNA] CTD PMID:27392435 Sf1 Rat copper(II) sulfate decreases expression ISO SF1 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of SF1 mRNA CTD PMID:19549813 Sf1 Rat cortisol decreases expression ISO SF1 (Homo sapiens) 6480464 Hydrocortisone results in decreased expression of SF1 mRNA CTD PMID:34454011 Sf1 Rat cortisol multiple interactions ISO SF1 (Homo sapiens) 6480464 Mifepristone inhibits the reaction [Hydrocortisone results in decreased expression of SF1 mRNA] and SF1 protein inhibits the reaction [Hydrocortisone results in increased expression of HDAC1 mRNA] CTD PMID:34454011 Sf1 Rat coumestrol multiple interactions ISO SF1 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of SF1 mRNA CTD PMID:19167446 Sf1 Rat cypermethrin decreases expression ISO Sf1 (Mus musculus) 6480464 cypermethrin results in decreased expression of SF1 protein CTD PMID:34794910 Sf1 Rat cypermethrin multiple interactions ISO Sf1 (Mus musculus) 6480464 MIR140 affects the reaction [cypermethrin results in decreased expression of SF1 protein] CTD PMID:34794910 Sf1 Rat cypermethrin decreases expression EXP 6480464 cypermethrin results in decreased expression of SF1 mRNA and cypermethrin results in decreased expression of SF1 protein CTD PMID:34794910 Sf1 Rat cypermethrin multiple interactions EXP 6480464 SF1 protein inhibits the reaction [cypermethrin results in decreased expression of CYP11A1 protein] and SF1 protein inhibits the reaction [cypermethrin results in decreased expression of STAR protein] CTD PMID:34794910 Sf1 Rat deoxynivalenol increases phosphorylation ISO Sf1 (Mus musculus) 6480464 deoxynivalenol results in increased phosphorylation of SF1 protein CTD PMID:23811945 Sf1 Rat dexamethasone multiple interactions ISO SF1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of SF1 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of SF1 mRNA CTD PMID:28628672 Sf1 Rat dextran sulfate multiple interactions ISO Sf1 (Mus musculus) 6480464 evodiamine inhibits the reaction [Dextran Sulfate results in increased expression of SF1 protein] CTD PMID:35362542 Sf1 Rat dextran sulfate increases expression ISO Sf1 (Mus musculus) 6480464 Dextran Sulfate results in increased expression of SF1 protein CTD PMID:35362542 Sf1 Rat Dibutyl phosphate affects expression ISO SF1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of SF1 mRNA CTD PMID:37042841 Sf1 Rat dicrotophos increases expression ISO SF1 (Homo sapiens) 6480464 dicrotophos results in increased expression of SF1 mRNA CTD PMID:28302478 Sf1 Rat dieldrin affects expression EXP 6480464 Dieldrin affects the expression of SF1 mRNA CTD PMID:22546817 Sf1 Rat dihydroartemisinin affects binding ISO SF1 (Homo sapiens) 6480464 artenimol analog binds to SF1 protein CTD PMID:26340163 Sf1 Rat doxorubicin affects expression ISO SF1 (Homo sapiens) 6480464 Doxorubicin affects the expression of SF1 mRNA CTD PMID:29803840 Sf1 Rat elemental selenium multiple interactions ISO SF1 (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in decreased expression of SF1 mRNA CTD PMID:19244175 Sf1 Rat elemental selenium decreases expression ISO SF1 (Homo sapiens) 6480464 Selenium results in decreased expression of SF1 mRNA CTD PMID:19244175 Sf1 Rat Enterolactone multiple interactions ISO SF1 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of SF1 mRNA CTD PMID:19167446 Sf1 Rat enzyme inhibitor multiple interactions ISO SF1 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of SF1 protein CTD PMID:23301498 Sf1 Rat epoxiconazole increases expression ISO Sf1 (Mus musculus) 6480464 epoxiconazole results in increased expression of SF1 mRNA CTD PMID:35436446 Sf1 Rat ethanol affects expression ISO Sf1 (Mus musculus) 6480464 Ethanol affects the expression of SF1 mRNA CTD PMID:30319688 Sf1 Rat ethanol multiple interactions ISO Sf1 (Mus musculus) 6480464 Ethanol affects the expression of and affects the splicing of SF1 mRNA CTD PMID:30319688 Sf1 Rat Evodiamine multiple interactions ISO Sf1 (Mus musculus) 6480464 evodiamine inhibits the reaction [Dextran Sulfate results in increased expression of SF1 protein] CTD PMID:35362542 Sf1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of SF1 mRNA CTD PMID:24136188 Sf1 Rat FR900359 increases phosphorylation ISO SF1 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of SF1 protein CTD PMID:37730182 Sf1 Rat furfural multiple interactions ISO SF1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of SF1 protein CTD PMID:38598786 Sf1 Rat hydralazine multiple interactions ISO SF1 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of SF1 mRNA CTD PMID:17183730 Sf1 Rat hydrogen peroxide decreases expression ISO SF1 (Homo sapiens) 6480464 Hydrogen Peroxide results in decreased expression of SF1 mRNA CTD PMID:12419474 Sf1 Rat hydroxyflutamide decreases expression ISO SF1 (Homo sapiens) 6480464 hydroxyflutamide results in decreased expression of SF1 mRNA CTD PMID:29556062 Sf1 Rat indometacin multiple interactions ISO SF1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of SF1 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of SF1 mRNA CTD PMID:28628672 Sf1 Rat inulin multiple interactions ISO Sf1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of SF1 mRNA CTD PMID:36331819 Sf1 Rat ivermectin decreases expression ISO SF1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of SF1 protein CTD PMID:32959892 Sf1 Rat methylparaben increases expression ISO SF1 (Homo sapiens) 6480464 methylparaben results in increased expression of SF1 mRNA CTD PMID:31745603 Sf1 Rat mifepristone multiple interactions ISO SF1 (Homo sapiens) 6480464 Mifepristone inhibits the reaction [Hydrocortisone results in decreased expression of SF1 mRNA] CTD PMID:34454011 Sf1 Rat Monobutylphthalate affects expression EXP 6480464 monobutyl phthalate affects the expression of SF1 mRNA CTD PMID:20864626 Sf1 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions ISO Sf1 (Mus musculus) 6480464 [MYBPC3 protein affects the susceptibility to benzyloxycarbonylleucyl-leucyl-leucine aldehyde] which results in increased expression of SF1 mRNA CTD PMID:25566086 Sf1 Rat Nutlin-3 multiple interactions ISO SF1 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of SF1 protein CTD PMID:38460933 Sf1 Rat ozone multiple interactions ISO SF1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of and results in increased oxidation of SF1 mRNA more ... CTD PMID:32699268 and PMID:35430440 Sf1 Rat paracetamol affects expression ISO Sf1 (Mus musculus) 6480464 Acetaminophen affects the expression of SF1 mRNA CTD PMID:17562736 Sf1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of SF1 mRNA CTD PMID:33387578 Sf1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Sf1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of SF1 mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of SF1 mRNA CTD PMID:36331819 Sf1 Rat potassium chromate multiple interactions ISO SF1 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of SF1 mRNA CTD PMID:22079256 Sf1 Rat potassium chromate increases expression ISO SF1 (Homo sapiens) 6480464 potassium chromate(VI) results in increased expression of SF1 mRNA CTD PMID:22079256 Sf1 Rat selenium atom multiple interactions ISO SF1 (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in decreased expression of SF1 mRNA CTD PMID:19244175 Sf1 Rat selenium atom decreases expression ISO SF1 (Homo sapiens) 6480464 Selenium results in decreased expression of SF1 mRNA CTD PMID:19244175 Sf1 Rat silicon dioxide increases expression ISO SF1 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of SF1 mRNA CTD PMID:25895662 Sf1 Rat sodium chloride multiple interactions ISO SF1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of SF1 protein more ... CTD PMID:38598786 Sf1 Rat Soman increases expression EXP 6480464 Soman results in increased expression of SF1 mRNA CTD PMID:19281266 Sf1 Rat temozolomide affects response to substance ISO SF1 (Homo sapiens) 6480464 SF1 mRNA affects the susceptibility to temozolomide CTD PMID:16365179 Sf1 Rat tert-butyl hydroperoxide decreases expression ISO SF1 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of SF1 mRNA CTD PMID:12419474 Sf1 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of SF1 mRNA CTD PMID:31150632 Sf1 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of SF1 mRNA] CTD PMID:31150632 Sf1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of SF1 mRNA CTD PMID:34492290 Sf1 Rat titanium dioxide increases methylation ISO Sf1 (Mus musculus) 6480464 titanium dioxide results in increased methylation of SF1 gene CTD PMID:35295148 Sf1 Rat titanium dioxide decreases methylation ISO Sf1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of SF1 promoter CTD PMID:35295148 Sf1 Rat triadimefon increases expression ISO SF1 (Homo sapiens) 6480464 triadimefon results in increased expression of SF1 mRNA CTD PMID:26705709 Sf1 Rat trichloroethene multiple interactions ISO Sf1 (Mus musculus) 6480464 PPARA protein inhibits the reaction [Trichloroethylene results in decreased expression of SF1 mRNA] CTD PMID:15363585 Sf1 Rat triphenyl phosphate affects expression ISO SF1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of SF1 mRNA CTD PMID:37042841 Sf1 Rat triptonide decreases expression ISO Sf1 (Mus musculus) 6480464 triptonide results in decreased expression of SF1 mRNA CTD PMID:33045310 Sf1 Rat troglitazone decreases expression ISO Sf1 (Mus musculus) 6480464 troglitazone results in decreased expression of SF1 mRNA CTD PMID:28973697 Sf1 Rat tungsten decreases expression ISO Sf1 (Mus musculus) 6480464 Tungsten results in decreased expression of SF1 mRNA CTD PMID:30912803 Sf1 Rat valproic acid multiple interactions ISO SF1 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of SF1 mRNA CTD PMID:17183730 Sf1 Rat valproic acid affects expression ISO Sf1 (Mus musculus) 6480464 Valproic Acid affects the expression of SF1 mRNA CTD PMID:17292431 Sf1 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of SF1 mRNA CTD PMID:23034163 Sf1 Rat vitamin E multiple interactions ISO SF1 (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in decreased expression of SF1 mRNA CTD PMID:19244175 Sf1 Rat vitamin E decreases expression ISO SF1 (Homo sapiens) 6480464 Vitamin E results in decreased expression of SF1 mRNA CTD PMID:19244175
(+)-catechin (ISO) (+)-schisandrin B (EXP) (-)-epigallocatechin 3-gallate (ISO) 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (EXP,ISO) 1,2-dimethylhydrazine (ISO) 14-Deoxy-11,12-didehydroandrographolide (ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 2,6-dimethoxyphenol (ISO) 2,6-dinitrotoluene (EXP) 2-methylcholine (ISO) 3,4-methylenedioxymethamphetamine (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 4-amino-2,6-dinitrotoluene (EXP) 8-Br-cAMP (ISO) acrolein (ISO) actinomycin D (ISO) alpha-pinene (ISO) ammonium chloride (EXP) benzatropine (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (EXP,ISO) caffeine (ISO) carmustine (ISO) chromium(6+) (EXP) cisplatin (ISO) copper(II) sulfate (ISO) cortisol (ISO) coumestrol (ISO) cypermethrin (EXP,ISO) deoxynivalenol (ISO) dexamethasone (ISO) dextran sulfate (ISO) Dibutyl phosphate (ISO) dicrotophos (ISO) dieldrin (EXP) dihydroartemisinin (ISO) doxorubicin (ISO) elemental selenium (ISO) Enterolactone (ISO) enzyme inhibitor (ISO) epoxiconazole (ISO) ethanol (ISO) Evodiamine (ISO) flutamide (EXP) FR900359 (ISO) furfural (ISO) hydralazine (ISO) hydrogen peroxide (ISO) hydroxyflutamide (ISO) indometacin (ISO) inulin (ISO) ivermectin (ISO) methylparaben (ISO) mifepristone (ISO) Monobutylphthalate (EXP) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) Nutlin-3 (ISO) ozone (ISO) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) potassium chromate (ISO) selenium atom (ISO) silicon dioxide (ISO) sodium chloride (ISO) Soman (EXP) temozolomide (ISO) tert-butyl hydroperoxide (ISO) tetrachloromethane (EXP) thioacetamide (EXP) titanium dioxide (ISO) triadimefon (ISO) trichloroethene (ISO) triphenyl phosphate (ISO) triptonide (ISO) troglitazone (ISO) tungsten (ISO) valproic acid (ISO) vinclozolin (EXP) vitamin E (ISO)
Sf1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 213,090,256 - 213,112,688 (+) NCBI GRCr8 mRatBN7.2 1 203,670,016 - 203,683,432 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 203,670,018 - 203,684,330 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 212,018,848 - 212,032,153 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 219,115,356 - 219,128,639 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 211,806,411 - 211,819,694 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 221,735,512 - 221,749,216 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 221,735,517 - 221,749,086 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 228,723,282 - 228,737,009 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 209,146,177 - 209,159,459 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 209,312,189 - 209,313,441 (+) NCBI Celera 1 201,203,443 - 201,216,725 (+) NCBI Celera Cytogenetic Map 1 q43 NCBI
SF1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 64,764,606 - 64,778,542 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 64,764,606 - 64,778,786 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 64,532,078 - 64,546,014 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 64,288,654 - 64,302,817 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 11 64,288,653 - 64,302,817 NCBI Celera 11 61,858,574 - 61,872,815 (-) NCBI Celera Cytogenetic Map 11 q13.1 NCBI HuRef 11 60,858,921 - 60,873,339 (-) NCBI HuRef CHM1_1 11 64,415,846 - 64,430,091 (-) NCBI CHM1_1 T2T-CHM13v2.0 11 64,757,911 - 64,771,848 (-) NCBI T2T-CHM13v2.0
Sf1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 19 6,413,952 - 6,428,060 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 19 6,413,720 - 6,428,060 (+) Ensembl GRCm39 Ensembl GRCm38 19 6,363,673 - 6,378,038 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 19 6,363,690 - 6,378,030 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 19 6,363,690 - 6,378,038 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 19 6,364,088 - 6,376,425 (+) NCBI MGSCv36 mm8 Celera 19 6,236,708 - 6,251,056 (+) NCBI Celera Cytogenetic Map 19 A NCBI cM Map 19 4.48 NCBI
Sf1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955422 20,391,722 - 20,551,870 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955422 20,391,340 - 20,406,555 (+) NCBI ChiLan1.0 ChiLan1.0
SF1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 65,990,503 - 66,006,673 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 67,033,499 - 67,048,030 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 60,120,126 - 60,134,279 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 63,461,318 - 63,473,350 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 63,461,318 - 63,473,355 (-) Ensembl panpan1.1 panPan2
SF1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 18 52,380,058 - 52,393,833 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 18 52,380,211 - 52,393,048 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 18 50,987,426 - 51,001,160 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 18 53,421,292 - 53,435,068 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 18 53,421,043 - 53,435,063 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 18 52,516,258 - 52,529,989 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 18 52,102,165 - 52,115,924 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 18 52,886,303 - 52,900,036 (+) NCBI UU_Cfam_GSD_1.0
Sf1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 8,091,417 - 8,104,506 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936599 4,533,795 - 4,546,853 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936599 4,533,664 - 4,546,857 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SF1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 7,391,383 - 7,404,948 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 7,391,295 - 7,404,693 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 6,522,689 - 6,537,534 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SF1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 1 9,456,524 - 9,470,920 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 1 9,456,971 - 9,472,396 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 106,845,714 - 106,860,060 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Sf1
.
Predicted Target Of
Count of predictions: 287 Count of miRNA genes: 180 Interacting mature miRNAs: 207 Transcripts: ENSRNOT00000028628, ENSRNOT00000044866 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 1357335 Bw39 Body weight QTL 39 3.3 body mass (VT:0001259) body weight (CMO:0000012) 1 197814409 242814409 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 2302375 Bw83 Body weight QTL 83 4.87 0.0002 body mass (VT:0001259) body weight (CMO:0000012) 1 197697768 242697768 Rat 1354652 Kidm20 Kidney mass QTL 20 4.3 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 177227632 256448636 Rat 2293674 Bss39 Bone structure and strength QTL 39 7.1 0.0001 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 1 201554356 246554356 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 1354653 Despr9 Despair related QTL 9 0.00019 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 167909849 212909849 Rat 2293673 Bss27 Bone structure and strength QTL 27 18.63 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 1 171629477 216629477 Rat 2293677 Bss41 Bone structure and strength QTL 41 9.38 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 1 171629477 216629477 Rat 1302787 Stl25 Serum triglyceride level QTL 25 2.7 0.0073 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 1 180359209 210702199 Rat 1549830 Bss1 Bone structure and strength QTL 1 4.8 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 172609619 217609619 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 70163 Bw20 Body weight QTL 20 5.1 body mass (VT:0001259) body weight (CMO:0000012) 1 174133260 219133260 Rat 1578763 Kidm29 Kidney mass QTL 29 3.3 0.0001 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 1 179567751 260522016 Rat 1600395 Niddm69 Non-insulin dependent diabetes mellitus QTL 69 4.14 0.0002 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 195804352 257091168 Rat 1354624 Cm35 Cardiac mass QTL35 5.7 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 177227632 256448636 Rat 1600396 Niddm68 Non-insulin dependent diabetes mellitus QTL 68 4.97 0.0003 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 1558658 Bw59 Body weight QTL 59 3.5 0.0003 body mass (VT:0001259) body weight (CMO:0000012) 1 178784622 223784622 Rat 631838 Niddm36 Non-insulin dependent diabetes mellitus QTL 36 0.01 insulin secretion trait (VT:0003564) calculated pancreatic islet insulin release measurement (CMO:0001217) 1 184550676 229550676 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 2293689 Bss47 Bone structure and strength QTL 47 7.25 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 1 171629477 216629477 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 1600388 Niddm67 Non-insulin dependent diabetes mellitus QTL 67 5.84 0.000004 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 2293694 Bss38 Bone structure and strength QTL 38 7.05 0.0001 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 1 201554356 246554356 Rat 1598853 Memor3 Memory QTL 3 4.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 1 143506580 212458660 Rat 61341 Bp26 Blood pressure QTL 26 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 169537671 214537671 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 2293693 Bss22 Bone structure and strength QTL 22 33.52 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 1 171629477 216629477 Rat 2300161 Bmd43 Bone mineral density QTL 43 8.4 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 1300145 Rf7 Renal function QTL 7 2.96 urine creatinine amount (VT:0010540) urine creatinine level (CMO:0000125) 1 185145134 221264292 Rat 8655655 Arrd2 Age-related retinal degeneration QTL 2 7.79 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 183970203 243914901 Rat 1358898 Bp255 Blood pressure QTL 255 3.6 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 191019702 246062233 Rat 631214 Bw61 Body weight QTL61 3.4 0.0001 intramuscular adipose amount (VT:0010044) intramuscular fat area (CMO:0001162) 1 173108781 218108781 Rat 7771612 Cm80 Cardiac mass QTL 80 8.4 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 1 149448574 221264292 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 2300175 Bmd40 Bone mineral density QTL 40 15.4 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 1 201554356 246554356 Rat 2300174 Bmd42 Bone mineral density QTL 42 8.4 0.0001 lumbar vertebra mineral mass (VT:0010511) bone mineral density (CMO:0001226) 1 171629477 216629477 Rat 737828 Hcas3 Hepatocarcinoma susceptibility QTL 3 4.9 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 1 144267353 222987745 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1358886 Bp260 Blood pressure QTL 260 3.67 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 151162766 225824951 Rat 737977 Bp160 Blood pressure QTL 160 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 181133855 226133855 Rat 2293654 Bss30 Bone structure and strength QTL 30 32.65 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 1 171629477 216629477 Rat 2293655 Bss36 Bone structure and strength QTL 36 10.66 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 201554356 246554356 Rat 1298084 Thym4 Thymus enlargement QTL 4 10.68 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 197814409 242814409 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 2300187 Bmd41 Bone mineral density QTL 41 8.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 8552891 Epfw5 Epididymal fat weight QTL 5 4.4 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 1 193113876 238113876 Rat 1354580 Scort1 Serum corticosterone level QTL 1 3.4 blood corticosterone amount (VT:0005345) blood corticosterone level (CMO:0001172) 1 156677124 256448636 Rat 1358292 Cm37 Cardiac mass QTL 37 6.2 8e-07 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 1 196248093 241248093 Rat 61376 Bp42 Blood pressure QTL 42 23.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 197814409 242814409 Rat 634313 Niddm43 Non-insulin dependent diabetes mellitus QTL 43 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 199050459 259647894 Rat 634312 Bp143 Blood pressure QTL 143 3 0.0002 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 182623426 219932796 Rat 1358294 Bw37 Body weight QTL 37 5 0.000011 body mass (VT:0001259) body weight (CMO:0000012) 1 171310381 216310381 Rat 724559 Pancm1 Pancreatic morphology QTL 1 7.1 islet of Langerhans morphology trait (VT:0005215) pancreatic islet damage composite score (CMO:0001156) 1 181759564 214537555 Rat 2312420 Pur17 Proteinuria QTL 17 7.1 0.0001 urine protein amount (VT:0005160) urine total protein excretion rate (CMO:0000756) 1 156677124 218753816 Rat 10059600 Bp378 Blood pressure QTL 378 3.08 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 176869060 221869060 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 619613 Bp77 Blood pressure QTL 77 0.01 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 164747424 209747424 Rat 2312564 Glom18 Glomerulus QTL 18 2.4 0.003 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 1 185356336 231689108 Rat 634321 Hc1 Hypercalciuria QTL 1 2.91 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 178810256 240830002 Rat 2292218 Kidm35 Kidney mass QTL 35 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 199368955 224569684 Rat 724562 Rends1 Renal damage susceptibility QTL 1 0.05 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 1 169537671 214537671 Rat 1331790 Bp201 Blood pressure QTL 201 3.127 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 198211513 225126682 Rat 10059587 Bw173 Body weight QTL 173 3.23 0.025 body mass (VT:0001259) body weight (CMO:0000012) 1 202069611 247069611 Rat 2292222 Bp307 Blood pressure QTL 307 3.06 0.0014 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 213533942 Rat 2292220 Bp306 Blood pressure QTL 306 3.47 0.00087 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 243914901 Rat 10059590 Kidm44 Kidney mass QTL 44 3.42 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 191033875 236033875 Rat 1641926 Teswt2 Testicular weight QTL 2 2.82 testis mass (VT:1000644) both testes wet weight (CMO:0000175) 1 197697768 238755659 Rat 631658 Cm7 Cardiac mass QTL 7 5.32 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 1 196248093 241248093 Rat 1600380 Niddm70 Non-insulin dependent diabetes mellitus QTL 70 3.1 0.0008 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 176550523 221550523 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1582206 Kidm33 Kidney mass QTL 33 6.9 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 188377360 224054420 Rat 8655855 Arrd3 Age-related retinal degeneration QTL 3 3.07 lens clarity trait (VT:0001304) cataract incidence/prevalence measurement (CMO:0001585) 1 183970203 243914901 Rat 634338 Hcar4 Hepatocarcinoma resistance QTL 4 4.6 liver integrity trait (VT:0010547) liver tumorous lesion number to liver area ratio (CMO:0001210) 1 193422268 214537671 Rat 6903303 Scl34 Serum cholesterol QTL 34 2.5 0.0033 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 180359209 218108781 Rat 1600374 Mcs17 Mammary carcinoma susceptibility QTL 17 3 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 1 197670404 242670404 Rat 2293083 Iddm25 Insulin dependent diabetes mellitus QTL 25 4.18 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 181829673 224569684 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat 738032 Hcas5 Hepatocarcinoma susceptibility QTL 5 3.12 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 176426412 257976495 Rat 1358191 Ept10 Estrogen-induced pituitary tumorigenesis QTL 10 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 192825253 243914732 Rat 7394701 Uae46 Urinary albumin excretion QTL 46 3.6 0.0056 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 201554356 246554356 Rat
RH142165
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 203,682,949 - 203,683,163 (+) MAPPER mRatBN7.2 Rnor_6.0 1 221,748,734 - 221,748,947 NCBI Rnor6.0 Rnor_5.0 1 228,736,523 - 228,736,736 UniSTS Rnor5.0 RGSC_v3.4 1 209,159,105 - 209,159,318 UniSTS RGSC3.4 Celera 1 201,216,371 - 201,216,584 UniSTS RH 3.4 Map 1 1537.4 UniSTS Cytogenetic Map 1 q43 UniSTS
RH141827
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 203,668,377 - 203,668,569 (+) MAPPER mRatBN7.2 Rnor_6.0 1 221,733,874 - 221,734,065 NCBI Rnor6.0 Rnor_5.0 1 228,721,663 - 228,721,854 UniSTS Rnor5.0 RGSC_v3.4 1 209,144,534 - 209,144,725 UniSTS RGSC3.4 Celera 1 201,201,800 - 201,201,991 UniSTS RH 3.4 Map 1 1523.4 UniSTS Cytogenetic Map 1 q43 UniSTS
stSG635675
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 203,674,648 - 203,675,797 (+) MAPPER mRatBN7.2 Rnor_6.0 1 221,740,144 - 221,741,292 NCBI Rnor6.0 Rnor_5.0 1 228,727,933 - 228,729,081 UniSTS Rnor5.0 RGSC_v3.4 1 209,150,804 - 209,151,952 UniSTS RGSC3.4 Celera 1 201,208,070 - 201,209,218 UniSTS Cytogenetic Map 1 q43 UniSTS
ECD02238
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 203,681,321 - 203,682,166 (+) MAPPER mRatBN7.2 Rnor_6.0 1 221,747,106 - 221,747,950 NCBI Rnor6.0 Rnor_5.0 1 228,734,895 - 228,735,739 UniSTS Rnor5.0 RGSC_v3.4 1 209,157,477 - 209,158,321 UniSTS RGSC3.4 Celera 1 201,214,743 - 201,215,587 UniSTS Cytogenetic Map 1 q43 UniSTS
REN56369
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 203,681,660 - 203,681,904 (+) MAPPER mRatBN7.2 Rnor_6.0 1 221,747,445 - 221,747,688 NCBI Rnor6.0 Rnor_5.0 1 228,735,234 - 228,735,477 UniSTS Rnor5.0 RGSC_v3.4 1 209,157,816 - 209,158,059 UniSTS RGSC3.4 Celera 1 201,215,082 - 201,215,325 UniSTS Cytogenetic Map 1 q43 UniSTS
REN56368
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 203,681,895 - 203,682,157 (+) MAPPER mRatBN7.2 Rnor_6.0 1 221,747,680 - 221,747,941 NCBI Rnor6.0 Rnor_5.0 1 228,735,469 - 228,735,730 UniSTS Rnor5.0 RGSC_v3.4 1 209,158,051 - 209,158,312 UniSTS RGSC3.4 Celera 1 201,215,317 - 201,215,578 UniSTS Cytogenetic Map 1 q43 UniSTS
REN56367
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 203,682,128 - 203,682,362 (+) MAPPER mRatBN7.2 Rnor_6.0 1 221,747,913 - 221,748,146 NCBI Rnor6.0 Rnor_5.0 1 228,735,702 - 228,735,935 UniSTS Rnor5.0 RGSC_v3.4 1 209,158,284 - 209,158,517 UniSTS RGSC3.4 Celera 1 201,215,550 - 201,215,783 UniSTS Cytogenetic Map 1 q43 UniSTS
REN56392
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 203,676,337 - 203,676,588 (+) MAPPER mRatBN7.2 Rnor_6.0 1 221,741,833 - 221,742,083 NCBI Rnor6.0 Rnor_5.0 1 228,729,622 - 228,729,872 UniSTS Rnor5.0 RGSC_v3.4 1 209,152,493 - 209,152,743 UniSTS RGSC3.4 Celera 1 201,209,759 - 201,210,009 UniSTS Cytogenetic Map 1 q43 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000028628 ⟹ ENSRNOP00000028628
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 203,671,415 - 203,683,424 (+) Ensembl Rnor_6.0 Ensembl 1 221,735,517 - 221,749,086 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000044866 ⟹ ENSRNOP00000041676
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 203,670,032 - 203,683,300 (+) Ensembl Rnor_6.0 Ensembl 1 221,735,528 - 221,749,086 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000100785 ⟹ ENSRNOP00000079109
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 203,670,272 - 203,684,330 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000110004 ⟹ ENSRNOP00000082510
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 203,670,018 - 203,682,665 (+) Ensembl
RefSeq Acc Id:
NM_001110793 ⟹ NP_001104263
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 213,099,281 - 213,112,563 (+) NCBI mRatBN7.2 1 203,670,021 - 203,683,304 (+) NCBI Rnor_6.0 1 221,735,517 - 221,749,088 (+) NCBI Rnor_5.0 1 228,723,282 - 228,737,009 (+) NCBI RGSC_v3.4 1 209,146,177 - 209,159,459 (+) RGD Celera 1 201,203,443 - 201,216,725 (+) RGD
Sequence:
CCGCGCAGTAACAAGAAGTGCGCGCTGCGACACCTCCCAGTTCACTCGGCCCCGCCGCCATTTCGTCGCCTGGCCTAACGGTTCGGCCAATCCCGACGCGTATTGAAAAGAACTAGTGCTCCGCCAAT
hide sequence
RefSeq Acc Id:
NM_058210 ⟹ NP_478117
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 213,099,281 - 213,112,563 (+) NCBI mRatBN7.2 1 203,670,021 - 203,683,304 (+) NCBI Rnor_6.0 1 221,735,517 - 221,749,088 (+) NCBI Rnor_5.0 1 228,723,282 - 228,737,009 (+) NCBI RGSC_v3.4 1 209,146,177 - 209,159,459 (+) RGD Celera 1 201,203,443 - 201,216,725 (+) RGD
Sequence:
CCGCGCAGTAACAAGAAGTGCGCGCTGCGACACCTCCCAGTTCACTCGGCCCCGCCGCCATTTCGTCGCCTGGCCTAACGGTTCGGCCAATCCCGACGCGTATTGAAAAGAACTAGTGCTCCGCCAAT
hide sequence
RefSeq Acc Id:
XM_039080398 ⟹ XP_038936326
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 213,090,256 - 213,112,688 (+) NCBI mRatBN7.2 1 203,670,250 - 203,682,270 (+) NCBI
RefSeq Acc Id:
XM_039080509 ⟹ XP_038936437
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 213,090,256 - 213,112,688 (+) NCBI mRatBN7.2 1 203,670,016 - 203,683,432 (+) NCBI
RefSeq Acc Id:
XM_039080582 ⟹ XP_038936510
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 213,090,256 - 213,112,688 (+) NCBI mRatBN7.2 1 203,670,016 - 203,683,432 (+) NCBI
RefSeq Acc Id:
XM_039080601 ⟹ XP_038936529
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 213,090,256 - 213,112,688 (+) NCBI mRatBN7.2 1 203,670,016 - 203,683,426 (+) NCBI
RefSeq Acc Id:
XM_039080641 ⟹ XP_038936569
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 213,101,276 - 213,112,688 (+) NCBI mRatBN7.2 1 203,672,047 - 203,683,257 (+) NCBI
RefSeq Acc Id:
XM_063268843 ⟹ XP_063124913
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 213,090,256 - 213,112,688 (+) NCBI
RefSeq Acc Id:
XM_063268911 ⟹ XP_063124981
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 213,090,256 - 213,112,688 (+) NCBI
RefSeq Acc Id:
XM_063268935 ⟹ XP_063125005
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 213,090,256 - 213,112,688 (+) NCBI
RefSeq Acc Id:
XM_063268967 ⟹ XP_063125037
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 213,101,270 - 213,112,688 (+) NCBI
RefSeq Acc Id:
XM_063268985 ⟹ XP_063125055
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 213,101,276 - 213,112,688 (+) NCBI
RefSeq Acc Id:
XM_063269068 ⟹ XP_063125138
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 213,101,276 - 213,112,688 (+) NCBI
RefSeq Acc Id:
XM_063269089 ⟹ XP_063125159
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 213,090,256 - 213,112,688 (+) NCBI
RefSeq Acc Id:
XM_063269115 ⟹ XP_063125185
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 213,101,276 - 213,112,688 (+) NCBI
RefSeq Acc Id:
XM_063269141 ⟹ XP_063125211
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 213,090,256 - 213,112,688 (+) NCBI
RefSeq Acc Id:
XM_063269180 ⟹ XP_063125250
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 213,090,256 - 213,112,688 (+) NCBI
RefSeq Acc Id:
XM_063269208 ⟹ XP_063125278
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 213,103,847 - 213,112,688 (+) NCBI
RefSeq Acc Id:
XM_063269232 ⟹ XP_063125302
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 213,101,276 - 213,112,688 (+) NCBI
RefSeq Acc Id:
XM_063269279 ⟹ XP_063125349
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 213,103,932 - 213,112,688 (+) NCBI
RefSeq Acc Id:
XM_063269311 ⟹ XP_063125381
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 213,090,256 - 213,112,688 (+) NCBI
RefSeq Acc Id:
NP_478117 ⟸ NM_058210
- Peptide Label:
isoform 2
- UniProtKB:
F1LM37 (UniProtKB/TrEMBL)
- Sequence:
MATGANATPLDFPSKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHTLITEMVALNPDFKPPAD
hide sequence
RefSeq Acc Id:
NP_001104263 ⟸ NM_001110793
- Peptide Label:
isoform 1
- UniProtKB:
F1LSC3 (UniProtKB/TrEMBL)
- Sequence:
MATGANATPLDFPSKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRK
hide sequence
Ensembl Acc Id:
ENSRNOP00000028628 ⟸ ENSRNOT00000028628
Ensembl Acc Id:
ENSRNOP00000041676 ⟸ ENSRNOT00000044866
RefSeq Acc Id:
XP_038936510 ⟸ XM_039080582
- Peptide Label:
isoform X8
RefSeq Acc Id:
XP_038936437 ⟸ XM_039080509
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_038936529 ⟸ XM_039080601
- Peptide Label:
isoform X9
RefSeq Acc Id:
XP_038936326 ⟸ XM_039080398
- Peptide Label:
isoform X1
- UniProtKB:
F1LSC3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038936569 ⟸ XM_039080641
- Peptide Label:
isoform X17
- UniProtKB:
I6L9G4 (UniProtKB/TrEMBL), F1LM37 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000082510 ⟸ ENSRNOT00000110004
Ensembl Acc Id:
ENSRNOP00000079109 ⟸ ENSRNOT00000100785
RefSeq Acc Id:
XP_063124913 ⟸ XM_063268843
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_063125381 ⟸ XM_063269311
- Peptide Label:
isoform X19
- UniProtKB:
A0A8I6G7I2 (UniProtKB/TrEMBL), A6HZG9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063124981 ⟸ XM_063268911
- Peptide Label:
isoform X4
RefSeq Acc Id:
XP_063125159 ⟸ XM_063269089
- Peptide Label:
isoform X11
RefSeq Acc Id:
XP_063125250 ⟸ XM_063269180
- Peptide Label:
isoform X14
RefSeq Acc Id:
XP_063125005 ⟸ XM_063268935
- Peptide Label:
isoform X5
RefSeq Acc Id:
XP_063125211 ⟸ XM_063269141
- Peptide Label:
isoform X13
- UniProtKB:
A0A8I5ZQ56 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063125037 ⟸ XM_063268967
- Peptide Label:
isoform X6
- UniProtKB:
F1LSC3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063125138 ⟸ XM_063269068
- Peptide Label:
isoform X10
RefSeq Acc Id:
XP_063125185 ⟸ XM_063269115
- Peptide Label:
isoform X12
RefSeq Acc Id:
XP_063125302 ⟸ XM_063269232
- Peptide Label:
isoform X16
RefSeq Acc Id:
XP_063125055 ⟸ XM_063268985
- Peptide Label:
isoform X7
- UniProtKB:
F1LSC3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063125278 ⟸ XM_063269208
- Peptide Label:
isoform X15
- UniProtKB:
F1LSC3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063125349 ⟸ XM_063269279
- Peptide Label:
isoform X18
RGD ID: 13690699 Promoter ID: EPDNEW_R1222 Type: multiple initiation site Name: Sf1_1 Description: splicing factor 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R1223 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 221,735,514 - 221,735,574 EPDNEW
RGD ID: 13690700 Promoter ID: EPDNEW_R1223 Type: initiation region Name: Sf1_2 Description: splicing factor 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R1222 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 221,735,746 - 221,735,806 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2006-07-26
Sf1
splicing factor 1
Zfp162
zinc finger protein 162
Symbol and Name updated to reflect Human and Mouse nomenclature
1299863 APPROVED
2005-07-08
Zfp162
zinc finger protein 162
Symbol and Name status set to approved
1299863 APPROVED
2002-08-07
Zfp162
zinc finger protein 162
Symbol and Name status set to provisional
70820 PROVISIONAL
