Advanced Search (OLGA)

Gene: Prmt3 (protein arginine methyltransferase 3) Rattus norvegicus

Analyze

Symbol:

Prmt3

Name:

protein arginine methyltransferase 3

RGD ID:

620413

Description:

Enables modified amino acid binding activity and protein-arginine omega-N asymmetric methyltransferase activity. Involved in dendritic spine morphogenesis. Predicted to be located in cytosol. Predicted to be active in nucleus. Biomarker of asthma. Orthologous to human PRMT3 (protein arginine methyltransferase 3); PARTICIPATES IN histidine metabolic pathway; histidinemia pathway; homocysteine metabolic pathway; INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

heterogeneous nuclear ribonucleoprotein methyltransferase-like 3; heterogeneous nuclear ribonucleoprotein methyltransferase-like 3 (S. cerevisiae); heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 3; Hrmt1l3; protein arginine N-methyltransferase 3; protein arginine N-methyltransferase 3(hnRNP methyltransferase S. cerevisiae)-like 3

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PRMT3 (protein arginine methyltransferase 3)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Prmt3 (protein arginine N-methyltransferase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Prmt3 (protein arginine methyltransferase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PRMT3 (protein arginine methyltransferase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PRMT3 (protein arginine methyltransferase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Prmt3 (protein arginine methyltransferase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PRMT3 (protein arginine methyltransferase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PRMT3 (protein arginine methyltransferase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Prmt3 (protein arginine methyltransferase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Prmt3 (protein arginine methyltransferase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	CDRT4 (CMT1A duplicated region transcript 4)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Prmt3 (protein arginine N-methyltransferase 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	PRMT3 (protein arginine methyltransferase 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	prmt3 (protein arginine methyltransferase 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Art3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Art3	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	prmt3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	prmt3	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	108,628,899 - 108,718,803 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	108,626,749 - 108,718,803 (+)	Ensembl				GRCr8
mRatBN7.2	1	99,492,712 - 99,581,774 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	99,492,724 - 99,579,435 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	104,846,834 - 104,933,517 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	113,318,757 - 113,405,436 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	106,641,014 - 106,727,679 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	105,113,595 - 105,200,253 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	105,113,595 - 105,200,470 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	106,163,799 - 106,250,502 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	99,581,943 - 99,668,604 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	93,691,794 - 93,778,258 (+)	NCBI		Celera
RGSC_v3.1	1	99,660,053 - 99,746,714 (+)	NCBI
Cytogenetic Map	1	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

asthma (IEP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(-)-epigallocatechin 3-gallate (ISO)

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

1-nitropyrene (ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

acrylamide (EXP,ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

atrazine (EXP)

Benoxacor (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium dichloride (ISO)

caffeine (EXP)

carbon nanotube (ISO)

chromium(6+) (ISO)

cisplatin (ISO)

cobalt dichloride (ISO)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

DDE (ISO)

dexamethasone (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (ISO)

dicrotophos (ISO)

dioxygen (ISO)

doxorubicin (ISO)

elemental selenium (ISO)

enzyme inhibitor (ISO)

ethyl methanesulfonate (ISO)

fenthion (ISO)

formaldehyde (ISO)

FR900359 (ISO)

gentamycin (EXP)

indometacin (ISO)

ivermectin (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

methoxyacetic acid (EXP)

methyl methanesulfonate (ISO)

methylmercury chloride (EXP)

Monobutylphthalate (EXP)

N-methyl-4-phenylpyridinium (EXP)

nitrates (ISO)

paracetamol (EXP,ISO)

paraquat (EXP)

pentachlorophenol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

phenytoin (EXP)

pirinixic acid (ISO)

potassium chromate (ISO)

resveratrol (ISO)

ribavirin (ISO)

rotenone (EXP)

selenium atom (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

tert-butyl hydroperoxide (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (ISO)

Tributyltin oxide (ISO)

trichostatin A (ISO)

triphenyl phosphate (ISO)

vinclozolin (EXP)

vitamin E (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

chromatin remodeling (IBA)

dendritic spine morphogenesis (IMP)

methylation (IEA)

negative regulation of protein ubiquitination (ISO)

negative regulation of retinoic acid biosynthetic process (ISO,ISS)

peptidyl-arginine methylation (IDA)

peptidyl-arginine methylation, to asymmetrical-dimethyl arginine (IDA)

positive regulation of osteoblast differentiation (ISO)

regulation of DNA-templated transcription (IBA)

transcription initiation-coupled chromatin remodeling (ISO)

Cellular Component

cytoplasm (ISO)

cytosol (IEA,ISO)

nucleus (IBA,IEA,ISO)

Molecular Function

histone H4R3 methyltransferase activity (ISO)

histone methyltransferase activity (IBA)

metal ion binding (IEA)

methyltransferase activity (IEA,ISO)

modified amino acid binding (IDA)

protein binding (ISO)

protein-arginine N-methyltransferase activity (IBA,IDA,IEA,ISO)

protein-arginine omega-N asymmetric methyltransferase activity (IDA,IEA,ISO)

protein-arginine omega-N monomethyltransferase activity (IEA)

S-adenosylmethionine-dependent methyltransferase activity (TAS)

transferase activity (IEA)

zinc ion binding (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

histidine metabolic pathway (ISO)

histidinemia pathway (ISO)

homocysteine metabolic pathway (ISS)

methionine cycle/metabolic pathway (ISO,ISS)

References

References - curated

#	Reference Title	Reference Citation
1.	Arginine methylation an emerging regulator of protein function.	Bedford MT and Richard S, Mol Cell 2005 Apr 29;18(3):263-72.
2.	Histone arginine methylation.	Di Lorenzo A and Bedford MT, FEBS Lett. 2011 Jul 7;585(13):2024-31. doi: 10.1016/j.febslet.2010.11.010. Epub 2010 Nov 11.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	PRMT3 is essential for dendritic spine maturation in rat hippocampal neurons.	Miyata S, etal., Brain Res. 2010 Sep 17;1352:11-20. doi: 10.1016/j.brainres.2010.07.033. Epub 2010 Jul 18.
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
7.	GOA pipeline	RGD automated data pipeline
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	[Expression of protein arginine N-methyltransferases in E3 rat models of acute asthma].	Sun QZ, etal., Nan Fang Yi Ke Da Xue Xue Bao. 2010 Apr;30(4):716-9.
10.	PRMT 3, a type I protein arginine N-methyltransferase that differs from PRMT1 in its oligomerization, subcellular localization, substrate specificity, and regulation.	Tang J, etal., J Biol Chem 1998 Jul 3;273(27):16935-45.
11.	Crystal structure of the conserved core of protein arginine methyltransferase PRMT3.	Zhang X, etal., EMBO J. 2000 Jul 17;19(14):3509-19.

Additional References at PubMed

PMID:10931850	PMID:15473865	PMID:18495660	PMID:18573314	PMID:24815167

Genomics

Comparative Map Data

Prmt3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	108,628,899 - 108,718,803 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	108,626,749 - 108,718,803 (+)	Ensembl				GRCr8
mRatBN7.2	1	99,492,712 - 99,581,774 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	99,492,724 - 99,579,435 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	104,846,834 - 104,933,517 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	113,318,757 - 113,405,436 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	106,641,014 - 106,727,679 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	105,113,595 - 105,200,253 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	105,113,595 - 105,200,470 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	106,163,799 - 106,250,502 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	99,581,943 - 99,668,604 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	93,691,794 - 93,778,258 (+)	NCBI		Celera
RGSC_v3.1	1	99,660,053 - 99,746,714 (+)	NCBI
Cytogenetic Map	1	q22	NCBI

PRMT3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	20,387,716 - 20,509,338 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	20,387,549 - 20,509,350 (+)	Ensembl			hg38	GRCh38
GRCh37	11	20,409,262 - 20,530,884 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	20,365,679 - 20,487,349 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	11	20,541,661 - 20,662,994 (+)	NCBI		Celera
Cytogenetic Map	11	p15.1	NCBI
HuRef	11	20,092,368 - 20,214,172 (+)	NCBI		HuRef
CHM1_1	11	20,408,983 - 20,530,723 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	11	20,508,397 - 20,629,944 (+)	NCBI		T2T-CHM13v2.0

Prmt3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	49,428,067 - 49,508,016 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	49,428,094 - 49,508,013 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	7	49,778,319 - 49,861,264 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	49,778,346 - 49,858,265 (+)	Ensembl			mm10	GRCm38
MGSCv37	7	57,033,728 - 57,113,635 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	7	49,646,379 - 49,726,286 (+)	NCBI		MGSCv36	mm8
Celera	7	45,228,154 - 45,308,430 (+)	NCBI		Celera
Cytogenetic Map	7	B4	NCBI
cM Map	7	31.44	NCBI

Prmt3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955476	1,223,076 - 1,331,582 (+)	Ensembl
ChiLan1.0	NW_004955476	1,222,579 - 1,331,582 (+)	NCBI	ChiLan1.0	ChiLan1.0

PRMT3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	9	22,688,983 - 22,817,065 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	11	22,648,763 - 22,776,831 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	20,412,419 - 20,538,295 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	11	20,324,196 - 20,449,681 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	11	20,324,196 - 20,449,681 (+)	Ensembl			panPan2	panpan1.1

PRMT3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	21	42,406,327 - 42,530,157 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	21	42,406,314 - 42,528,116 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	21	41,882,566 - 42,006,278 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	21	43,527,769 - 43,650,988 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	21	43,527,763 - 43,653,579 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	21	42,529,594 - 42,653,065 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	21	42,705,438 - 42,829,263 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	21	43,087,080 - 43,211,034 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Prmt3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	42,462,572 - 42,589,987 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936654	1,336,429 - 1,461,476 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936654	1,336,546 - 1,464,959 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PRMT3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	38,884,362 - 39,032,996 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	2	38,884,311 - 39,032,944 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	41,911,569 - 41,930,041 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PRMT3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	44,486,165 - 44,621,002 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	1	44,485,880 - 44,620,936 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666038	141,822,116 - 141,955,377 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Prmt3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624766	11,670,108 - 11,795,272 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624766	11,669,732 - 11,797,133 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Prmt3
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	2	149,974,174 - 150,063,185 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Prmt3
530 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	224
Count of miRNA genes:	146
Interacting mature miRNAs:	173
Transcripts:	ENSRNOT00000020853
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1582234	Gluco18	Glucose level QTL 18	3.4	0.0003	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	87889942	132889942	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	39728272	132889942	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	51941022	208479811	Rat
1331793	Bp200	Blood pressure QTL 200	3.71601		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	102780511	182384005	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	51940904	168768703	Rat
2300324	Fetw1	Fetal weight QTL 1	12.1	0.005	fetal growth trait (VT:0004201)	fetal body weight (CMO:0002080)	1	92963855	109494029	Rat
1554320	Bmd1	Bone mineral density QTL 1	12.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	101228864	146228864	Rat
1331800	Scl25	Serum cholesterol level QTL 25	3.013		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	87785026	142582336	Rat
7421628	Bp361	Blood pressure QTL 361		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	83019780	128019780	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	66404680	111404680	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34184556	172281316	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	66009857	160501508	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34565911	208798288	Rat
631519	Pia11	Pristane induced arthritis QTL 11	5.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	93903998	191260518	Rat
1302788	Scl19	Serum cholesterol QTL 19	4.6	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	66400974	132889942	Rat
61399	Tcat1	Tongue tumor resistance QTL 1	3.3		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 5 mm (CMO:0001879)	1	108680016	153680016	Rat
1549903	Bp267	Blood pressure QTL 267			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	84107164	115183752	Rat
2313083	Bmd74	Bone mineral density QTL 74	4	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	91302413	136302413	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	51511344	153680016	Rat
724567	Tcas6	Tongue tumor susceptibility QTL 6	6.85		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	1	102359314	153680016	Rat
724521	Uae1	Urinary albumin excretion QTL 1	3.8	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	99645382	182701046	Rat
1358902	Bw47	Body weight QTL 47	1.67		body mass (VT:0001259)	body weight (CMO:0000012)	1	99645382	221502378	Rat
1358192	Ept13	Estrogen-induced pituitary tumorigenesis QTL 13	3.4		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	86622262	131622262	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	66077886	111077886	Rat
731168	Bp154	Blood pressure QTL 154	3.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	103779152	223964440	Rat
631205	Bp196	Blood pressure QTL 196	4	0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	98879955	208479939	Rat
738022	Anxrr13	Anxiety related response QTL 13	4.6	0.00039	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of, or within a discrete space in an open field apparatus (CMO:0001514)	1	92683681	137683681	Rat
152025249	Scl82	Serum cholesterol level QTL 82	4.77		blood cholesterol amount (VT:0000180)		1	52891222	109116986	Rat
10054135	Gmadr2	Adrenal mass QTL 2	1.97	0.0129	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	86993904	131993904	Rat
7411712	Strs4	Sensitivity to stroke QTL 4	8.7		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	1	87558587	132558587	Rat
1331749	Hrtrt11	Heart rate QTL 11	2.973		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	92683681	137683681	Rat
737977	Bp160	Blood pressure QTL 160		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	97582336	142582336	Rat
2293142	Bp314	Blood pressure QTL 314			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	101594089	146594089	Rat
61433	Cia2	Collagen induced arthritis QTL 2	5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	100345976	145345976	Rat
724529	Cm16	Cardiac mass QTL 16	2.7		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	1	96717367	160111531	Rat

Markers in Region

RH141582

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	99,579,143 - 99,579,339 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	105,199,960 - 105,200,155	NCBI	Rnor6.0
Rnor_5.0	1	106,250,209 - 106,250,404	UniSTS	Rnor5.0
RGSC_v3.4	1	99,668,311 - 99,668,506	UniSTS	RGSC3.4
Celera	1	93,777,965 - 93,778,160	UniSTS
RH 3.4 Map	1	920.5	UniSTS
Cytogenetic Map	1	q22	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	164	91	90	59	92	59	6	356	192	11	143	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053557	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039093128	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF059530	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000020853 ⟹ ENSRNOP00000020853

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	108,628,907 - 108,718,794 (+)	Ensembl
mRatBN7.2 Ensembl	1	99,492,724 - 99,579,435 (+)	Ensembl
Rnor_6.0 Ensembl	1	105,113,595 - 105,200,259 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000079655 ⟹ ENSRNOP00000069745

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	108,628,907 - 108,718,794 (+)	Ensembl
mRatBN7.2 Ensembl	1	99,492,724 - 99,579,435 (+)	Ensembl
Rnor_6.0 Ensembl	1	105,113,658 - 105,200,470 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000127157 ⟹ ENSRNOP00000110628

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	108,626,749 - 108,718,803 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000161702 ⟹ ENSRNOP00000104381

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	108,628,907 - 108,718,794 (+)	Ensembl

RefSeq Acc Id:

NM_053557 ⟹ NP_446009

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	108,628,924 - 108,718,803 (+)	NCBI
mRatBN7.2	1	99,492,768 - 99,579,437 (+)	NCBI
Rnor_6.0	1	105,113,595 - 105,200,253 (+)	NCBI
Rnor_5.0	1	106,163,799 - 106,250,502 (+)	NCBI
RGSC_v3.4	1	99,581,943 - 99,668,604 (+)	RGD
Celera	1	93,691,794 - 93,778,258 (+)	RGD

Sequence:

show sequence

GTTGCTTTGGGGCTACCGCGCGCCCGCGCTCGTTCCCAGCTCCGGTCCCGCGCTGTGCGGTCGC
GCGCTTGGTCGGCGGCCATGTGTTCGCTGGCGGCGGGGAACGGACAAGGCGCGGAGCTGGGGCC
GGAGCCCTTGGAGCTGTCGGACAGCGGAGACGACGCGGGCTGGGAGGACGAGGACGCGGACGCT
GAGCCCGCACAGGGCCGGCAGCACACACCCTGCCTGTTCTGTGACAGGCTCTTCAGGTCTGCTG
AAGAAACGTTTTCACACTGTAAGTTGGAGCATCAATTTAATATTGATGGTATGGTCCACAAACA
TGGACTGGAATTTTATGGATACATTAAACTAATAAATTTTATTAGACTTAAGAATCCTACTGTT
GAGTACATGAATTCCATATACAACCCTGTGCCTTGGGATAAAGATGAGTACCTGAAGCCAGTGT
TGGAAGATGATCTTTTGCTTCAGTTTGATGTAGAAGATCTTTATGAGCCAGTGTCTGCTCCCTT
CACATACCCCAATGGACTCAGCGAAAACACATCTGCTGTTGAGAAATTGAAGCTCATGGAGGCC
CGGGCGCTGTCTGCTGAGGCGGCTCTGGCTCGGGCGCGTGAGGATCTGCAGAAGATGAAACAAT
TTGCTCAGGACTTTGTGATGAACGTAGATGTCAGAACCTGCTCCTCCACGACTACCATTGCAGA
CCTGCAGGAGGACGAGGATGGCGTCTACTTCAGCTCCTATGGGCATTATGGGATACATGAAGAA
ATGCTAAAGGACAAAGTGCGCACAGAAAGCTACAGAGATTTCATATACCAAAATCCACACATCT
TCAAAGATAAGGTTGTTCTGGATGTTGGCTGTGGAACTGGAATTCTCTCCATGTTTGCTGCCAA
AGCTGGGGCAAAGAAGGTGATTGCAGTTGACCAGTCTGAAATCCTCTACCAGGCTATGGATATC
ATAAGGCTAAATAAACTTGAAGATACCATTGTACTAATTAAAGGAAAGATCGAAGAAGTGAGTC
TTCCTGTGGAAAAGGTGGATGTTATTATATCAGAGTGGATGGGCTATTTTCTTCTTTTTGAGTC
GATGTTGGATTCTGTCCTTTATGCCAAGAGCAAATACTTGGCAAAAGGGGGATCGGTCTACCCT
GACATTTGCACCATCAGCCTTGTGGCCGTGAGTGACGTGAGCAAACACGCCGATAGAATTGCCT
TCTGGGATGACGTCTATGGCTTCAACATGTCCTGCATGAAGAAAGCAGTTATACCAGAAGCTGT
TGTGGAAGTTGTAGATCACAAGACTCTCATTTCAGACCCTTGTGATATCAAGCATATAGATTGC
CACACCACATCTATCTCAGACTTGGAGTTTTCTTCAGACTTTACCCTGAGAACCACAAAGACAG
CCATGTGCACGGCAGTTGCTGGGTACTTTGATATATATTTTGAGAAGAACTGTCACAACAGGGT
TGTATTCTCTACTGGCCCCCAGAGCACCAAAACACACTGGAAACAGACAATATTTCTTCTGGAA
AAGCCTTTTCCCGTTAAAGCAGGTGAAGCCTTAAAAGGAAAGATCACAGTTCACAAGAACAAGA
AGGATCCTCGTTCCCTCATTGTGACCCTGACCTTGAACAGTTCAACCCAGACTTACAGTCTCCA
GTGACAGTCATGGTCTCCAGCCGCCACAAAGTCTGAAGCACACCCAACTGTCTGTTAAAGCGGG
ATAAGGCAATCAGCAGGAGGGGCAGGCTCCACGGGGCTGTAGCATGGCTGCTCCTGGTCCTGCA
GCTACTGGGTAGTAAGCCCAAATAAAGCAGAGAGCTCAGTGGAGGCCTGTGCCCTCCTTCCTCC
TACTGCTTCTGCTCCTAGAGATCCTAGTCACAGAAGCCTGCTTGGCCAGATTAGCTGAAGAGAC
TTCCTCTCCTGCTAGACTGAGAGTCATTTGAATTGGCTTACTTTTGGAACAGTAATAGTCCTGG
TTTTTAAATTATATATATGTTTCTTACTATAAATTTTGTTTTTAATAATGAGCAACACAAAGCA
GTGTTTTACTGTAGATTTCCTTTCTAGAGGAACAGTTTTTAGTTACACTCTTTGCTGCAATATC
AGGATATCTTAAGACTAGGGAGCCAGTGGATGGGACACAGCAGCGTCTCTCACACATTCTGTTT
GCAGGGGCTGTGCTGCGGTCCTCTCCACCCACCTGCAGCTCAGCTGTACCCCTCAGTGTTCTCC
AGCCATAGCCTAGCAATGTGGGGAAGTCTAACTTCAGTGCACAGCCTAGGTGTGACAGACTACT
CTTCAGGCTGGGATAGAGGTATCTAAAATGCTGCCTTTACAGACCAGGTTTGTGCCAAGGCCAT
GTATCCATCTGCTAGTACTGTAAAATCATGATATTCAGGTTGAAAAAATGAAAAATATCCAATA
AAATGTGTAACTATTGAAATAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039093128 ⟹ XP_038949056

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	108,628,899 - 108,717,950 (+)	NCBI
mRatBN7.2	1	99,492,712 - 99,581,774 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_446009	(Get FASTA)	NCBI Sequence Viewer
	XP_038949056	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAC40158	(Get FASTA)	NCBI Sequence Viewer
	EDM07219	(Get FASTA)	NCBI Sequence Viewer
	EDM07220	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000020853
	ENSRNOP00000069745
GenBank Protein	O70467	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_446009 ⟸ NM_053557

- UniProtKB:

O70467 (UniProtKB/Swiss-Prot), A6JBG4 (UniProtKB/TrEMBL), A0A8L2QAU2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MCSLAAGNGQGAELGPEPLELSDSGDDAGWEDEDADAEPAQGRQHTPCLFCDRLFRSAEETFSH
CKLEHQFNIDGMVHKHGLEFYGYIKLINFIRLKNPTVEYMNSIYNPVPWDKDEYLKPVLEDDLL
LQFDVEDLYEPVSAPFTYPNGLSENTSAVEKLKLMEARALSAEAALARAREDLQKMKQFAQDFV
MNVDVRTCSSTTTIADLQEDEDGVYFSSYGHYGIHEEMLKDKVRTESYRDFIYQNPHIFKDKVV
LDVGCGTGILSMFAAKAGAKKVIAVDQSEILYQAMDIIRLNKLEDTIVLIKGKIEEVSLPVEKV
DVIISEWMGYFLLFESMLDSVLYAKSKYLAKGGSVYPDICTISLVAVSDVSKHADRIAFWDDVY
GFNMSCMKKAVIPEAVVEVVDHKTLISDPCDIKHIDCHTTSISDLEFSSDFTLRTTKTAMCTAV
AGYFDIYFEKNCHNRVVFSTGPQSTKTHWKQTIFLLEKPFPVKAGEALKGKITVHKNKKDPRSL
IVTLTLNSSTQTYSLQ

hide sequence

Ensembl Acc Id:

ENSRNOP00000069745 ⟸ ENSRNOT00000079655

Ensembl Acc Id:

ENSRNOP00000020853 ⟸ ENSRNOT00000020853

RefSeq Acc Id:	XP_038949056 ⟸ XM_039093128
- Peptide Label:	isoform X1
- UniProtKB:	A0A0G2JW52 (UniProtKB/TrEMBL), A0A8L2QAU2 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000104381 ⟸ ENSRNOT00000161702

Ensembl Acc Id:

ENSRNOP00000110628 ⟸ ENSRNOT00000127157

Protein Domains

Protein arginine N-methyltransferase Protein arginine N-methyltransferase 3 C2H2 zinc Protein arginine N-methyltransferase 3-like C2H2 SAM-dependent MTase PRMT-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O70467-F1-model_v2	AlphaFold	O70467	1-528	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13690078

Promoter ID:

EPDNEW_R602

Type:

multiple initiation site

Name:

Prmt3_1

Description:

protein arginine methyltransferase 3

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	105,113,568 - 105,113,628	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620413	AgrOrtholog
BioCyc Gene	G2FUF-59559	BioCyc
Ensembl Genes	ENSRNOG00000014829	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000020853	ENTREZGENE
	ENSRNOT00000079655	ENTREZGENE
Gene3D-CATH	3.40.50.150	UniProtKB/Swiss-Prot
	Hnrnp arginine n-methyltransferase1	UniProtKB/Swiss-Prot
InterPro	ANM3-like_C2H2_Zf	UniProtKB/Swiss-Prot
	ANM3_Znf-C2H2	UniProtKB/Swiss-Prot
	Arg_MeTrfase	UniProtKB/Swiss-Prot
	PRMT_dom	UniProtKB/Swiss-Prot
	SAM-dependent_MTases	UniProtKB/Swiss-Prot
	Znf_C2H2_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:89820	UniProtKB/Swiss-Prot
NCBI Gene	89820	ENTREZGENE
PANTHER	PROTEIN ARGININE N-METHYLTRANSFERASE 3	UniProtKB/Swiss-Prot
	PTHR11006	UniProtKB/Swiss-Prot
Pfam	ANM3_C2H2_Zf	UniProtKB/Swiss-Prot
	ANM3_zf-C2H2	UniProtKB/Swiss-Prot
	PrmA	UniProtKB/Swiss-Prot
	PRMT_C	UniProtKB/Swiss-Prot
PhenoGen	Prmt3	PhenoGen
PROSITE	SAM_MT_PRMT	UniProtKB/Swiss-Prot
	ZINC_FINGER_C2H2_1	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000014829	RatGTEx
Superfamily-SCOP	SSF53335	UniProtKB/Swiss-Prot
	SSF57667	UniProtKB/Swiss-Prot
UniProt	A0A0G2JW52	ENTREZGENE, UniProtKB/TrEMBL
	A0A8L2QAU2	ENTREZGENE, UniProtKB/TrEMBL
	A0ABK0LSN4_RAT	UniProtKB/TrEMBL
	A0ABK0M0T5_RAT	UniProtKB/TrEMBL
	A6JBG4	ENTREZGENE, UniProtKB/TrEMBL
	ANM3_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-10-24	Prmt3	protein arginine methyltransferase 3	Prmt3	protein arginine N-methyltransferase 3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-25	Prmt3	protein arginine N-methyltransferase 3	Hrmt1l3	heterogeneous nuclear ribonucleoprotein methyltransferase-like 3 (S. cerevisiae)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	Hrmt1l3	heterogeneous nuclear ribonucleoprotein methyltransferase-like 3 (S. cerevisiae)	Prmt3	protein arginine N-methyltransferase 3(hnRNP methyltransferase S. cerevisiae)-like 3	Symbol and Name updated	1299863	APPROVED
2002-08-07	Prmt3	protein arginine N-methyltransferase 3(hnRNP methyltransferase S. cerevisiae)-like 3			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_other	probably acts as a monomer	729523

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

RGD Manual Annotations

Imported Annotations - SMPDB

Send us a Message

RGD Manual Annotations

Imported Annotations - SMPDB