Advanced Search (OLGA)

Gene: Akr7a2 (aldo-keto reductase family 7, member A2) Rattus norvegicus

Analyze

Symbol:

Akr7a2

Name:

aldo-keto reductase family 7, member A2

RGD ID:

620311

Description:

Enables alcohol dehydrogenase (NADP+) activity. Predicted to be involved in daunorubicin metabolic process and doxorubicin metabolic process. Located in several cellular components, including Golgi apparatus; nuclear envelope; and smooth endoplasmic reticulum. Orthologous to human AKR7A2 (aldo-keto reductase family 7 member A2); INTERACTS WITH (+)-schisandrin B; 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane; 17alpha-ethynylestradiol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

aflatoxin B1 aldehyde reductase member 2; Aiar; aldo-keto reductase family 7, member A2 (aflatoxin aldehyde reductase); rAFAR2; SSA reductase; succinic semialdehyde reductase

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	AKR7A2 (aldo-keto reductase family 7 member A2)	HGNC	Ensembl, HomoloGene, Inparanoid, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Akr7a5 (aldo-keto reductase family 7, member A5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Akr7a2 (aldo-keto reductase family 7 member A2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	LOC100981962 (aflatoxin B1 aldehyde reductase member 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	AKR7A2 (aldo-keto reductase family 7 member A2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	LOC101974041 (aflatoxin B1 aldehyde reductase member 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	AKR7A2 (aldo-keto reductase family 7 member A2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	LOC103225480 (aflatoxin B1 aldehyde reductase member 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	AKR7A3 (aldo-keto reductase family 7 member A3)	HGNC	OrthoDB
Homo sapiens (human):	AKR7L (aldo-keto reductase family 7 like (gene/pseudogene))	HGNC	Ensembl
Alliance orthologs ³
Homo sapiens (human):	AKR7A2 (aldo-keto reductase family 7 member A2)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Homo sapiens (human):	AKR7A2 (aldo-keto reductase family 7 member A2)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Mus musculus (house mouse):	Akr7a5 (aldo-keto reductase family 7, member A5)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Akr7a5 (aldo-keto reductase family 7, member A5)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	akr7a3 (aldo-keto reductase family 7, member A3 (aflatoxin aldehyde reductase))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	AAD10	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoInspector)
Saccharomyces cerevisiae (baker's yeast):	AAD10	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoInspector\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	AAD14	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoInspector)
Saccharomyces cerevisiae (baker's yeast):	AAD14	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoInspector\|SonicParanoid)
Caenorhabditis elegans (roundworm):	mec-14	Alliance	DIOPT (Ensembl Compara\|InParanoid)
Caenorhabditis elegans (roundworm):	mec-14	Alliance	DIOPT (Ensembl Compara\|OrthoInspector)
Xenopus tropicalis (tropical clawed frog):	akr7a2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	akr7a2	Alliance	DIOPT (OMA\|OrthoFinder\|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):	AAD3	Alliance	DIOPT (Ensembl Compara\|InParanoid\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	AAD4	Alliance	DIOPT (Ensembl Compara\|InParanoid\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	156,835,589 - 156,844,127 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	156,835,551 - 156,844,109 (+)	Ensembl				GRCr8
mRatBN7.2	5	151,552,375 - 151,560,914 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	151,552,343 - 151,560,909 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	154,250,866 - 154,259,404 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	156,025,214 - 156,033,752 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	156,006,202 - 156,014,739 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	157,759,448 - 157,768,473 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	157,759,416 - 157,768,471 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	161,499,603 - 161,508,628 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	158,097,679 - 158,106,217 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	149,932,592 - 149,941,127 (+)	NCBI		Celera
RGSC_v3.1	5	158,107,717 - 158,116,254 (+)	NCBI
Cytogenetic Map	5	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Alzheimer's disease (ISO)

autism spectrum disorder (ISO)

pancreatic ductal adenocarcinoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (EXP)

1,2-dimethylhydrazine (ISO)

1,2-naphthoquinone (ISO)

14-Deoxy-11,12-didehydroandrographolide (ISO)

16-Ketoestrone (ISO)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (EXP,ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-trinitrotoluene (EXP)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP,ISO)

2,6-dimethoxyphenol (ISO)

2-methylcholine (ISO)

2-nitrobenzaldehyde (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

3,4-methylenedioxymethamphetamine (EXP)

3-chloropropane-1,2-diol (EXP)

3-nitrobenzaldehyde (ISO)

3H-1,2-dithiole-3-thione (EXP)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

4-amino-2,6-dinitrotoluene (EXP)

4-hydroxynon-2-enal (ISO)

4-nitrobenzaldehyde (ISO)

5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP)

6-propyl-2-thiouracil (EXP)

7,12-dimethyltetraphene (ISO)

9,10-phenanthroquinone (ISO)

acetamide (EXP)

acrolein (ISO)

acrylamide (ISO)

aflatoxin B1 (EXP)

Aflatoxin B2 alpha (ISO)

alpha-pinene (ISO)

amiodarone (EXP)

ammonium chloride (EXP)

antimycin A (ISO)

aristolochic acid A (ISO)

Aroclor 1254 (ISO)

atorvastatin calcium (ISO)

azoxystrobin (ISO)

benzbromarone (EXP)

benzo[a]pyrene-7,8-dione (ISO)

beta-naphthoflavone (EXP)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

bisphenol F (ISO)

bortezomib (ISO)

Brodifacoum (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

CGP 52608 (ISO)

chenodeoxycholic acid (ISO)

chlordecone (ISO)

cisplatin (ISO)

clofibrate (EXP,ISO)

cobalt dichloride (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

deguelin (ISO)

deoxycholic acid (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP,ISO)

dimethylarsinic acid (ISO)

dioxygen (ISO)

doxorubicin (ISO)

endosulfan (EXP)

epoxiconazole (ISO)

etacrynic acid (ISO)

eugenol (EXP)

fenpyroximate (ISO)

folic acid (ISO)

FR900359 (ISO)

fulvestrant (ISO)

furan (EXP)

furfural (ISO)

gentamycin (EXP)

glafenine (EXP)

glutathione (EXP,ISO)

glycochenodeoxycholic acid (ISO)

glycocholic acid (ISO)

glycodeoxycholic acid (ISO)

hexanal (ISO)

hydrogen peroxide (ISO)

hypochlorous acid (ISO)

indole-3-methanol (EXP)

indometacin (ISO)

inulin (ISO)

isatin (ISO)

ivermectin (ISO)

L-ethionine (EXP)

leflunomide (EXP)

menadione (ISO)

methamphetamine (ISO)

methylarsonic acid (ISO)

methylglyoxal (ISO)

Muconic dialdehyde (ISO)

N-nitrosomorpholine (EXP)

NADP zwitterion (ISO)

NADP(+) (ISO)

naphthalenes (ISO)

naringin (ISO)

nefazodone (EXP)

nimesulide (EXP)

nitrates (ISO)

non-2-enal (ISO)

omeprazole (EXP)

oxaliplatin (EXP)

ozone (ISO)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

phenobarbital (ISO)

phlorizin (ISO)

picoxystrobin (ISO)

pirinixic acid (EXP,ISO)

piroxicam (ISO)

Propiverine (EXP)

pyrimidifen (ISO)

quercetin (ISO)

raloxifene (EXP)

reactive oxygen species (ISO)

rotenone (ISO)

sodium arsenate (ISO)

sodium arsenite (EXP,ISO)

sodium chloride (ISO)

sodium fluoride (ISO)

Soman (EXP)

succinic semialdehyde (ISO)

superoxide (ISO)

tartrazine (ISO)

tebufenpyrad (ISO)

tetrachloromethane (EXP)

thioacetamide (EXP)

thiram (ISO)

topotecan (EXP)

trichloroethene (EXP)

triphenyl phosphate (EXP)

Triptolide (EXP)

umbelliferone (ISO)

valproic acid (ISO)

vancomycin (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

daunorubicin metabolic process (ISO)

doxorubicin metabolic process (ISO)

lipid metabolic process (IEA)

Cellular Component

cytoplasm (IBA,IEA)

cytosol (IDA,ISO)

Golgi apparatus (IDA)

Golgi stack (IEA)

mitochondrion (IEA)

nuclear envelope (IDA)

smooth endoplasmic reticulum (IDA)

Molecular Function

alcohol dehydrogenase (NADP+) activity (IBA,IDA)

oxidoreductase activity (IEA)

phenanthrene-9,10-epoxide hydrolase activity (ISO)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Proteomic analysis of pancreatic ductal adenocarcinoma compared with normal adjacent pancreatic tissue and pancreatic benign cystadenoma.	Cui Y, etal., Pancreatology. 2009;9(1-2):89-98. Epub 2008 Dec 12.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Novel homodimeric and heterodimeric rat gamma-hydroxybutyrate synthases that associate with the Golgi apparatus define a distinct subclass of aldo-keto reductase 7 family proteins.	Kelly VP, etal., Biochem J 2002 Sep 15;366(Pt 3):847-61.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	Androgen-regulated expression of a novel member of the aldo-keto reductase superfamily in regrowing rat prostate.	Nishi N, etal., Endocrinology 2000 Sep;141(9):3194-9.
8.	Elevation of AKR7A2 (succinic semialdehyde reductase) in neurodegenerative disease.	Picklo MJ, etal., Brain Res. 2001 Oct 19;916(1-2):229-38.
9.	Aflatoxin B1 aldehyde reductase (AFAR) genes cluster at 1p35-1p36.1 in a region frequently altered in human tumour cells.	Praml C, etal., Oncogene 2003 Jul 24;22(30):4765-73.
10.	GOA pipeline	RGD automated data pipeline
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:14651853	PMID:15489334	PMID:18614015	PMID:19056867	PMID:20837989	PMID:23533145	PMID:26316108

Genomics

Comparative Map Data

Akr7a2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	156,835,589 - 156,844,127 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	156,835,551 - 156,844,109 (+)	Ensembl				GRCr8
mRatBN7.2	5	151,552,375 - 151,560,914 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	151,552,343 - 151,560,909 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	154,250,866 - 154,259,404 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	156,025,214 - 156,033,752 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	156,006,202 - 156,014,739 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	157,759,448 - 157,768,473 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	157,759,416 - 157,768,471 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	161,499,603 - 161,508,628 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	158,097,679 - 158,106,217 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	149,932,592 - 149,941,127 (+)	NCBI		Celera
RGSC_v3.1	5	158,107,717 - 158,116,254 (+)	NCBI
Cytogenetic Map	5	q36	NCBI

AKR7A2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	19,302,708 - 19,312,146 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	19,301,991 - 19,312,144 (-)	Ensembl			hg38	GRCh38
GRCh37	1	19,629,202 - 19,638,640 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	19,503,046 - 19,511,227 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	1	19,375,768 - 19,383,946	NCBI
Celera	1	17,957,442 - 17,965,624 (-)	NCBI		Celera
Cytogenetic Map	1	p36.13	NCBI
HuRef	1	17,875,577 - 17,884,829 (-)	NCBI		HuRef
CHM1_1	1	19,738,505 - 19,747,943 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	19,126,242 - 19,135,681 (-)	NCBI		T2T-CHM13v2.0

Akr7a5
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	139,038,005 - 139,046,097 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	139,038,055 - 139,045,737 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	4	139,310,720 - 139,318,786 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	139,310,744 - 139,318,426 (+)	Ensembl			mm10	GRCm38
MGSCv37	4	138,866,659 - 138,874,701 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	4	138,582,820 - 138,590,501 (+)	NCBI		MGSCv36	mm8
Celera	4	141,097,258 - 141,105,993 (+)	NCBI		Celera
Cytogenetic Map	4	D3	NCBI
cM Map	4	70.64	NCBI

Akr7a2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955452	7,418 - 13,837 (-)	Ensembl
ChiLan1.0	NW_004955452	6,844 - 13,868 (-)	NCBI	ChiLan1.0	ChiLan1.0

LOC100981962
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	207,802,957 - 207,822,054 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	206,919,935 - 206,938,840 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	18,262,631 - 18,270,783 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	19,309,211 - 19,317,836 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	19,309,471 - 19,317,227 (-)	Ensembl			panPan2	panpan1.1

AKR7A2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	79,334,179 - 79,343,880 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	79,334,205 - 79,343,007 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	75,849,105 - 75,858,155 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	79,956,898 - 79,965,951 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	79,956,898 - 79,968,886 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	76,717,803 - 76,726,853 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	77,727,438 - 77,736,710 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	78,798,535 - 78,808,663 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

LOC101974041
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	39,740,406 - 39,748,246 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936474	5,566,282 - 5,573,011 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936474	5,565,715 - 5,573,048 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

AKR7A2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	77,754,174 - 77,761,667 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	6	77,754,172 - 77,761,609 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	71,816,268 - 71,823,705 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LOC103225480
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	113,234,257 - 113,242,445 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666033	2,916,852 - 2,925,038 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants

Variants in Akr7a2
36 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	40
Count of miRNA genes:	36
Interacting mature miRNAs:	40
Transcripts:	ENSRNOT00000024063
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
10053720	Scort26	Serum corticosterone level QTL 26	2.06	0.0147	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	130249266	172190305	Rat
8552960	Pigfal15	Plasma insulin-like growth factor 1 level QTL 15			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	116702075	161702075	Rat
1354583	Despr3	Despair related QTL3	4.98	0.0002	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	5	132930505	172190305	Rat
61444	Strs2	Sensitivity to stroke QTL 2	4.7		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	5	141212838	172190305	Rat
1300119	Bp180	Blood pressure QTL 180	3.82		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	5	149642129	171146538	Rat
61452	Ciaa5	CIA Autoantibody QTL 5	3.5		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	5	99905133	172190305	Rat
8552908	Pigfal4	Plasma insulin-like growth factor 1 level QTL 4	6.6		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	133789363	172190305	Rat
1331803	Rf32	Renal function QTL 32	2.798		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	134369199	172190305	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	65089051	166764498	Rat
7794791	Mcs33	Mammary carcinoma susceptibility QTL 33	1.93		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	5	136631198	172190305	Rat
7207486	Bss109	Bone structure and strength QTL 109			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	5	112142946	157142946	Rat
1354631	Swd2	Spike wave discharge measurement QTL 2	3.64	0.0002	brain electrophysiology trait (VT:0010557)	brain total spike-and-wave discharge duration (CMO:0001740)	5	156396728	172190305	Rat
7207481	Bss106	Bone structure and strength QTL 106	7.9		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	112142946	157142946	Rat
1598861	Cm64	Cardiac mass QTL 64	2.9		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	133081618	172190305	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	51657967	166600247	Rat
631263	Cm24	Cardiac mass QTL 24	3.5		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	5	149805999	162987697	Rat
631505	Bp103	Blood pressure QTL 103	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	138002522	170842766	Rat
1549838	Bss4	Bone structure and strength QTL 4	9.2		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	5	112142946	157142946	Rat
1581505	Rf54	Renal function QTL 54			kidney physiology trait (VT:0002136)	kidney 20-HETE level (CMO:0001854)	5	133270647	172190305	Rat
2317753	Glom24	Glomerulus QTL 24	3.1		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	5	141764300	172190305	Rat
8694169	Bw148	Body weight QTL 148	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	133789363	172190305	Rat
1331721	Bp210	Blood pressure QTL 210	3.413		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	5	148093485	172129029	Rat
1581510	Cm54	Cardiac mass QTL 54	3.4	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	5	125969677	172190305	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55124766	172190305	Rat
631272	Lanf1	Left ventricular atrial natriuretic factor QTL 1	12		heart left ventricle natriuretic peptide A amount (VT:0010596)	heart left ventricle natriuretic peptide A level (CMO:0002165)	5	156396728	167181764	Rat
724525	Bp147	Blood pressure QTL 147	4.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	131708216	172190305	Rat
1598847	Cm62	Cardiac mass QTL 62	3.4		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	114131300	159131300	Rat
2313096	Bmd78	Bone mineral density QTL 78	3.1	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	5	149661912	166600247	Rat
7207488	Bss110	Bone structure and strength QTL 1	8.4		femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	5	112142946	157142946	Rat
8694441	Bw169	Body weight QTL 169	17.61	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	5	116702075	161702075	Rat
7207491	Bss112	Bone structure and strength QTL 112	7		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	5	112142946	157142946	Rat
8694389	Bw160	Body weight QTL 160	6.17	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	5	116702075	161702075	Rat
8694198	Abfw3	Abdominal fat weight QTL 3	16.13	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	5	116702075	161702075	Rat
1298090	Bp155	Blood pressure QTL 155	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	156289283	171137955	Rat
1298089	Scl14	Serum cholesterol level QTL 14	5.8	0.0004	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	114131300	159131300	Rat
1598819	Bp292	Blood pressure QTL 292	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	133081618	172190305	Rat

Markers in Region

Afar

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	151,560,717 - 151,560,886 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	157,768,277 - 157,768,445	NCBI	Rnor6.0
Rnor_5.0	5	161,508,432 - 161,508,600	UniSTS	Rnor5.0
RGSC_v3.4	5	158,106,021 - 158,106,189	UniSTS	RGSC3.4
Celera	5	149,940,931 - 149,941,099	UniSTS
Cytogenetic Map	5	q36	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	160	91	90	59	92	59	6	356	192	11	139	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_134407	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB037424	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF503514	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AJ271883	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC061816	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473968	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230711	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ231883	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000024063 ⟹ ENSRNOP00000024063

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	5	157,759,416 - 157,768,301 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000083629 ⟹ ENSRNOP00000072789

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	156,835,551 - 156,844,109 (+)	Ensembl
mRatBN7.2 Ensembl	5	151,552,343 - 151,560,909 (+)	Ensembl
Rnor_6.0 Ensembl	5	157,759,448 - 157,768,471 (+)	Ensembl

RefSeq Acc Id:

NM_134407 ⟹ NP_599234

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	156,835,589 - 156,844,127 (+)	NCBI
mRatBN7.2	5	151,552,375 - 151,560,914 (+)	NCBI
Rnor_6.0	5	157,759,448 - 157,768,473 (+)	NCBI
Rnor_5.0	5	161,499,603 - 161,508,628 (+)	NCBI
RGSC_v3.4	5	158,097,679 - 158,106,217 (+)	RGD
Celera	5	149,932,592 - 149,941,127 (+)	RGD

Sequence:

show sequence

CGCTGCTGTACGCTGCGCGTGGCGCTCTGGGCCTTCGGTCGCGCGTCCTCTCGCCATGTCCCGG
TCTCCGGCACCCCGCGCCGTCTCTGGCGCCCCTCTCCGGCCCGGTACGGTGCTGGGCACCATGG
AGATGGGGCGCCGCATGGATGCGAGTGCTAGCGCTGCGACCGTACGCGCCTTCCTGGAGCGCGG
CCTCAACGAGCTGGACACGGCCTTCATGTATTGCGACGGCCAGTCCGAAAGCATCCTGGGCAGC
CTGGGGCTCGGGCTGGGCAGCGGCGACTGCACAGTGAAAATTGCCACCAAGGCCAACCCTTGGG
ACGGGAAGTCGCTGAAGCCTGACAGTGTCCGGTCCCAATTAGAGACGTCATTGAAGCGGCTGCA
GTGTCCCCGGGTGGACCTCTTCTACTTACACGCTCCTGACCACGGCACTCCTATCGTGGAGACC
CTGCAGGCCTGCCAACAGCTGCATCAGGAGGGCAAGTTTGTGGAGCTTGGCTTGTCCAACTATG
CCTCCTGGGAGGTAGCCGAGATCTATACCCTCTGTAAAAGCAACGGCTGGATCCTGCCAACTGT
GTACCAGGGCATGTACAACGCCACCACCCGGCAGGTGGAGACTGAGCTCCTCCCCTGCCTCAGA
TACTTCGGACTGAGGTTCTATGCCTACAACCCTTTGGCTGGAGGCCTGCTGACTGGCAAATACA
GATATGAAGACAAGGATGGGAAACAGCCCGAGGGCCGCTTCTTTGGGAATAGCTGGTCTGAGAC
CTACAGGAACCGCTTCTGGAAGGAACACCACTTTGAGGCCATTGCCCTGGTAGAAAAGGCCCTG
AAGACCACCTATGGCACCAGTGCCCCCAGCATGACCTCGGCTGCCCTGCGCTGGATGTACCATC
ACTCACAGCTCCAGGGCACCCGAGGGGACGCAGTCATCTTGGGCATGTCCAGCCTGGAGCAGCT
GGAGCAGAACTTGGCGGCCACTGAGGAAGGTCCCCTGGAGCCCGCTGTCGTGGAGGCCTTTAAC
CAAGCCTGGAACGTGGTCGCCCACGAGTGTCCCAACTACTTCAGATAGACTGTCGTGACTCAAG
ACGCCAGGGCTTTTCTGCCAACTCTTAGAGTCACACCCTGGCCACTCCTTGCCCAGTGCTGACC
TAGTGTGGTCTTTTCTGCTGGTCTCCATCCACTCCCTGCTCTTTTCCCGTCTGAATAAAGCAGG
CGTCCGACCTAGCTGCAGCCCGGACTGAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_599234	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH61816	(Get FASTA)	NCBI Sequence Viewer
	AAN03824	(Get FASTA)	NCBI Sequence Viewer
	BAA90396	(Get FASTA)	NCBI Sequence Viewer
	CAC81080	(Get FASTA)	NCBI Sequence Viewer
	EDL80914	(Get FASTA)	NCBI Sequence Viewer
	EDL80915	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000072789
GenBank Protein	Q8CG45	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_599234 ⟸ NM_134407

- UniProtKB:

Q9JM82 (UniProtKB/Swiss-Prot), Q8K435 (UniProtKB/Swiss-Prot), Q6P765 (UniProtKB/Swiss-Prot), Q8CG45 (UniProtKB/Swiss-Prot), A0A0G2K3V2 (UniProtKB/TrEMBL), A6ITL3 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSRSPAPRAVSGAPLRPGTVLGTMEMGRRMDASASAATVRAFLERGLNELDTAFMYCDGQSESI
LGSLGLGLGSGDCTVKIATKANPWDGKSLKPDSVRSQLETSLKRLQCPRVDLFYLHAPDHGTPI
VETLQACQQLHQEGKFVELGLSNYASWEVAEIYTLCKSNGWILPTVYQGMYNATTRQVETELLP
CLRYFGLRFYAYNPLAGGLLTGKYRYEDKDGKQPEGRFFGNSWSETYRNRFWKEHHFEAIALVE
KALKTTYGTSAPSMTSAALRWMYHHSQLQGTRGDAVILGMSSLEQLEQNLAATEEGPLEPAVVE
AFNQAWNVVAHECPNYFR

hide sequence

Ensembl Acc Id:

ENSRNOP00000024063 ⟸ ENSRNOT00000024063

Ensembl Acc Id:

ENSRNOP00000072789 ⟸ ENSRNOT00000083629

Protein Domains

NADP-dependent oxidoreductase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q8CG45-F1-model_v2	AlphaFold	Q8CG45	1-367	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13694210

Promoter ID:

EPDNEW_R4728

Type:

initiation region

Name:

Akr7a2_1

Description:

aldo-keto reductase family 7, member A2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	157,759,427 - 157,759,487	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620311	AgrOrtholog
BioCyc Gene	G2FUF-39420	BioCyc
Ensembl Genes	ENSRNOG00000017780	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000083629	ENTREZGENE
Gene3D-CATH	3.20.20.100	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:5598724	IMAGE-MGC_LOAD
InterPro	AKR_Detox_Biosynth	UniProtKB/Swiss-Prot
	NADP_OxRdtase_dom	UniProtKB/Swiss-Prot
	NADP_OxRdtase_dom_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:171445	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72311	IMAGE-MGC_LOAD
NCBI Gene	171445	ENTREZGENE
PANTHER	NAD(P)-LINKED OXIDOREDUCTASE SUPERFAMILY PROTEIN	UniProtKB/Swiss-Prot
	NADH-SPECIFIC METHYLGLYOXAL REDUCTASE-RELATED	UniProtKB/Swiss-Prot
Pfam	Aldo_ket_red	UniProtKB/Swiss-Prot
PhenoGen	Akr7a2	PhenoGen
RatGTEx	ENSRNOG00000017780	RatGTEx
Superfamily-SCOP	SSF51430	UniProtKB/Swiss-Prot
UniProt	A0A0G2K3V2	ENTREZGENE, UniProtKB/TrEMBL
	A6ITL3	ENTREZGENE, UniProtKB/TrEMBL
	A6ITL4_RAT	UniProtKB/TrEMBL
	ARK72_RAT	UniProtKB/Swiss-Prot
	Q6P765	ENTREZGENE
	Q8CG45	ENTREZGENE
	Q8K435	ENTREZGENE
	Q9JM82	ENTREZGENE
UniProt Secondary	Q6P765	UniProtKB/Swiss-Prot
	Q8K435	UniProtKB/Swiss-Prot
	Q9JM82	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-06-10	Akr7a2	aldo-keto reductase family 7, member A2	Akr7a2	aldo-keto reductase family 7, member A2 (aflatoxin aldehyde reductase)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-11-17	Akr7a2	aldo-keto reductase family 7, member A2 (aflatoxin aldehyde reductase)			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Akr7a2	aldo-keto reductase family 7, member A2 (aflatoxin aldehyde reductase)			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_cellular_localization	Golgi-associated	625492
gene_protein	has a low K(m) and high activity towards succinic semialdehyde	625492

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD