Advanced Search (OLGA)

Gene: Mchr1 (melanin-concentrating hormone receptor 1) Rattus norvegicus

Analyze

Symbol:

Mchr1

Name:

melanin-concentrating hormone receptor 1

RGD ID:

619841

Description:

Enables hormone binding activity and melanin-concentrating hormone receptor activity. Involved in cell surface receptor signaling pathway; positive regulation of calcium ion transport; and positive regulation of cytosolic calcium ion concentration. Predicted to be located in ciliary membrane and non-motile cilium. Predicted to be active in neuron projection and plasma membrane. Biomarker of obesity. Human ortholog(s) of this gene implicated in morbid obesity. Orthologous to human MCHR1 (melanin concentrating hormone receptor 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; alpha-Zearalanol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

G protein-coupled receptor 24; G-protein coupled receptor 24; Gpr24; MCH receptor 1; Mch-1r; MCH-R1; MCH1R; MCHR; MCHR-1; SLC-1; Slc1; somatostatin receptor-like protein

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	114,641,721 - 114,644,913 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	114,641,580 - 114,644,919 (+)	Ensembl				GRCr8
mRatBN7.2	7	112,761,554 - 112,764,746 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	112,761,554 - 112,764,032 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	114,524,098 - 114,526,580 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	116,747,649 - 116,750,131 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	116,717,002 - 116,719,482 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	122,456,846 - 122,459,324 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	122,456,799 - 122,459,960 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	7	122,432,538 - 122,435,016 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	119,557,141 - 119,559,619 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	109,080,262 - 109,082,740 (+)	NCBI		Celera
RGSC_v3.1	7	119,591,370 - 119,593,849 (+)	NCBI
Cytogenetic Map	7	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

morbid obesity (ISO)

obesity (IEP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2-tert-butylhydroquinone (ISO)

3,4-methylenedioxymethamphetamine (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

amitrole (EXP)

ammonium chloride (EXP)

belinostat (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbamazepine (ISO)

clothianidin (ISO)

cobalt dichloride (ISO)

dichloroacetic acid (ISO)

dimethylarsinic acid (ISO)

dioxygen (ISO)

doxorubicin (ISO)

epoxiconazole (ISO)

fenvalerate (EXP)

fonofos (ISO)

fulvestrant (ISO)

haloperidol (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

methylarsonic acid (ISO)

N-Nitrosopyrrolidine (ISO)

O-methyleugenol (ISO)

okadaic acid (ISO)

ozone (ISO)

paracetamol (ISO)

parathion (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP,ISO)

pirinixic acid (ISO)

propiconazole (EXP)

pyridazines (ISO)

resveratrol (ISO)

rotenone (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

succimer (ISO)

sulfadimethoxine (EXP)

terbufos (ISO)

titanium dioxide (ISO)

trichostatin A (ISO)

triclosan (ISO)

triptonide (ISO)

troglitazone (ISO)

valproic acid (ISO)

vanadyl sulfate (ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell surface receptor signaling pathway (IMP)

G protein-coupled receptor signaling pathway (IEA)

neuropeptide signaling pathway (IBA,IEA)

positive regulation of calcium ion transport (IMP)

positive regulation of cytosolic calcium ion concentration (IMP)

signal transduction (IEA)

Cellular Component

9+0 non-motile cilium (IEA,ISO)

ciliary membrane (IEA,ISO)

cilium (IEA,ISO)

membrane (IEA)

neuron projection (IBA)

non-motile cilium (IEA,ISO)

plasma membrane (IBA,IEA,ISO,ISS)

Molecular Function

G protein-coupled receptor activity (IBA,IEA)

hormone binding (IDA)

melanin-concentrating hormone receptor activity (IDA,IEA)

neuropeptide binding (IBA)

protein binding (IPI,ISO)

signaling receptor binding (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	MIZIP, a highly conserved, vertebrate specific melanin-concentrating hormone receptor 1 interacting zinc-finger protein.	Bachner D, etal., FEBS Lett 2002 Aug 28;526(1-3):124-8.
2.	Association of melanin-concentrating hormone receptor 1 5' polymorphism with early-onset extreme obesity.	Bell CG, etal., Diabetes. 2005 Oct;54(10):3049-55.
3.	Increases in melanin-concentrating hormone and MCH receptor levels in the hypothalamus of dietary-obese rats.	Elliott JC, etal., Brain Res Mol Brain Res. 2004 Sep 28;128(2):150-9.
4.	Interaction of neurochondrin with the melanin-concentrating hormone receptor 1 interferes with G protein-coupled signal transduction but not agonist-mediated internalization.	Francke F, etal., J Biol Chem. 2006 Oct 27;281(43):32496-507. Epub 2006 Aug 31.
5.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
7.	Cloning of the rat brain cDNA encoding for the SLC-1 G protein-coupled receptor reveals the presence of an intron in the gene.	Lakaye B, etal., Biochim Biophys Acta 1998 Feb 4;1401(2):216-20.
8.	The receptor for the orexigenic peptide melanin-concentrating hormone is a G-protein-coupled receptor.	Lembo PM, etal., Nat Cell Biol. 1999 Sep;1(5):267-71.
9.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
10.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
11.	Online Mendelian Inheritance in Man, OMIM (TM).	Online Mendelian Inheritance in Man, OMIM (TM).
12.	GOA pipeline	RGD automated data pipeline
13.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
14.	Functional role of N-linked glycosylation on the rat melanin-concentrating hormone receptor 1.	Saito Y, etal., FEBS Lett 2003 Jan 2;533(1-3):29-34.
15.	The basic residues in the membrane-proximal C-terminal tail of the rat melanin-concentrating hormone receptor 1 are required for receptor function.	Tetsuka M, etal., Endocrinology. 2004 Aug;145(8):3712-23. Epub 2004 Apr 29.

Additional References at PubMed

PMID:8977118	PMID:10421368	PMID:12620396	PMID:15476926	PMID:15590649	PMID:15845622	PMID:15950311	PMID:16359819	PMID:18062961	PMID:18334641	PMID:18760349	PMID:18849359
PMID:19428776	PMID:21925200	PMID:21946196	PMID:22139371	PMID:22209364	PMID:23029470	PMID:23351594	PMID:25617691	PMID:26456505	PMID:27579857	PMID:28154160	PMID:32530066
PMID:33197527	PMID:36565982

Genomics

Comparative Map Data

Mchr1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	114,641,721 - 114,644,913 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	114,641,580 - 114,644,919 (+)	Ensembl				GRCr8
mRatBN7.2	7	112,761,554 - 112,764,746 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	112,761,554 - 112,764,032 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	114,524,098 - 114,526,580 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	116,747,649 - 116,750,131 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	116,717,002 - 116,719,482 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	122,456,846 - 122,459,324 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	122,456,799 - 122,459,960 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	7	122,432,538 - 122,435,016 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	119,557,141 - 119,559,619 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	109,080,262 - 109,082,740 (+)	NCBI		Celera
RGSC_v3.1	7	119,591,370 - 119,593,849 (+)	NCBI
Cytogenetic Map	7	q34	NCBI

MCHR1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	22	40,679,484 - 40,682,812 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	22	40,679,273 - 40,682,812 (+)	Ensembl			hg38	GRCh38
GRCh37	22	41,075,488 - 41,078,816 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	22	39,405,128 - 39,408,764 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	22	39,399,736 - 39,403,318	NCBI
Celera	22	24,878,864 - 24,882,500 (+)	NCBI		Celera
Cytogenetic Map	22	q13.2	NCBI
HuRef	22	24,037,016 - 24,040,650 (+)	NCBI		HuRef
CHM1_1	22	41,035,201 - 41,038,835 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	22	41,151,449 - 41,154,777 (+)	NCBI		T2T-CHM13v2.0

Mchr1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	81,119,700 - 81,123,165 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	81,119,700 - 81,123,165 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	15	81,235,499 - 81,238,964 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	81,235,499 - 81,238,964 (+)	Ensembl			mm10	GRCm38
MGSCv37	15	81,065,929 - 81,069,394 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	15	81,063,029 - 81,065,367 (+)	NCBI		MGSCv36	mm8
Celera	15	83,352,799 - 83,356,252 (+)	NCBI		Celera
Cytogenetic Map	15	E1	NCBI
cM Map	15	38.02	NCBI

Mchr1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955413	26,343,759 - 26,347,520 (+)	Ensembl
ChiLan1.0	NW_004955413	26,343,771 - 26,347,374 (+)	NCBI	ChiLan1.0	ChiLan1.0

MCHR1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	23	50,512,835 - 50,516,718 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	22	53,212,725 - 53,216,607 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	22	21,577,190 - 21,581,062 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	22	39,673,698 - 39,677,517 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	22	39,673,698 - 39,677,517 (+)	Ensembl			panPan2	panpan1.1

MCHR1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	10	24,526,687 - 24,560,948 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	10	24,526,693 - 24,559,836 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	10	24,462,281 - 24,464,655 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	10	25,276,788 - 25,311,181 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	10	25,276,794 - 25,280,056 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	10	24,990,613 - 24,992,985 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	10	25,312,293 - 25,314,664 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	10	25,486,758 - 25,489,135 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Mchr1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	8,143,469 - 8,147,147 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936492	1,153,651 - 1,157,142 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936492	1,153,895 - 1,156,980 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MCHR1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	7,735,825 - 7,738,701 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	5	7,735,752 - 7,752,006 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	4,916,103 - 4,918,861 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MCHR1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	19	23,240,509 - 23,245,553 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	19	23,241,487 - 23,243,950 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666045	102,341,335 - 102,346,097 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Mchr1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624752	7,801,948 - 7,805,635 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624752	7,801,867 - 7,805,791 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Mchr1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	1	250,985,623 - 250,989,198 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Mchr1
9 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	78
Count of miRNA genes:	65
Interacting mature miRNAs:	67
Transcripts:	ENSRNOT00000025564
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300179	Kidm5	Kidney mass QTL 5	3.51		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	92388565	119280177	Rat
1331728	Bp214	Blood pressure QTL 214	2.825		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	82111245	123048330	Rat
1331731	Bp216	Blood pressure QTL 216	2.851		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	104186212	135371468	Rat
1357338	Stl17	Serum triglyceride level QTL 17	3.23		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	7	71621154	114982716	Rat
70159	Bp61	Blood pressure QTL 61		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	73618702	118618702	Rat
631687	Hcas1	Hepatocarcinoma susceptibility QTL 1	3.9	0.001	liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	7	93302009	131686183	Rat
61397	Bw17	Body weight QTL 17	6.3		body mass (VT:0001259)	body weight (CMO:0000012)	7	95485047	137014596	Rat
631504	Cm27	Cardiac mass QTL 27	3.45		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	7	46307490	127866166	Rat
634322	Bw12	Body weight QTL 12	0		body mass (VT:0001259)	body weight (CMO:0000012)	7	85043242	130043242	Rat
70173	Niddm19	Non-insulin dependent diabetes mellitus QTL 19	4.33	0.00005	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	85497398	130497398	Rat
1549899	Stresp8	Stress response QTL 8	4.37	0.0008	stress-related behavior trait (VT:0010451)	defensive burying duration (CMO:0001961)	7	92362341	137014596	Rat
2317052	Aia17	Adjuvant induced arthritis QTL 17	2.13		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	7	83626689	128626689	Rat
631529	Tls2	T-lymphoma susceptibility QTL 2	0	0.001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	7	82111382	132099989	Rat
731176	Glom5	Glomerulus QTL 5	2.5	0.0035	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	7	98549867	137014596	Rat
7411607	Foco15	Food consumption QTL 15		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	77807807	122807807	Rat
631201	Panci1	Pancreas inflammation QTL 1	0	0.001	pancreas integrity trait (VT:0010560)	percentage of study population displaying chronic pancreatitis at a point in time (CMO:0001214)	7	73557047	118557047	Rat
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	1509236	116977875	Rat
1331768	Kidm10	Kidney mass QTL 10	4.62096		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	82111245	123048330	Rat
61357	Bp38	Blood pressure QTL 38	1.6	0.052	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	40540077	123682549	Rat
2313102	Bmd79	Bone mineral density QTL 79	2.3	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	7	96700404	118618702	Rat
2316947	Rf58	Renal function QTL 58	7.8		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	7	49682832	115766396	Rat
1331748	Bp215	Blood pressure QTL 215	4.043		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	110725024	135371468	Rat
10450862	Kidm55	Kidney mass QTL 55	4.9		kidney mass (VT:0002707)	kidney weight (CMO:0000081)	7	72725037	117725037	Rat
61428	Scl3	Serum cholesterol level QTL 3	3.2		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	7	100548246	137014596	Rat
1331746	Kidm9	Kidney mass QTL 9	3.934		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	7	82111245	134948181	Rat
10450856	Livw4	Liver weight QTL 4	3.8		liver mass (VT:0003402)	liver weight (CMO:0000092)	7	72725037	117725037	Rat
7411654	Foco25	Food consumption QTL 25	9.3	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	77807807	122807807	Rat
2316955	Stl24	Serum triglyceride level QTL 24	7.1		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	7	49682832	115766396	Rat
10402855	Bp379	Blood pressure QTL 379		0.21	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	78682549	123682549	Rat
2316952	Pur22	Proteinuria QTL 22	5.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	7	49682832	115766396	Rat
631540	Bw9	Body weight QTL 9	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	7	71621154	119349044	Rat
1358891	Bp265	Blood pressure QTL 265	2.21		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	71827901	136544683	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
15	12	31	140	59	56	31	14	31	6	193	78	11	111	61	82	25	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031758	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039079955	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF008650	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473950	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U77953	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000025564 ⟹ ENSRNOP00000025564

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	7	114,641,580 - 114,644,919 (+)	Ensembl
mRatBN7.2 Ensembl	7	112,761,554 - 112,764,032 (+)	Ensembl
Rnor_6.0 Ensembl	7	122,456,799 - 122,459,960 (+)	Ensembl

RefSeq Acc Id:

NM_031758 ⟹ NP_113946

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	114,641,721 - 114,644,199 (+)	NCBI
mRatBN7.2	7	112,761,554 - 112,764,032 (+)	NCBI
Rnor_6.0	7	122,456,846 - 122,459,324 (+)	NCBI
Rnor_5.0	7	122,432,538 - 122,435,016 (+)	NCBI
RGSC_v3.4	7	119,557,141 - 119,559,619 (+)	RGD
Celera	7	109,080,262 - 109,082,740 (+)	RGD

Sequence:

show sequence

GCAGGCGACCTGCACCGGCTGCATGGATCTGCAAACCTCGTTGCTGTCCACTGGCCCCAATGCC
AGCAACATCTCCGATGGCCAGGATAATCTCACATTGCCGGGGTCACCTCCTCGCACAGGGAGTG
TCTCCTACATCAACATCATTATGCCTTCCGTGTTTGGTACCATCTGTCTCCTGGGCATCGTGGG
AAACTCCACGGTCATCTTTGCTGTGGTGAAGAAGTCCAAGCTACACTGGTGCAGCAACGTCCCC
GACATCTTCATCATCAACCTCTCTGTGGTGGATCTGCTCTTCCTGCTGGGCATGCCTTTCATGA
TCCACCAGCTCATGGGGAACGGCGTCTGGCACTTTGGGGAAACCATGTGCACCCTCATCACAGC
CATGGACGCCAACAGTCAGTTCACTAGCACCTACATCCTGACTGCCATGACCATTGACCGCTAC
TTGGCCACCGTCCACCCCATCTCCTCCACCAAGTTCCGGAAGCCCTCCATGGCCACCCTGGTGA
TCTGCCTCCTGTGGGCGCTCTCCTTCATCAGTATCACCCCTGTGTGGCTCTACGCCAGGCTCAT
TCCCTTCCCAGGGGGTGCTGTGGGCTGTGGCATCCGCCTGCCAAACCCGGACACTGACCTCTAC
TGGTTCACTCTGTACCAGTTTTTCCTGGCCTTTGCCCTTCCGTTTGTGGTCATTACCGCCGCAT
ACGTGAAAATACTACAGCGCATGACGTCTTCGGTGGCCCCAGCCTCCCAACGCAGCATCCGGCT
TCGGACAAAGAGGGTGACCCGCACGGCCATTGCCATCTGTCTGGTCTTCTTTGTGTGCTGGGCA
CCCTACTATGTGCTGCAGCTGACCCAGCTGTCCATCAGCCGCCCGACCCTCACGTTTGTCTACT
TGTACAACGCGGCCATCAGCTTGGGCTATGCTAACAGCTGCCTGAACCCCTTTGTGTACATAGT
GCTCTGTGAGACCTTTCGAAAACGCTTGGTGTTGTCAGTGAAGCCTGCAGCCCAGGGGCAGCTC
CGCACGGTCAGCAACGCTCAGACAGCTGATGAGGAGAGGACAGAAAGCAAAGGCACCTGACAAT
TCCCCAGTCGCCTCCAAGTCAGGCCACCCCATCAAACCGTGGGGAGAGATACTGAGATTAAACC
CAAGGCTACCCTGGGAGAATGCAGAGGCTGGAGGCTGGGGGCTTGTAGCAACCACATTCCAC

hide sequence

RefSeq Acc Id:

XM_039079955 ⟹ XP_038935883

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	114,641,829 - 114,644,913 (+)	NCBI
mRatBN7.2	7	112,761,712 - 112,764,746 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_113946	(Get FASTA)	NCBI Sequence Viewer
	XP_038935883	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAC14588	(Get FASTA)	NCBI Sequence Viewer
	AAC27977	(Get FASTA)	NCBI Sequence Viewer
	EDM15736	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000025564
	ENSRNOP00000025564.4
GenBank Protein	P97639	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_113946 ⟸ NM_031758

- UniProtKB:

A0A140TAD3 (UniProtKB/Swiss-Prot), P97639 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MDLQTSLLSTGPNASNISDGQDNLTLPGSPPRTGSVSYINIIMPSVFGTICLLGIVGNSTVIFA
VVKKSKLHWCSNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQF
TSTYILTAMTIDRYLATVHPISSTKFRKPSMATLVICLLWALSFISITPVWLYARLIPFPGGAV
GCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVKILQRMTSSVAPASQRSIRLRTKRVTR
TAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRK
RLVLSVKPAAQGQLRTVSNAQTADEERTESKGT

hide sequence

Ensembl Acc Id:

ENSRNOP00000025564 ⟸ ENSRNOT00000025564

RefSeq Acc Id:	XP_038935883 ⟸ XM_039079955
- Peptide Label:	isoform X1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P97639-F1-model_v2	AlphaFold	P97639	1-353	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:619841	AgrOrtholog
BioCyc Gene	G2FUF-32685	BioCyc
Ensembl Genes	ENSRNOG00000018895	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000025564	ENTREZGENE
	ENSRNOT00000025564.7	UniProtKB/Swiss-Prot
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot
InterPro	GPCR_Rhodpsn	UniProtKB/Swiss-Prot
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot
	MCH1_rcpt	UniProtKB/Swiss-Prot
	MCH_rcpt	UniProtKB/Swiss-Prot
KEGG Report	rno:83567	UniProtKB/Swiss-Prot
NCBI Gene	83567	ENTREZGENE
PANTHER	NEUROPEPTIDES RECEPTOR	UniProtKB/Swiss-Prot
	PTHR24229:SF91	UniProtKB/Swiss-Prot
Pfam	7tm_1	UniProtKB/Swiss-Prot
PhenoGen	Mchr1	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/Swiss-Prot
	MCH1RECEPTOR	UniProtKB/Swiss-Prot
	MCHRECEPTOR	UniProtKB/Swiss-Prot
PROSITE	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000018895	RatGTEx
SMART	7TM_GPCR_Srsx	UniProtKB/Swiss-Prot
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot
UniProt	A0A140TAD3	ENTREZGENE
	MCHR1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
UniProt Secondary	A0A140TAD3	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2006-03-30	Mchr1	melanin-concentrating hormone receptor 1	Gpr24	G protein-coupled receptor 24	Symbol and Name updated	1299863	APPROVED
2004-12-14	Gpr24	G protein-coupled receptor 24		somatostatin receptor-like protein	Name updated	1299863	APPROVED
2002-08-07	Gpr24	somatostatin receptor-like protein			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_pathway	involves in the Ca2+, cAMP and MAP kinases signaling pathways	628540
gene_protein	all three N-linked glycosylation sites are glycosylated in vivo	628540
gene_regulation	N-glycosylation at Asn23 is important for cell surface expression, ligand binding and signal transduction	628540

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message