Advanced Search (OLGA)

Gene: Vamp1 (vesicle-associated membrane protein 1) Rattus norvegicus

Analyze

Symbol:

Vamp1

Name:

vesicle-associated membrane protein 1

RGD ID:

3948

Description:

Predicted to enable SNAP receptor activity and syntaxin binding activity. Predicted to be involved in SNARE complex assembly; regulation of synaptic vesicle fusion to presynaptic active zone membrane; and synaptic vesicle priming. Located in terminal bouton. Is active in presynapse. Human ortholog(s) of this gene implicated in congenital myasthenic syndrome and spastic ataxia 1. Orthologous to human VAMP1 (vesicle associated membrane protein 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2-amino-2-deoxy-D-glucopyranose; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Syb1; synaptobrevin 1; synaptobrevin-1; VAMP-1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	VAMP1 (vesicle associated membrane protein 1)	HGNC	Ensembl, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Vamp1 (vesicle-associated membrane protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Vamp1 (vesicle associated membrane protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	VAMP1 (vesicle associated membrane protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	VAMP1 (vesicle associated membrane protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Vamp1 (vesicle associated membrane protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	VAMP1 (vesicle associated membrane protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	VAMP1 (vesicle associated membrane protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Vamp1 (vesicle associated membrane protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Vamp1 (vesicle associated membrane protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	VAMP2 (vesicle associated membrane protein 2)	HGNC	OrthoDB
Homo sapiens (human):	VAMP3 (vesicle associated membrane protein 3)	HGNC	OrthoDB
Homo sapiens (human):	DCAF15 (DDB1 and CUL4 associated factor 15)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	VAMP1 (vesicle associated membrane protein 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Vamp1 (vesicle-associated membrane protein 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	zgc:92912	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	zgc:92912	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	vamp1 (vesicle-associated membrane protein 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	vamp1 (vesicle-associated membrane protein 1)	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	snb-1	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	snb-1	Alliance	DIOPT (InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	SNC1	Alliance	DIOPT (InParanoid\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	SNC1	Alliance	DIOPT (InParanoid\|OrthoInspector\|PANTHER)
Saccharomyces cerevisiae (baker's yeast):	SNC2	Alliance	DIOPT (InParanoid\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	SNC2	Alliance	DIOPT (InParanoid\|OrthoInspector\|PANTHER)
Drosophila melanogaster (fruit fly):	Syb	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER)
Drosophila melanogaster (fruit fly):	Syb	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoInspector\|PANTHER)
Drosophila melanogaster (fruit fly):	nSyb	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	snb-2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	snb-2	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	vamp1	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	vamp1	Alliance	DIOPT (InParanoid\|OrthoFinder\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	159,698,894 - 159,705,582 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	159,698,629 - 159,713,608 (+)	Ensembl				GRCr8
mRatBN7.2	4	158,012,634 - 158,019,350 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	158,012,663 - 158,019,349 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	164,241,975 - 164,248,577 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	160,024,891 - 160,031,493 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	158,660,913 - 158,667,515 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	157,726,941 - 157,733,644 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	157,726,941 - 157,733,643 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	224,743,851 - 224,750,440 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	161,333,661 - 161,340,447 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	146,749,782 - 146,756,446 (+)	NCBI		Celera
RGSC_v3.1	4	161,578,698 - 161,583,642 (+)	NCBI
RH 3.4 Map	4	1003.9	RGD
Cytogenetic Map	4	q42	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Congenital Myasthenic Syndrome 25 (ISO)

paraplegia (ISO)

spastic ataxia 1 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(2,4,5-trichlorophenoxy)acetic acid (ISO)

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

1,2-dichloroethane (ISO)

17beta-estradiol (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,4'-trichlorobiphenyl (ISO)

2-amino-2-deoxy-D-glucopyranose (EXP)

2-methylcholine (ISO)

3,4-methylenedioxymethamphetamine (ISO)

6-propyl-2-thiouracil (EXP)

acetylsalicylic acid (ISO)

aflatoxin B1 (EXP,ISO)

aldehydo-D-glucosamine (EXP)

aldrin (ISO)

all-trans-retinoic acid (ISO)

amitrole (EXP)

ammonium chloride (EXP)

amphetamine (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

beta-D-glucosamine (EXP)

bis(2-chloroethyl) sulfide (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

chloroethene (ISO)

choline (ISO)

cisplatin (ISO)

clozapine (EXP)

copper(II) sulfate (ISO)

coumarin (ISO)

Cuprizon (EXP)

dexamethasone (EXP)

diarsenic trioxide (ISO)

dorsomorphin (ISO)

ethanol (EXP,ISO)

fenvalerate (EXP)

folic acid (ISO)

formaldehyde (ISO)

gamma-tocopherol (ISO)

gentamycin (EXP)

haloperidol (EXP)

L-methionine (ISO)

lead diacetate (EXP,ISO)

leflunomide (ISO)

lipopolysaccharide (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

MeIQx (ISO)

methimazole (EXP)

methylisothiazolinone (ISO)

nickel sulfate (ISO)

okadaic acid (ISO)

paracetamol (EXP,ISO)

PCB138 (ISO)

phenylmercury acetate (ISO)

pregnenolone 16alpha-carbonitrile (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

tert-butyl hydroperoxide (ISO)

titanium dioxide (ISO)

tocopherol (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

urethane (ISO)

valproic acid (ISO)

venlafaxine hydrochloride (EXP)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

intracellular protein transport (TAS)

regulation of synaptic vesicle fusion to presynaptic active zone membrane (ISO)

SNARE complex assembly (IBA,ISO)

synaptic vesicle priming (ISO)

vesicle fusion (IBA)

vesicle-mediated transport (IEA,TAS)

Cellular Component

azurophil granule membrane (ISO)

cell surface (ISO)

cytoplasmic vesicle (IEA)

cytoplasmic vesicle membrane (IEA)

cytosol (ISO)

endomembrane system (IEA)

glutamatergic synapse (ISO)

membrane (IEA)

mitochondrial outer membrane (IEA)

neuromuscular junction (ISO)

neuron projection (IEA)

plasma membrane (IBA)

presynapse (EXP,IDA,IEP)

SNARE complex (IBA)

specific granule membrane (ISO)

synapse (IEA)

synaptic vesicle membrane (IEA)

terminal bouton (HDA)

tertiary granule membrane (ISO)

Molecular Function

protein binding (IPI,ISO)

SNAP receptor activity (IBA)

syntaxin binding (IBA)

References

References - curated

#	Reference Title	Reference Citation
1.	The specificity of SNARE pairing in biological membranes is mediated by both proof-reading and spatial segregation.	Bethani I, etal., EMBO J. 2007 Sep 5;26(17):3981-92. Epub 2007 Aug 23.
2.	Changes in mRNA for VAMPs following facial nerve transection.	Che YH, etal., J Chem Neuroanat 2002 Jul;24(2):147-52.
3.	Expression of two membrane fusion proteins, synaptosome-associated protein of 25 kDa and vesicle-associated membrane protein, in choroid plexus epithelium.	Chung I, etal., Neuroscience 2003;116(2):349-57.
4.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
6.	High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.	Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
7.	Tissue-specific alternative RNA splicing of rat vesicle-associated membrane protein-1 (VAMP-1).	Mandic R, etal., Gene 1997 Oct 15;199(1-2):173-9.
8.	Isolation and characterization of a dual prenylated Rab and VAMP2 receptor.	Martincic I, etal., J Biol Chem 1997 Oct 24;272(43):26991-8.
9.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
10.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
11.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
12.	GOA pipeline	RGD automated data pipeline
13.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
14.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
15.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
16.	VAMP-1: a synaptic vesicle-associated integral membrane protein.	Trimble WS, etal., Proc Natl Acad Sci U S A. 1988 Jun;85(12):4538-42.
17.	Composition of isolated synaptic boutons reveals the amounts of vesicle trafficking proteins.	Wilhelm BG, etal., Science. 2014 May 30;344(6187):1023-8. doi: 10.1126/science.1252884.

Additional References at PubMed

PMID:1299100	PMID:2472388	PMID:8889548	PMID:11391393	PMID:12477932	PMID:16169186	PMID:16539689	PMID:17360966	PMID:17666428	PMID:18655825	PMID:20085749	PMID:20406821
PMID:20801128	PMID:21330375	PMID:22871113	PMID:23699527	PMID:24534378	PMID:24604356	PMID:25010769	PMID:26888187	PMID:27791016	PMID:28314111	PMID:28477408	PMID:29476059
PMID:31962145

Genomics

Comparative Map Data

Vamp1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	159,698,894 - 159,705,582 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	159,698,629 - 159,713,608 (+)	Ensembl				GRCr8
mRatBN7.2	4	158,012,634 - 158,019,350 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	158,012,663 - 158,019,349 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	164,241,975 - 164,248,577 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	160,024,891 - 160,031,493 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	158,660,913 - 158,667,515 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	157,726,941 - 157,733,644 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	157,726,941 - 157,733,643 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	224,743,851 - 224,750,440 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	161,333,661 - 161,340,447 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	146,749,782 - 146,756,446 (+)	NCBI		Celera
RGSC_v3.1	4	161,578,698 - 161,583,642 (+)	NCBI
RH 3.4 Map	4	1003.9	RGD
Cytogenetic Map	4	q42	NCBI

VAMP1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	6,462,237 - 6,470,677 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	6,462,237 - 6,470,677 (-)	Ensembl			hg38	GRCh38
GRCh37	12	6,571,403 - 6,579,843 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	6,441,664 - 6,450,104 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	12	6,441,666 - 6,450,104	NCBI
Celera	12	8,188,292 - 8,196,732 (-)	NCBI		Celera
Cytogenetic Map	12	p13.31	NCBI
HuRef	12	6,425,592 - 6,434,004 (-)	NCBI		HuRef
CHM1_1	12	6,570,277 - 6,578,717 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	12	6,472,621 - 6,481,015 (-)	NCBI		T2T-CHM13v2.0

Vamp1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	125,192,544 - 125,199,269 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	125,192,514 - 125,222,927 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	6	125,215,581 - 125,222,306 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	125,215,551 - 125,245,964 (+)	Ensembl			mm10	GRCm38
MGSCv37	6	125,165,599 - 125,172,324 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	6	125,181,200 - 125,187,922 (+)	NCBI		MGSCv36	mm8
Celera	6	126,885,383 - 126,892,110 (+)	NCBI		Celera
Cytogenetic Map	6	F3	NCBI
cM Map	6	59.32	NCBI

Vamp1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955413	4,117,367 - 4,124,149 (-)	Ensembl
ChiLan1.0	NW_004955413	4,117,367 - 4,124,149 (-)	NCBI	ChiLan1.0	ChiLan1.0

VAMP1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	12,023,662 - 12,032,366 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	12,020,416 - 12,029,162 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	6,592,688 - 6,601,317 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	6,486,475 - 6,518,459 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	6,509,762 - 6,518,459 (-)	Ensembl			panPan2	panpan1.1

VAMP1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	27	38,518,978 - 38,526,361 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	27	38,518,974 - 38,559,455 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	27	8,090,305 - 8,097,691 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	27	38,872,706 - 38,880,082 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	27	38,872,951 - 38,880,078 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	27	38,745,477 - 38,752,859 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	27	38,786,894 - 38,794,280 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	27	7,569,199 - 7,576,586 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Vamp1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	102,630,494 - 102,637,244 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936709	1,297,743 - 1,304,899 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936709	1,297,820 - 1,304,793 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

VAMP1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	5	64,181,496 - 64,188,275 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	66,643,057 - 66,649,800 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

VAMP1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	6,510,717 - 6,520,429 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666063	1,711,975 - 1,721,326 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Vamp1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624860	3,213,474 - 3,219,359 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624860	3,212,549 - 3,219,354 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Vamp1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	6	22,682,886 - 22,689,680 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Vamp1
18 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	312
Count of miRNA genes:	187
Interacting mature miRNAs:	241
Transcripts:	ENSRNOT00000025081, ENSRNOT00000026012
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
6478754	Anxrr43	Anxiety related response QTL 43		0.14035	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	146370897	184426481	Rat
724558	Plsm2	Polydactyly-luxate syndrome (PLS) morphotypes QTL 2		0.0003	hindlimb integrity trait (VT:0010563)	hind foot phalanges count (CMO:0001949)	4	134095016	179095016	Rat
1582237	Kidm34	Kidney mass QTL 34	4	0.0001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	4	149763204	169799698	Rat
6478693	Anxrr32	Anxiety related response QTL 32		0.00092	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	4	146370897	184426481	Rat
6478757	Anxrr44	Anxiety related response QTL 44		0.01087	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
1358364	Sradr4	Stress Responsive Adrenal Weight QTL 4	4.92		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	4	131384565	176384565	Rat
10755501	Bp390	Blood pressure QTL 390	2.5		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	4	27730518	170099664	Rat
61451	Ciaa4	CIA Autoantibody QTL 4	3.1		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	4	123870974	168870974	Rat
1331802	Srn5	Serum renin concentration QTL 5	3.045		renin activity (VT:0005581)	plasma renin activity level (CMO:0000116)	4	117559384	162559384	Rat
1331738	Bp209	Blood pressure QTL 209	2.979		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	140059299	181024663	Rat
6478700	Anxrr33	Anxiety related response QTL 33		0.00896	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	146370897	184426481	Rat
1298524	Oia8	Oil induced arthritis QTL 8			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	140059299	184426481	Rat
10053718	Scort25	Serum corticosterone level QTL 25	2.15	0.0097	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	157292416	184426481	Rat
738009	Sach4	Saccharine consumption QTL 4	4.9	0.000016	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	60916264	184426481	Rat
634335	Anxrr16	Anxiety related response QTL 16	7.22		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	94638356	168870820	Rat
737821	Hcar9	Hepatocarcinoma resistance QTL 9	3.7		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	4	106848959	168870974	Rat
7411558	Bw133	Body weight QTL 133	13.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	127263297	172263297	Rat
6478778	Anxrr51	Anxiety related response QTL 51		0.25384	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	4	126334185	171334185	Rat
10401796	Kidm48	Kidney mass QTL 48			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	4	147299608	184426481	Rat
6478718	Anxrr34	Anxiety related response QTL 34		0.00896	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	146370897	184426481	Rat
6478782	Anxrr52	Anxiety related response QTL 52		0.02091	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
631511	Pia7	Pristane induced arthritis QTL 7	4.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	123870974	168870974	Rat
634347	Hcar8	Hepatocarcinoma resistance QTL 8	5.8		liver integrity trait (VT:0010547)	liver tumorous lesion area to total liver area ratio (CMO:0001075)	4	124700988	169700988	Rat
6478720	Alc23	Alcohol consumption QTL 23		0.00509	drinking behavior trait (VT:0001422)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	155834926	184426481	Rat
6478785	Anxrr53	Anxiety related response QTL 53		0.01397	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
738031	Alc14	Alcohol consumption QTL 14	7.6	0.00003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	60916264	174095838	Rat
1576316	Ept5	Estrogen-induced pituitary tumorigenesis QTL 5	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	4	100752691	179366077	Rat
1581566	Eae21	Experimental allergic encephalomyelitis QTL 21	6.2		body mass (VT:0001259)	maximum body weight loss to initial body weight ratio (CMO:0001400)	4	137447185	182447185	Rat
1578674	Bmd12	Bone mineral density QTL 12	3.8		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	4	137430611	182430611	Rat
6478728	Anxrr36	Anxiety related response QTL 36		0.01061	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
738016	Alc16	Alcohol consumption QTL 16	3.6	0.00015	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	60916264	184426481	Rat
1358202	Gluco11	Glucose level QTL 11	2.4	0.02	adipocyte glucose uptake trait (VT:0004185)	absolute change in adipocyte glucose uptake (CMO:0000873)	4	86709649	168870974	Rat
61422	Cia13	Collagen induced arthritis QTL 13	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	134199006	168870974	Rat
634342	Cia24	Collagen induced arthritis QTL 24	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	148121375	176967367	Rat
6478733	Anxrr37	Anxiety related response QTL 37		0.00095	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
737978	Pia23	Pristane induced arthritis QTL 23	5.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	123870974	168870974	Rat
61362	Oia2	Oil induced arthritis QTL 2		0.001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	140059299	184426481	Rat
6478737	Anxrr38	Anxiety related response QTL 38		0.00159	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
12798519	Anxrr54	Anxiety related response QTL 54	2.54	0.05	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	116184844	161184844	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	12212457	182430611	Rat
6478748	Anxrr42	Anxiety related response QTL 42		0.28008	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	146370897	184426481	Rat
12798525	Anxrr57	Anxiety related response QTL 57	3.21	0.05	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	148834094	168870974	Rat

Markers in Region

BE292615

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	158,019,003 - 158,019,116 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	157,733,298 - 157,733,410	NCBI	Rnor6.0
Rnor_5.0	4	224,750,094 - 224,750,206	UniSTS	Rnor5.0
RGSC_v3.4	4	161,340,101 - 161,340,213	UniSTS	RGSC3.4
Celera	4	146,756,100 - 146,756,212	UniSTS
Cytogenetic Map	4	q42	UniSTS

Vamp1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	158,019,065 - 158,019,291 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	157,733,360 - 157,733,585	NCBI	Rnor6.0
Rnor_5.0	4	224,750,156 - 224,750,381	UniSTS	Rnor5.0
RGSC_v3.4	4	161,340,163 - 161,340,388	UniSTS	RGSC3.4
Celera	4	146,756,162 - 146,756,387	UniSTS
Cytogenetic Map	4	q42	UniSTS

RH94634

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	158,017,434 - 158,017,594 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	157,731,723 - 157,731,882	NCBI	Rnor6.0
Rnor_5.0	4	224,748,519 - 224,748,678	UniSTS	Rnor5.0
RGSC_v3.4	4	161,338,526 - 161,338,685	UniSTS	RGSC3.4
Celera	4	146,754,525 - 146,754,684	UniSTS
RH 3.4 Map	4	1003.9	UniSTS
Cytogenetic Map	4	q42	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	163	91	90	59	92	59	6	356	192	11	142	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_013090	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF498262	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AI059682	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC092206	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB582258	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473964	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CO567426	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EF653274	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EF653275	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M24104	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U74621	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000025081 ⟹ ENSRNOP00000025081

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	159,698,629 - 159,705,713 (+)	Ensembl
mRatBN7.2 Ensembl	4	158,012,663 - 158,019,349 (+)	Ensembl
Rnor_6.0 Ensembl	4	157,726,941 - 157,733,643 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000096098 ⟹ ENSRNOP00000076937

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	159,698,969 - 159,705,553 (+)	Ensembl
mRatBN7.2 Ensembl	4	158,012,738 - 158,019,321 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000097145 ⟹ ENSRNOP00000080681

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	159,701,862 - 159,703,847 (+)	Ensembl
mRatBN7.2 Ensembl	4	158,015,629 - 158,017,615 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000123906 ⟹ ENSRNOP00000102084

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	159,698,629 - 159,713,608 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000148495 ⟹ ENSRNOP00000107773

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	159,698,969 - 159,705,702 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000172434 ⟹ ENSRNOP00000111993

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	159,698,629 - 159,704,615 (+)	Ensembl

RefSeq Acc Id:

NM_013090 ⟹ NP_037222

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	159,698,894 - 159,705,582 (+)	NCBI
mRatBN7.2	4	158,012,663 - 158,019,350 (+)	NCBI
Rnor_6.0	4	157,726,941 - 157,733,644 (+)	NCBI
Rnor_5.0	4	224,743,851 - 224,750,440 (+)	NCBI
RGSC_v3.4	4	161,333,661 - 161,340,447 (+)	RGD
Celera	4	146,749,782 - 146,756,446 (+)	RGD

Sequence:

show sequence

CCGCAGTTAGAGTTCCGGGTGGCTCGCGTGAGGCGGAGCTCGGCAGTTCCGTCTACTTCAGCCG
CAGCGTCTCCCTGCCTGTCTCATTGCATTCTCTAGAGAGGGGACGGACCTCCACTTCCTCTTTC
AGAAAAATGTCTGCTCCAGCTCAGCCACCTGCTGAAGGGACAGAAGGGGCTGCCCCAGGTGGGG
GTCCTCCTGGTCCTCCTCCCAATACGACCAGTAACAGACGATTACAGCAAACCCAGGCACAAGT
GGAGGAGGTGGTGGACATCATGCGCGTGAATGTGGACAAGGTCTTGGAGAGGGACCAGAAGTTG
TCAGAGTTGGATGACCGAGCTGACGCCTTGCAGGCAGGAGCGTCAGTGTTTGAGAGCAGTGCTG
CCAAGCTAAAAAGGAAGTATTGGTGGAAAAACTGCAAGATGATGATCATGCTGGGAGCTATCTG
TGCCATCATCGTGGTAGTAATTGTAATCTACATTTTTACTTGAGAATGTGCCATCCCTTCCCTG
TTCTCCATTGCCATCCAAGCTCATGTTTCCCCTCTGTTTGCTCTCTCAACAAAGTCCTCCATCT
TCCGTTCTCCATCCTGGCCCAGGCTTCTCTGTGATCCGACCTTCCCTTTTTGTTGCATTCATTC
GCACTCTTCCTCAAAACTAGAAATGCTGCTCGTGGCACAGTCCTGAAAGTCACTGCCCGAAGAG
AACACCCAGCACCTCCTCTTTACCCATTTATCATGTGCCCTGGAGCTTAAAAGAGTTGTGGCCA
ATGGCAGAGGTGAAGTGTCTGAGAAGTTAGCATGGCTGAGGGGAAGAGAAAGGCATTTGTGTCC
AAGAAAGGCTGGCCTTTGGCAGGAGGGAAGCAAGAATAGTTGGGAAGTAGTAGCTTGCTGCCAG
TGTATATGTATATGTATATGTATATGTATATGTATATGTATATGTATATGTATATGTATATGTA
TATGTATATGTATATGTATATGTATATGTATATGTATATGTATATGTATATATTAGTTGGGAAC
TATGACCTGCTGTCCTCATTTGGAACTTTCCTCCCATACCAGGCCTGTCTTGGGTCCCAGAGGT
CTGTTTAAAGACCAACTTCAAATCCCTTTTAGAAAAACATCAAACTTGCATTTTGTAGCTACTG
TTATCTGTCAGTACAAGATTTTCTGTGTCTTTGGGGGAACTTTACAACTTTTCGCTTTGTCTCT
ATAGCCCCAGGAGAGAAGTACCTTCTGATTTTAAAAACAGCAGGACACTCTTACCTTCTTCTAG
AAGGCGTCCCACATGCTTCTGACTAGAAGGAGCTACCACCTCTTCATGTCATCTGAAGCATTTG
ATGTTGTTCATGAAGGCACCAAATAATTTCAGGGAATGAGGGGCTTTGAGGATAACAGGCTCTC
AGGAACACGCTCCATGCCATCCCACTCTCCAATGAAAGCCCTGTACCTCCCTTGTTGATTAAGA
GAAATGAGAGTTATATGGTGAGACTCCCAGGGTCCCACAGAACACTTCCCCCTGCACTACCCAC
TTACTGTGTGTAAGACAAGGATGAGGCAGGAGGGCCTTTCCAGATTCAGCTCAGACTTGGATAG
CGGGGTCTAGGCTGTGTCAGGTGTACCGTGCACTGCTGTGTGGCATGGGCCTCGCATCCGCAGC
TGCCTGCCGTGCTTCCTTCAGTTCTTTCTCTGCAGCTGCCGTGTCCATCCATCCTGCATCACCT
CCTTCCTTTCCCTCCCTTTGCATGCTCTGTGCGCAGACTCTGGAACCGAGGACAGGAGCTGCTC
AGTCTGTTTTGGGAGCTTCTGCTGAGCCTCAGATAGGATGCTGCATGGGGTAAAGCCAGGTGCT
GGGGTGGGAGCAGGGTGGGAGCAGGAGGGGTGTTCTCAGACCTCTATTCCTGCTGTCCTCTGGT
GCACAAGCAGGAGAGGTGGCCATGCTAGGCTGGGTGCCCACTTCCCGTGAAGCAGCATTTCATT
CTGCAGAACCATCCTTCCTTTCCCTTGCCCATTTCCCACGTTTCCTTCGTGCTGCCTCAGGGCA
GGACTGAAGAGCTGGAAGGAAGCAGTCAGTGTACCCTCCCAACGTTCCCTGAAGGTCTCCACTA
GACTCTGGGCTTCCCTTTGCCTAGTGCAGGGGTCACCGCTGGAGAAGAACCAACACTGTCCTTG
GTGTGCTCCAAGCCTGGAGCCAATTTACCCTGTTGGCCCACCCAGCCCCAGCGGGGGATTATTT
CCTGGGTTTCTGTCCCTCCAAGGCTTACCAGGTGTAGTTGGCTTTGTTCTTCTGGGGCTGTTAG
TCCTTCTACTTTCTTTCTCACTTCACCCTGGACCCCCTTCTGTGTCTCTGCAGTCTTCTGTCCC
TCCCACCCATGTGCATGAGCAAATATGCAACTTACCTTGGGATCTGCAGTCAGTTGAAGCCAAG
CTTCCCACATCCTCTTTGTTTGCCATGAGGTGATGTGGGGTTTCCATTGTGTCTGTCATTACCA
CCGTGTCTTTCCTAACCCAGTCTCACAGTTTATGTATAGTAGTAAGAGTTGTCCTTCCACCAAA
GGCATGTGACAGATTTACCAATCTCATGTATTCTCAACAAAGGCGAAAAATACAAATTCCTACC
ACAACATGGAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_037222	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA42322	(Get FASTA)	NCBI Sequence Viewer
	AAC53427	(Get FASTA)	NCBI Sequence Viewer
	AAH92206	(Get FASTA)	NCBI Sequence Viewer
	AAN85832	(Get FASTA)	NCBI Sequence Viewer
	ABR68027	(Get FASTA)	NCBI Sequence Viewer
	ABR68028	(Get FASTA)	NCBI Sequence Viewer
	EDM01858	(Get FASTA)	NCBI Sequence Viewer
	EDM01859	(Get FASTA)	NCBI Sequence Viewer
	EDM01860	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000025081
	ENSRNOP00000025081.7
	ENSRNOP00000076937.1
GenBank Protein	Q63666	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_037222 ⟸ NM_013090
- UniProtKB:	Q56A22 (UniProtKB/Swiss-Prot), O09025 (UniProtKB/Swiss-Prot), A6YSN3 (UniProtKB/Swiss-Prot), Q8CH14 (UniProtKB/Swiss-Prot), Q63666 (UniProtKB/Swiss-Prot), A6ILT1 (UniProtKB/TrEMBL), A6ILS9 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSAPAQPPAEGTEGAAPGGGPPGPPPNTTSNRRLQQTQAQVEEVVDIMRVNVDKVLERDQKLSE LDDRADALQAGASVFESSAAKLKRKYWWKNCKMMIMLGAICAIIVVVIVIYIFT hide sequence

Ensembl Acc Id:

ENSRNOP00000025081 ⟸ ENSRNOT00000025081

Ensembl Acc Id:

ENSRNOP00000080681 ⟸ ENSRNOT00000097145

Ensembl Acc Id:

ENSRNOP00000076937 ⟸ ENSRNOT00000096098

Ensembl Acc Id:

ENSRNOP00000111993 ⟸ ENSRNOT00000172434

Ensembl Acc Id:

ENSRNOP00000107773 ⟸ ENSRNOT00000148495

Ensembl Acc Id:

ENSRNOP00000102084 ⟸ ENSRNOT00000123906

Protein Domains

v-SNARE coiled-coil homology

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q63666-F1-model_v2	AlphaFold	Q63666	1-118	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693406

Promoter ID:

EPDNEW_R3931

Type:

single initiation site

Name:

Vamp1_1

Description:

vesicle-associated membrane protein 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	4	157,726,931 - 157,726,991	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3948	AgrOrtholog
BioCyc Gene	G2FUF-43004	BioCyc
Ensembl Genes	ENSRNOG00000019219	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000025081	ENTREZGENE
	ENSRNOT00000025081.6	UniProtKB/Swiss-Prot
	ENSRNOT00000096098.1	UniProtKB/Swiss-Prot
Gene3D-CATH	1.20.5.110	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7313343	IMAGE-MGC_LOAD
InterPro	Synaptobrevin	UniProtKB/Swiss-Prot
	Synaptobrevin/VAMP	UniProtKB/Swiss-Prot
	V_SNARE_CC	UniProtKB/Swiss-Prot
KEGG Report	rno:25624	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:105480	IMAGE-MGC_LOAD
NCBI Gene	25624	ENTREZGENE
PANTHER	PTHR45701	UniProtKB/Swiss-Prot
Pfam	Synaptobrevin	UniProtKB/Swiss-Prot
PhenoGen	Vamp1	PhenoGen
PIRSF	Synaptobrevin_euk	UniProtKB/Swiss-Prot
PRINTS	SYNAPTOBREVN	UniProtKB/Swiss-Prot
PROSITE	SYNAPTOBREVIN	UniProtKB/Swiss-Prot
	V_SNARE	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000019219	RatGTEx
Superfamily-SCOP	SNARE fusion complex	UniProtKB/Swiss-Prot
TIGR	TC204051
UniProt	A0A8I5ZR85_RAT	UniProtKB/TrEMBL
	A0ABK0LM28_RAT	UniProtKB/TrEMBL
	A0ABK0LM48_RAT	UniProtKB/TrEMBL
	A6ILS9	ENTREZGENE, UniProtKB/TrEMBL
	A6ILT1	ENTREZGENE, UniProtKB/TrEMBL
	A6YSN3	ENTREZGENE
	O09025	ENTREZGENE
	Q56A22	ENTREZGENE
	Q63666	ENTREZGENE
	Q8CH14	ENTREZGENE
	VAMP1_RAT	UniProtKB/Swiss-Prot
UniProt Secondary	A6YSN3	UniProtKB/Swiss-Prot
	O09025	UniProtKB/Swiss-Prot
	Q56A22	UniProtKB/Swiss-Prot
	Q8CH14	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2001-06-22	Vamp1	Vesicle-associated membrane protein 1			Name updated	67952	APPROVED
2001-06-22	Syb1	Synaptobrevin 1			Symbol withdrawn, duplicate of Vamp1 (RGD:3948)	67952	WITHDRAWN

RGD Curation Notes

Note Type	Note	Reference
gene_expression	protein and mRNA are expressed in the choroid plexus, however, alternative splce form Vamp-1b is not detected in this tissue	1299043
gene_transcript	Vamp-1b is produced by alternative pre-mRNA splicing	1299100

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM