Advanced Search (OLGA)

Gene: Rps5 (ribosomal protein S5) Rattus norvegicus

Analyze

Symbol:

Rps5

Name:

ribosomal protein S5

RGD ID:

3601

Description:

Predicted to enable mRNA binding activity and rRNA binding activity. Predicted to be a structural constituent of ribosome. Predicted to be involved in regulation of translational fidelity; ribosomal small subunit biogenesis; and translation. Part of cytosolic small ribosomal subunit. Orthologous to human RPS5 (ribosomal protein S5); PARTICIPATES IN ribosome biogenesis pathway; translation pathway; INTERACTS WITH 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane; 1-naphthyl isothiocyanate; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

40S ribosomal protein S5; small ribosomal subunit protein uS7

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RPS5 (ribosomal protein S5)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Rps5 (ribosomal protein S5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rps5 (ribosomal protein S5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RPS5 (ribosomal protein S5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RPS5 (ribosomal protein S5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rps5 (ribosomal protein S5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RPS5 (ribosomal protein S5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RPS5 (ribosomal protein S5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rps5 (ribosomal protein S5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Rps5 (ribosomal protein S5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	MYO1C (myosin IC)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Rps5 (ribosomal protein S5)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	RPS5 (ribosomal protein S5)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rps5 (ribosomal protein S5)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	rps-5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	RPS5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	RpS5a	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	RpS5a	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	RpS5b	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	RpS5b	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	rps5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	rps5	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Related Pseudogenes:

Rps5-ps1 Rps5-ps2

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	82,610,965 - 82,615,262 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	82,610,965 - 82,615,262 (+)	Ensembl				GRCr8
mRatBN7.2	1	73,538,776 - 73,543,073 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	73,538,776 - 73,543,073 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	78,919,602 - 78,923,902 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	87,483,951 - 87,488,251 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	80,674,674 - 80,678,974 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	65,660,470 - 65,664,767 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	65,660,470 - 65,664,767 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	66,471,608 - 66,475,905 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	72,828,981 - 72,833,277 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	60,295,732 - 60,300,029 (-)	NCBI		Celera
RGSC_v3.1	1	72,907,117 - 72,911,635 (+)	NCBI
Cytogenetic Map	1	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

(S)-nicotine (ISO)

1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (EXP)

1,2-dimethylhydrazine (ISO)

1-naphthyl isothiocyanate (EXP)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-trinitrotoluene (EXP)

2,4-dinitrotoluene (EXP)

2,6-dimethoxyphenol (ISO)

2,6-dinitrotoluene (EXP)

2-amino-14,16-dimethyloctadecan-3-ol (ISO)

2-bromohexadecanoic acid (ISO)

4,4'-sulfonyldiphenol (ISO)

4-amino-2,6-dinitrotoluene (EXP)

aldehydo-D-glucose (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

antimycin A (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenic trichloride (ISO)

arsenite(3-) (ISO)

azoxystrobin (ISO)

benzo[a]pyrene (ISO)

beta-lapachone (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

Bisphenol B (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

chlordecone (ISO)

chloropicrin (ISO)

chromium(6+) (ISO)

cisplatin (ISO)

clobetasol (ISO)

clofibric acid (EXP)

CU-O LINKAGE (ISO)

cylindrospermopsin (ISO)

D-glucose (ISO)

deguelin (ISO)

deoxynivalenol (ISO)

diazinon (ISO)

dihydroartemisinin (ISO)

disodium selenite (ISO)

enzyme inhibitor (ISO)

ethanol (ISO)

fenpyroximate (ISO)

flutamide (EXP)

folic acid (ISO)

FR900359 (ISO)

furfural (ISO)

gentamycin (EXP)

glafenine (EXP)

glucose (ISO)

indometacin (EXP)

ivermectin (ISO)

mercury atom (ISO)

mercury(0) (ISO)

N-methyl-4-phenylpyridinium (ISO)

N-nitrosodiethylamine (EXP)

nefazodone (EXP)

nicotine (ISO)

nimesulide (EXP)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

PhIP (EXP)

picoxystrobin (ISO)

pregnenolone 16alpha-carbonitrile (ISO)

pyrimidifen (ISO)

rotenone (EXP,ISO)

SB 431542 (ISO)

sodium arsenite (EXP,ISO)

sodium chloride (ISO)

sodium dichromate (EXP)

sunitinib (ISO)

tebufenpyrad (ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

tungsten (ISO)

valproic acid (ISO)

zearalenone (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

regulation of translational fidelity (ISO)

ribosomal small subunit biogenesis (ISO,ISS)

translation (IBA,IEA,ISO)

Cellular Component

cytoplasm (IEA)

cytosol (ISO)

cytosolic ribosome (IEA,ISO)

cytosolic small ribosomal subunit (IBA,IDA,IEA,ISO,ISS)

endoplasmic reticulum (ISO)

nucleolus (IEA)

ribonucleoprotein complex (IEA,ISO)

ribosome (IBA,IEA)

small ribosomal subunit (IEA)

small-subunit processome (ISO,ISS)

synapse (IEA,ISO)

Molecular Function

mRNA binding (IBA,ISO)

protein binding (IPI,ISO)

RNA binding (IEA)

rRNA binding (IBA)

structural constituent of ribosome (IBA,IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

ribosome biogenesis pathway (ISO)

translation pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Structures of the human and Drosophila 80S ribosome.	Anger AM, etal., Nature. 2013 May 2;497(7447):80-5. doi: 10.1038/nature12104.
2.	Normalization and subtraction: two approaches to facilitate gene discovery.	Bonaldo MF, etal., Genome Res 1996 Sep;6(9):791-806.
3.	The isolation of eukaryotic ribosomal proteins. The purification and characterization of the 40 S ribosomal subunit proteins S2, S3, S4, S5, S6, S7, S8, S9, S13, S23/S24, S27, and S28.	Collatz E, etal., J Biol Chem. 1976 Aug 10;251(15):4666-72.
4.	Isolation of eukaryotic ribosomal proteins. Purification and characterization of the 40 S ribosomal subunit proteins Sa, Sc, S3a, S3b, S5', S9, S10, S11, S12, S14, S15, S15', S16, S17, S18, S19, S20, S21, S26, S27', and S29.	Collatz E, etal., J Biol Chem. 1977 Dec 25;252(24):9071-80.
5.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
7.	The primary structure of rat ribosomal protein S5. A ribosomal protein present in the rat genome in a single copy.	Kuwano Y, etal., J Biol Chem 1992 Dec 15;267(35):25304-8.
8.	Electron microscopic investigations on the location of rat liver ribosomal proteins S3a, S5, S6, S7 and S9 by means of antibody labeling.	Lutsch G, etal., Biomed Biochim Acta. 1983;42(6):705-23.
9.	Landscape of the hnRNP K protein-protein interactome.	Mikula M, etal., Proteomics. 2006 Apr;6(8):2395-406.
10.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
11.	Functional dichotomy of ribosomal proteins during the synthesis of mammalian 40S ribosomal subunits.	O'Donohue MF, etal., J Cell Biol. 2010 Sep 6;190(5):853-66. doi: 10.1083/jcb.201005117.
12.	GOA pipeline	RGD automated data pipeline
13.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
14.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
15.	Comprehensive gene review and curation	RGD comprehensive gene curation
16.	Expression of ribosomal protein S5 cloned gene during differentiation and apoptosis in murine erythroleukemia (MEL) cells.	Vizirianakis IS, etal., Oncol Res 1999;11(9):409-19.

Additional References at PubMed

PMID:8706699	PMID:12477932	PMID:15883184	PMID:16854843	PMID:17901157	PMID:18464793	PMID:18809582	PMID:19946888	PMID:20458337	PMID:21423176	PMID:22658674	PMID:22681889
PMID:23376485	PMID:23979707	PMID:24668691	PMID:25931508	PMID:31505169	PMID:35352799

Genomics

Comparative Map Data

Rps5
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	82,610,965 - 82,615,262 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	82,610,965 - 82,615,262 (+)	Ensembl				GRCr8
mRatBN7.2	1	73,538,776 - 73,543,073 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	73,538,776 - 73,543,073 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	78,919,602 - 78,923,902 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	87,483,951 - 87,488,251 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	80,674,674 - 80,678,974 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	65,660,470 - 65,664,767 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	65,660,470 - 65,664,767 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	66,471,608 - 66,475,905 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	72,828,981 - 72,833,277 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	60,295,732 - 60,300,029 (-)	NCBI		Celera
RGSC_v3.1	1	72,907,117 - 72,911,635 (+)	NCBI
Cytogenetic Map	1	q21	NCBI

RPS5
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	58,387,269 - 58,394,804 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	58,380,570 - 58,394,807 (+)	Ensembl			hg38	GRCh38
GRCh37	19	58,898,636 - 58,906,171 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	63,590,448 - 63,597,983 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	19	63,590,466 - 63,597,982	NCBI
Celera	19	55,942,629 - 55,950,164 (+)	NCBI		Celera
Cytogenetic Map	19	q13.43	NCBI
HuRef	19	55,207,846 - 55,215,380 (+)	NCBI		HuRef
CHM1_1	19	58,892,560 - 58,900,109 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	61,483,659 - 61,491,195 (+)	NCBI		T2T-CHM13v2.0

Rps5
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	12,656,223 - 12,660,613 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	12,656,217 - 12,660,613 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	7	12,922,311 - 12,926,686 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	12,922,290 - 12,926,686 (+)	Ensembl			mm10	GRCm38
MGSCv37	7	13,507,660 - 13,512,035 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	7	11,822,516 - 11,838,015 (+)	NCBI		MGSCv36	mm8
Celera	7	10,547,262 - 10,551,638 (+)	NCBI		Celera
Cytogenetic Map	7	A1	NCBI
cM Map	7	7.69	NCBI

Rps5
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955584	1,036,044 - 1,041,506 (+)	Ensembl
ChiLan1.0	NW_004955584	1,036,044 - 1,040,451 (+)	NCBI	ChiLan1.0	ChiLan1.0

RPS5
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	64,658,449 - 64,671,398 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	66,446,404 - 66,459,269 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	55,396,001 - 55,403,624 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	64,219,991 - 64,228,173 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	64,218,986 - 64,228,173 (+)	Ensembl			panPan2	panpan1.1

RPS5
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	99,558,769 - 99,564,393 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	99,558,763 - 99,564,332 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	99,953,814 - 99,959,453 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	100,199,463 - 100,205,112 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	100,199,459 - 100,205,037 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	99,844,961 - 99,850,599 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	99,557,359 - 99,562,993 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	100,312,457 - 100,318,097 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Rps5
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	218,104,320 - 218,109,406 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004937062	9,902 - 15,718 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004937062	10,007 - 15,042 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RPS5
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	62,967,994 - 62,974,350 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	6	62,967,955 - 62,974,353 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	57,686,364 - 57,692,212 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RPS5
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	50,662,539 - 50,670,204 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	50,663,431 - 50,670,230 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666045	3,961,962 - 3,969,821 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rps5
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624832	177,463 - 184,373 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624832	177,463 - 184,459 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Rps5
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	2	174,251,112 - 174,254,584 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Rps5
26 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	65
Count of miRNA genes:	63
Interacting mature miRNAs:	65
Transcripts:	ENSRNOT00000026528
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331732	Srn4	Serum renin concentration QTL 4	4.467		renin activity (VT:0005581)	plasma renin activity level (CMO:0000116)	1	43457837	87558729	Rat
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	51940904	101229020	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	39728272	132889942	Rat
4889929	Bss87	Bone structure and strength QTL 87	6.7		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	46302615	91302615	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	51941022	208479811	Rat
1331792	Rf29	Renal function QTL 29	4.589		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	1	43457837	87558729	Rat
2313062	Bmd73	Bone mineral density QTL 73	3.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	46302615	91302615	Rat
8552900	Pigfal1	Plasma insulin-like growth factor 1 level QTL 1	7.4		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	43509952	88509952	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	51940904	168768703	Rat
1354643	Foco2	Food consumption QTL 2	7.17	0.0001	eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	1	42122968	87122968	Rat
2313065	Bss67	Bone structure and strength QTL 67	3.1	0.0001	tibia area (VT:1000281)	tibia total energy absorbed before break (CMO:0001736)	1	46302615	91302615	Rat
2313069	Bss68	Bone structure and strength QTL 68	2.9	0.0001	tibia size trait (VT:0100001)	tibia total energy absorbed before break (CMO:0001736)	1	46302615	91302615	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	66404680	111404680	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34184556	172281316	Rat
2313075	Bss66	Bone structure and strength QTL 66	3.4	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	46302615	91302615	Rat
631512	Scl6	Serum cholesterol level QTL 6	9.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	81269860	99645535	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	66009857	160501508	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34565911	208798288	Rat
1331778	Rf28	Renal function QTL 28	4.66		urine potassium amount (VT:0010539)	urine potassium excretion rate (CMO:0000761)	1	43457837	87558729	Rat
2313077	Bss69	Bone structure and strength QTL 69	3.5	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	46302615	91302615	Rat
1302788	Scl19	Serum cholesterol QTL 19	4.6	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	66400974	132889942	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	51511344	153680016	Rat
1331785	Rf27	Renal function QTL 27	4.643		urine sodium amount (VT:0006274)	urine sodium level (CMO:0000129)	1	30708375	87558729	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	65405637	96805205	Rat
4889962	Bss94	Bone structure and strength QTL 94	3.8		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	51909206	91302615	Rat
6903308	Scl36	Serum cholesterol QTL 36	2	0.0125	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	58769992	103769992	Rat
2313092	Bmd72	Bone mineral density QTL 72	2.5	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	46302615	91302615	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	66077886	111077886	Rat
2313097	Bss70	Bone structure and strength QTL 70	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	46302615	91302615	Rat
9589820	Insglur3	Insulin/glucose ratio QTL 3	10.75	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	1	43509952	88509952	Rat
152025249	Scl82	Serum cholesterol level QTL 82	4.77		blood cholesterol amount (VT:0000180)		1	52891222	109116986	Rat
1354599	Bw29	Body weight QTL 29	3.46	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	1	42122968	87122968	Rat
4889919	Bss86	Bone structure and strength QTL 86	4.1		tibia area (VT:1000281)	tibia midshaft total cross-sectional area (CMO:0001715)	1	46302615	91302615	Rat
8552948	Pigfal11	Plasma insulin-like growth factor 1 level QTL 11	4.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	43509952	88509952	Rat

Markers in Region

RH127789

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	1	82,614,351 - 82,615,163 (+)	Marker Load Pipeline
mRatBN7.2	1	73,542,162 - 73,542,974 (-)	MAPPER	mRatBN7.2
Rnor_6.0	1	65,660,569 - 65,661,380	NCBI	Rnor6.0
Rnor_5.0	1	66,471,707 - 66,472,518	UniSTS	Rnor5.0
RGSC_v3.4	1	72,832,368 - 72,833,179	UniSTS	RGSC3.4
Celera	1	60,295,831 - 60,296,642	UniSTS
RH 3.4 Map	8	1260.6	UniSTS
Cytogenetic Map	1	q21	UniSTS

RH138527

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	1	82,615,009 - 82,615,234 (+)	Marker Load Pipeline
mRatBN7.2	1	73,542,820 - 73,543,045 (-)	MAPPER	mRatBN7.2
Rnor_6.0	1	65,660,498 - 65,660,722	NCBI	Rnor6.0
Rnor_5.0	1	66,471,636 - 66,471,860	UniSTS	Rnor5.0
RGSC_v3.4	1	72,833,026 - 72,833,250	UniSTS	RGSC3.4
Celera	1	60,295,760 - 60,295,984	UniSTS
RH 3.4 Map	1	765.09	UniSTS
Cytogenetic Map	1	q21	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001277243	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001277244	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC158718	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474090	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FM052146	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ209785	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ210357	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ210491	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ217060	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ217574	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219286	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221071	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221219	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221255	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221284	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221608	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ222025	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ222269	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ222365	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ222894	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ223194	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224029	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224177	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ225463	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ226199	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ226257	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ226702	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ227598	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228474	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230232	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232912	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000026528 ⟹ ENSRNOP00000026528

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	82,610,965 - 82,615,262 (+)	Ensembl
mRatBN7.2 Ensembl	1	73,538,776 - 73,543,073 (+)	Ensembl
Rnor_6.0 Ensembl	1	65,660,470 - 65,664,767 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000088367 ⟹ ENSRNOP00000072051

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	82,610,965 - 82,615,262 (+)	Ensembl
mRatBN7.2 Ensembl	1	73,538,776 - 73,543,063 (+)	Ensembl
Rnor_6.0 Ensembl	1	65,660,470 - 65,664,767 (-)	Ensembl

RefSeq Acc Id:

NM_001277243 ⟹ NP_001264172

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	82,610,965 - 82,615,262 (+)	NCBI
mRatBN7.2	1	73,538,776 - 73,543,073 (+)	NCBI
Rnor_6.0	1	65,660,470 - 65,664,767 (-)	NCBI
Rnor_5.0	1	66,471,608 - 66,475,905 (-)	NCBI
Celera	1	60,295,732 - 60,300,029 (-)	NCBI

Sequence:

show sequence

AAAAGCGCTGGCCTGCTACGTTCGGCCTCTTCCTGTCTGTGCCAGAACTGCGCGTGGTCCGCGC
CGATCGACTGAGAAGCCCGGTTTGCGCTCTCAGAATGACTGAATGGGAAACAGCCACACCCGCG
GTGGCAGAGACCCCGGACATCAAGCTCTTTGGGAAATGGAGCACTGATGATGTGCAGATCAACG
ATATTTCTCTACAGGATTACATTGCTGTGAAGGAGAAGTATGCCAAGTACCTGCCCCACAGTGC
AGGACGGTATGCTGCCAAGCGTTTCCGCAAAGCACAGTGTCCCATCGTGGAGCGCCTTACTAAC
TCCATGATGATGCACGGTCGTAACAACGGCAAGAAGCTCATGACTGTACGAATTGTCAAGCATG
CCTTTGAGATCATCCACCTGCTCACTGGTGAGAACCCTCTGCAGGTCCTGGTGAATGCTATCAT
CAACAGTGGCCCCCGAGAAGACTCAACACGCATTGGGCGGGCTGGAACAGTGAGACGGCAGGCT
GTGGATGTATCCCCACTTCGCCGAGTGAATCAGGCCATCTGGCTGCTGTGCACGGGGGCTCGTG
AGGCTGCTTTCCGGAACATCAAGACCATCGCTGAGTGCCTTGCAGATGAGCTCATTAATGCTGC
CAAGGGCTCCTCCAACTCCTATGCTATCAAGAAGAAAGATGAACTGGAGCGTGTGGCCAAGTCT
AACCGCTGATTTCCCAGCTGCTGCCTAATAAATTGTGTGCCCTTTGGGACAGTTACATCTT

hide sequence

RefSeq Acc Id:

NM_001277244 ⟹ NP_001264173

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	82,610,965 - 82,615,262 (+)	NCBI
mRatBN7.2	1	73,538,776 - 73,543,073 (+)	NCBI
Rnor_6.0	1	65,660,470 - 65,664,767 (-)	NCBI
Rnor_5.0	1	66,471,608 - 66,475,905 (-)	NCBI
Celera	1	60,295,732 - 60,300,029 (-)	NCBI

Sequence:

show sequence

AAAAGCGCTGGCCTGCTACGTTCGGCCTCTTCCTGTCTGTGCCAGAACTGCGCGTGGTCCGCGC
CGATCGACTGAGAAGCCCGGTTTGCGCTCTCAGAATGACTGAATGGGAAACAGCCACACCCGCG
GTGGCAGAGACCCCGGACATCAAGCTCTTTGGGAAATGGAGCACTGATGATGTGCAGATCAACG
ATATTTCTCTACAGGATTACATTGCTGTGAAGGAGAAGTATGCCAAGTACCTGCCCCACAGTGC
AGGACGGTATGCTGCCAAGCGTTTCCGCAAAGCACAGTGTCCCATCGTGGAGCGCCTTACTAAC
TCCATGATGATGCACGGTCGTAACAACGGCAAGAAGCTCATGACTGTACGAATTGTCAAGCATG
CCTTTGAGATCATCCACCTGCTCACTGGTGAGAACCCTCTGCAGGTCCTGGTGAATGCTATCAT
CAACAGTGGCCCCCGAGAAGACTCAACACGCATTGGGCGGGCTGGAACAGTGAGACGGCAGGCT
GTGGATGTATCCCCACTTCGCCGAGTGAATCAGGGCTCCTCCAACTCCTATGCTATCAAGAAGA
AAGATGAACTGGAGCGTGTGGCCAAGTCTAACCGCTGATTTCCCAGCTGCTGCCTAATAAATTG
TGTGCCCTTTGGGACAGTTACATCTT

hide sequence

Protein Sequences


Protein RefSeqs	NP_001264172	(Get FASTA)	NCBI Sequence Viewer
	NP_001264173	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI58719	(Get FASTA)	NCBI Sequence Viewer
	EDL75777	(Get FASTA)	NCBI Sequence Viewer
	EDL75778	(Get FASTA)	NCBI Sequence Viewer
	EDL75779	(Get FASTA)	NCBI Sequence Viewer
	EDL75780	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000026528
	ENSRNOP00000072051
GenBank Protein	P24050	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001264173 ⟸ NM_001277244
- Peptide Label:	isoform 2
- UniProtKB:	P24050 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MTEWETATPAVAETPDIKLFGKWSTDDVQINDISLQDYIAVKEKYAKYLPHSAGRYAAKRFRKA QCPIVERLTNSMMMHGRNNGKKLMTVRIVKHAFEIIHLLTGENPLQVLVNAIINSGPREDSTRI GRAGTVRRQAVDVSPLRRVNQGSSNSYAIKKKDELERVAKSNR hide sequence

RefSeq Acc Id:	NP_001264172 ⟸ NM_001277243
- Peptide Label:	isoform 1
- UniProtKB:	P24050 (UniProtKB/Swiss-Prot), B0BN81 (UniProtKB/TrEMBL), F7FP79 (UniProtKB/TrEMBL)
- Sequence:	show sequence MTEWETATPAVAETPDIKLFGKWSTDDVQINDISLQDYIAVKEKYAKYLPHSAGRYAAKRFRKA QCPIVERLTNSMMMHGRNNGKKLMTVRIVKHAFEIIHLLTGENPLQVLVNAIINSGPREDSTRI GRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECLADELINAAKGSSNSYAIKK KDELERVAKSNR hide sequence

Ensembl Acc Id:

ENSRNOP00000026528 ⟸ ENSRNOT00000026528

Ensembl Acc Id:

ENSRNOP00000072051 ⟸ ENSRNOT00000088367

Protein Domains

Small ribosomal subunit protein uS7

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P24050-F1-model_v2	AlphaFold	P24050	1-204	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13689675

Promoter ID:

EPDNEW_R200

Type:

multiple initiation site

Name:

Rps5_1

Description:

ribosomal protein S5

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	65,664,741 - 65,664,801	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3601	AgrOrtholog
BioCyc Gene	G2FUF-60715	BioCyc
Ensembl Genes	ENSRNOG00000019453	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000026528	ENTREZGENE
	ENSRNOT00000088367	ENTREZGENE
Gene3D-CATH	1.10.455.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:9089281	IMAGE-MGC_LOAD
InterPro	Ribosomal_S5/S7	UniProtKB/Swiss-Prot
	Ribosomal_S5/S7_euk/arc	UniProtKB/Swiss-Prot
	Ribosomal_S7_CS	UniProtKB/Swiss-Prot
	Ribosomal_S7_dom	UniProtKB/Swiss-Prot
	Ribosomal_S7_dom_sf	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:187862	IMAGE-MGC_LOAD
NCBI Gene	25538	ENTREZGENE
PANTHER	PTHR11205	UniProtKB/Swiss-Prot
Pfam	Ribosomal_S7	UniProtKB/Swiss-Prot
PhenoGen	Rps5	PhenoGen
PIRSF	RPS7p_RPS7a_RPS5e_RPS7o	UniProtKB/Swiss-Prot
PROSITE	RIBOSOMAL_S7	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000019453	RatGTEx
Superfamily-SCOP	SSF47973	UniProtKB/Swiss-Prot
UniProt	A0A0G2K200_RAT	UniProtKB/TrEMBL
	A6KQN0_RAT	UniProtKB/TrEMBL
	B0BN81	ENTREZGENE, UniProtKB/TrEMBL
	F7FP79	ENTREZGENE, UniProtKB/TrEMBL
	P24050	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2002-06-10	Rps5	ribosomal protein S5			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_regulation	expression level decreases upon induction of differentiation	724626

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

RGD Manual Annotations