Advanced Search (OLGA)

Gene: Nsg1 (neuronal vesicle trafficking associated 1) Rattus norvegicus

Analyze

Symbol:

Nsg1

Name:

neuronal vesicle trafficking associated 1

RGD ID:

2222

Description:

Enables ionotropic glutamate receptor binding activity. Involved in several processes, including positive regulation of receptor recycling; postsynaptic neurotransmitter receptor cycle; and spontaneous synaptic transmission. Located in several cellular components, including endosome; lysosomal lumen; and trans-Golgi network membrane. Is active in glutamatergic synapse and postsynaptic endosome. Orthologous to human NSG1 (neuronal vesicle trafficking associated 1); INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-sulfonyldiphenol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

brain neuron cytoplasmic protein 1/2; brain specific mRNA b; Bsmrb; Neep21; neuron specific gene family member 1; neuron-enriched endosomal protein of 21 kDa; neuron-specific protein family member 1; neuronal vesicle trafficking-associated protein 1; PEP1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	76,861,079 - 76,882,822 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	14	76,860,746 - 76,883,390 (+)	Ensembl				GRCr8
mRatBN7.2	14	72,648,771 - 72,670,521 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	72,648,741 - 72,670,514 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	14	77,090,481 - 77,112,223 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	78,331,349 - 78,353,091 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	74,771,417 - 74,793,159 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	14	77,390,778 - 77,412,461 (+)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	14	76,019,521 - 76,041,204 (+)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	14	77,538,330 - 77,560,015 (+)	NCBI		Lyon_Hypertensive
F344_StmMcwi	14	76,462,440 - 76,484,123 (+)	NCBI		F344_StmMcwi
Rnor_6.0	14	77,380,264 - 77,402,007 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	77,380,262 - 77,401,996 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	14	77,362,126 - 77,383,869 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	14	77,931,947 - 77,953,690 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	14	71,598,968 - 71,620,711 (+)	NCBI		Celera
RGSC_v3.1	14	77,934,337 - 77,956,080 (+)	NCBI
Cytogenetic Map	14	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-methylcholine (ISO)

4,4'-sulfonyldiphenol (EXP,ISO)

actinomycin D (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

ammonium chloride (EXP)

amphetamine (EXP)

antirheumatic drug (ISO)

benzene (ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

benzo[e]pyrene (ISO)

bis(2-chloroethyl) sulfide (ISO)

bis(2-ethylhexyl) phthalate (EXP,ISO)

bisphenol A (EXP,ISO)

bisphenol F (EXP)

butanal (ISO)

Butylbenzyl phthalate (EXP,ISO)

C60 fullerene (EXP)

cadmium atom (EXP)

cadmium dichloride (EXP)

camptothecin (ISO)

choline (ISO)

cisplatin (ISO)

clobetasol (ISO)

deguelin (ISO)

dibutyl phthalate (EXP,ISO)

diethyl phthalate (EXP,ISO)

diisobutyl phthalate (EXP,ISO)

diisononyl phthalate (EXP,ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

endosulfan (EXP)

ethanol (ISO)

ferric oxide (EXP)

folic acid (ISO)

formaldehyde (ISO)

furan (EXP)

L-methionine (ISO)

lead diacetate (EXP)

levonorgestrel (ISO)

methapyrilene (ISO)

methotrexate (ISO)

methylmercury chloride (ISO)

mono(2-ethylhexyl) phthalate (ISO)

Nutlin-3 (ISO)

okadaic acid (ISO)

oxaliplatin (EXP)

oxidopamine (EXP)

ozone (ISO)

paracetamol (EXP,ISO)

pentanal (ISO)

perfluorooctanoic acid (EXP)

phenobarbital (EXP)

pirinixic acid (EXP)

progesterone (ISO)

propanal (ISO)

quercetin 3-O-beta-D-glucofuranoside (EXP)

quercetin 3-O-beta-D-glucopyranoside (EXP)

rutin (EXP)

SB 431542 (ISO)

sunitinib (ISO)

testosterone undecanoate (ISO)

tetrachloromethane (EXP)

titanium dioxide (ISO)

topotecan (EXP)

Trapidil (EXP)

trichloroethene (EXP)

trichostatin A (ISO)

triclosan (ISO)

triphenyl phosphate (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

amyloid precursor protein metabolic process (IEA,ISO,ISS)

apoptotic process (IEA,ISO,ISS)

clathrin coat assembly (IBA,IEA)

endosomal transport (IBA,IMP)

neurotransmitter receptor cycle (IEA,ISO,ISS)

neurotransmitter receptor transport, endosome to postsynaptic membrane (IEA,ISO)

positive regulation of receptor recycling (IMP)

postsynaptic neurotransmitter receptor cycle (IMP)

receptor recycling (IEA,ISO,ISS)

regulation of long-term synaptic potentiation (IMP)

spontaneous synaptic transmission (IMP)

Cellular Component

cytoplasmic vesicle (IEA)

cytoplasmic vesicle membrane (IEA)

dendrite (IDA,IEA)

early endosome (IDA)

early endosome membrane (IDA,IEA)

endoplasmic reticulum (IEA,ISO,ISS)

endoplasmic reticulum membrane (IEA)

endosome (IBA,IDA,IEA,ISO)

endosome membrane (IEA)

glutamatergic synapse (IDA,IEA,ISO)

Golgi apparatus (IEA)

Golgi cisterna membrane (IEA)

late endosome (IDA,IEA,ISO)

late endosome membrane (IEA)

lateral plasma membrane (IEA,ISO)

lysosomal lumen (IDA,IEA)

membrane (IBA,IEA)

multivesicular body membrane (IEA)

postsynaptic endosome (IDA)

postsynaptic membrane (IEA,ISO)

recycling endosome membrane (IDA,IEA)

somatodendritic compartment (IDA)

trans-Golgi network membrane (IDA)

Molecular Function

clathrin light chain binding (IBA,IEA)

ionotropic glutamate receptor binding (IPI)

protein binding (IPI,ISO)

signaling receptor binding (IPI)

References

References - curated

#	Reference Title	Reference Citation
1.	The endosomal protein NEEP21 regulates AMPA receptor-mediated synaptic transmission and plasticity in the hippocampus.	Alberi S, etal., Mol Cell Neurosci. 2005 Jun;29(2):313-9.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.	GOA pipeline	RGD automated data pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	Interactions between NEEP21, GRIP1 and GluR2 regulate sorting and recycling of the glutamate receptor subunit GluR2.	Steiner P, etal., EMBO J. 2005 Aug 17;24(16):2873-84. Epub 2005 Jul 21.
9.	Modulation of receptor cycling by neuron-enriched endosomal protein of 21 kD.	Steiner P, etal., J Cell Biol. 2002 Jun 24;157(7):1197-209. Epub 2002 Jun 17.
10.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
11.	Identifying the protein products of brain-specific genes with antibodies to chemically synthesized peptides.	Sutcliffe JG, etal., Cell 1983 Jul;33(3):671-82.
12.	The somatodendritic endosomal regulator NEEP21 facilitates axonal targeting of L1/NgCAM.	Yap CC, etal., J Cell Biol. 2008 Feb 25;180(4):827-42. doi: 10.1083/jcb.200707143.
13.	The endosomal neuronal proteins Nsg1/NEEP21 and Nsg2/P19 are itinerant, not resident proteins of dendritic endosomes.	Yap CC, etal., Sci Rep. 2017 Sep 5;7(1):10481. doi: 10.1038/s41598-017-07667-x.

Additional References at PubMed

PMID:15187090	PMID:15489334	PMID:17121843	PMID:19063943	PMID:20599942	PMID:21084623	PMID:22871113

Genomics

Comparative Map Data

Nsg1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	76,861,079 - 76,882,822 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	14	76,860,746 - 76,883,390 (+)	Ensembl				GRCr8
mRatBN7.2	14	72,648,771 - 72,670,521 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	72,648,741 - 72,670,514 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	14	77,090,481 - 77,112,223 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	78,331,349 - 78,353,091 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	74,771,417 - 74,793,159 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	14	77,390,778 - 77,412,461 (+)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	14	76,019,521 - 76,041,204 (+)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	14	77,538,330 - 77,560,015 (+)	NCBI		Lyon_Hypertensive
F344_StmMcwi	14	76,462,440 - 76,484,123 (+)	NCBI		F344_StmMcwi
Rnor_6.0	14	77,380,264 - 77,402,007 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	77,380,262 - 77,401,996 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	14	77,362,126 - 77,383,869 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	14	77,931,947 - 77,953,690 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	14	71,598,968 - 71,620,711 (+)	NCBI		Celera
RGSC_v3.1	14	77,934,337 - 77,956,080 (+)	NCBI
Cytogenetic Map	14	q21	NCBI

NSG1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	4,386,532 - 4,419,058 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	4,348,140 - 4,419,058 (+)	Ensembl			hg38	GRCh38
GRCh37	4	4,388,259 - 4,420,785 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	4,438,884 - 4,471,686 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	4	4,506,823 - 4,538,856	NCBI
Celera	4	4,285,777 - 4,318,783 (+)	NCBI		Celera
Cytogenetic Map	4	p16.3	NCBI
HuRef	4	4,323,846 - 4,356,408 (+)	NCBI		HuRef
CHM1_1	4	4,385,947 - 4,418,741 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	4	4,350,456 - 4,388,523 (+)	NCBI		T2T-CHM13v2.0

Nsg1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	38,294,537 - 38,317,087 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	38,294,536 - 38,317,251 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	5	38,137,193 - 38,159,743 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	38,137,192 - 38,159,907 (-)	Ensembl			mm10	GRCm38
MGSCv37	5	38,528,432 - 38,550,706 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	5	38,425,442 - 38,447,716 (-)	NCBI		MGSCv36	mm8
Celera	5	35,587,097 - 35,609,344 (-)	NCBI		Celera
Cytogenetic Map	5	B3	NCBI
cM Map	5	20.21	NCBI

Nsg1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955514	5,273,810 - 5,295,710 (-)	Ensembl
ChiLan1.0	NW_004955514	5,273,810 - 5,294,925 (-)	NCBI	ChiLan1.0	ChiLan1.0

NSG1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	3	4,652,831 - 4,683,301 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	4	4,585,813 - 4,616,317 (+)	NCBI		NHGRI_mPanPan1
PanPan1.1	4	4,467,232 - 4,496,088 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	4	4,467,234 - 4,496,088 (+)	Ensembl			panPan2	panpan1.1

NSG1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	3	69,805,646 - 69,831,200 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	3	69,805,592 - 69,831,194 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	3	72,354,015 - 72,382,936 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	3	70,558,811 - 70,587,730 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	3	70,557,943 - 70,587,725 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	3	69,832,775 - 69,861,668 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	3	69,997,988 - 70,026,875 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	3	70,379,404 - 70,408,307 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Nsg1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405285	63,323,364 - 63,344,659 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936477	17,025,044 - 17,046,014 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936477	17,025,057 - 17,046,353 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NSG1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	8	6,000,057 - 6,024,769 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	8	6,000,054 - 6,023,379 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

NSG1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	27	40,544,037 - 40,576,479 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	27	40,544,701 - 40,579,108 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666047	87,345,154 - 87,377,591 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Nsg1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624755	21,506,250 - 21,529,052 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624755	21,507,068 - 21,529,057 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Nsg1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	11	67,029,277 - 67,051,142 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Nsg1
54 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	158
Count of miRNA genes:	109
Interacting mature miRNAs:	144
Transcripts:	ENSRNOT00000008030
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2313089	Bss81	Bone structure and strength QTL 81	3.4	0.0001	body length (VT:0001256)	body length, nose to rump (CMO:0000079)	14	38023710	83023710	Rat
9590294	Uminl4	Urine mineral level QTL 4	5.66	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	14	59848686	104848686	Rat
70214	Niddm28	Non-insulin dependent diabetes mellitus QTL 28	4.06		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	14	39009444	84009444	Rat
70153	Bp59	Blood pressure QTL 59	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	14	72970210	87582095	Rat
70187	Pancm5	Pancreatic morphology QTL 5	16.7		pancreas mass (VT:0010144)	pancreas weight to body weight ratio (CMO:0000630)	14	30674469	85041098	Rat
631523	Pia13	Pristane induced arthritis QTL 13	3.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	14	33424686	102238540	Rat
1582259	Gluco23	Glucose level QTL 23	3.1	0.0008	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	14	74255551	109089856	Rat
2313100	Bss82	Bone structure and strength QTL 82	3	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	14	38023710	83023710	Rat
634328	Hc5	Hypercalciuria QTL 5	2.3		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	14	62398852	107398852	Rat
2317879	Alcrsp27	Alcohol response QTL 27	3.3	0.63	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	14	60854936	105854936	Rat
1641900	Alcrsp11	Alcohol response QTL 11			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	14	74255551	109089856	Rat
631839	Niddm37	Non-insulin dependent diabetes mellitus QTL 37	3.37		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	11334716	100078267	Rat
9589034	Epfw11	Epididymal fat weight QTL 11	6	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	14	59848686	104848686	Rat
2313048	Bss84	Bone structure and strength QTL 84	3.1	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	14	38023710	83023710	Rat
1300136	Rf22	Renal function QTL 22	3.9		renal blood flow trait (VT:2000006)	absolute change in renal vascular resistance (CMO:0001900)	14	42616258	99224555	Rat
1549834	Scl45	Serum cholesterol level QTL 45	5.8		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	14	65920283	99224555	Rat
738037	Hcas6	Hepatocarcinoma susceptibility QTL 6	2.93		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464)	14	39411170	87582095	Rat
2313084	Bss83	Bone structure and strength QTL 83	2.9	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	14	38023710	83023710	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	162	91	90	59	90	59	6	347	190	11	140	74	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_024128	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039091623	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063272865	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC133046	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC060538	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473963	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000014	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	V01543	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000008030 ⟹ ENSRNOP00000008030

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	14	76,861,519 - 76,883,390 (+)	Ensembl
mRatBN7.2 Ensembl	14	72,648,741 - 72,670,514 (+)	Ensembl
Rnor_6.0 Ensembl	14	77,380,262 - 77,401,996 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000116917 ⟹ ENSRNOP00000090551

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	14	72,649,211 - 72,670,514 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000118922 ⟹ ENSRNOP00000097258

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	14	76,860,746 - 76,883,390 (+)	Ensembl
mRatBN7.2 Ensembl	14	72,648,797 - 72,670,514 (+)	Ensembl

RefSeq Acc Id:

NM_024128 ⟹ NP_077042

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	76,861,079 - 76,882,822 (+)	NCBI
mRatBN7.2	14	72,648,771 - 72,670,514 (+)	NCBI
Dahl_SR_JrHsd	14	77,390,778 - 77,412,461 (+)	NCBI
Lyon_Normotensive	14	76,019,521 - 76,041,204 (+)	NCBI
Lyon_Hypertensive	14	77,538,330 - 77,560,015 (+)	NCBI
F344_StmMcwi	14	76,462,440 - 76,484,123 (+)	NCBI
Rnor_6.0	14	77,380,264 - 77,402,007 (+)	NCBI
Rnor_5.0	14	77,362,126 - 77,383,869 (+)	NCBI
RGSC_v3.4	14	77,931,947 - 77,953,690 (+)	RGD
Celera	14	71,598,968 - 71,620,711 (+)	RGD

Sequence:

show sequence

GGAGCCTCGGAGCGCGCTTGAAGCCCAGATCTGCTGGAGCCAGGCGTGGGGCCGCAGCCTCGTG
TCTTTCGCAGCCATGGTGAAGTTGGGGAACAATTTTGCAGAGAAGGGCACAAAGCAGCCACTGC
TGGAGGATGGCTTCGACACCATTCCTCTGATGACGCCCCTCGATGTCAACCAGCTGCAGTTCCC
ACCCCCAGATAAGGTCGTTGTGAAAACTAAGACCGAATATGAACCTGACCGCAAGAAAGGAAAA
GCGCGTCCTCCCAAGATAGCCGAGTTCACCGTCAGCATCACCGAGGGTGTCACCGAGAGGTTTA
AGGTCTCCGTGCTGGTCCTCTTTGCCCTGGCCTTCCTCACCTGTGTCGTCTTCCTGGTTGTCTA
CAAAGTGTACAAGTATGACCGTGCGTGCCCTGATGGGTTTGTCTTGAAGAATACCCAGTGCATC
CCAGAAGGCTTGGAGAGCTACTACACGGAGCAAGACTCCAGTGCCCGGGAGAAATTTTACACTG
TCATAAATCACTACAACCTGGCCAAGCAGAGCATCACGCGCTCAGTGTCACCGTGGATGTCAGT
TCTGTCAGAAGAGAAGCTGTCGGAACAGGAGACCGAAGCTGCAGAGAAGTCAGCTTAGCAAGCG
GGGCAGGTTCCTTACAATGTGTCACTTGAAGGCAACAAAGGGACTTTGAGGGACATTTCATTAA
ATATAATTACCGATAATTTAGAGATTACTCATTTACGGTGCAATTGCTTCTGTTTGCTAATGCT
GCTTTGCAAATAAAACTTGCTGCGGACCACCCACAGGCATAAGAAAAGTGCATCTCAGCACTGC
TTAGAGAGCTTGATGCCACTGTCCATGCCGAGGAGTCGCCATTTAGCTCCTTCACTGGGACGCA
CTGGATACTGTCAAGAGGTAATTCGCCCTGGCTATGCCAGGGCTCCGGCCATCAGAACAGTGCA
TTTGGTGGTTTCGTTCTCTTTTATGCCCCTTTGCTATTTGCAGACCTTACCCCATACATAGAGT
GACCCCACGCTCTGCTGACTGCAGTGTGGATGCACTGCTAAGCGGCGCAGAGGAAGGAAGGTGT
GCACCACGACACACGCAGCCCTGCCAGGGCAGTTCTGGGAGGTTCTCTTTGCTATGTCCCCTGC
GCAGAACACGAGGATGGGGTGGGGAGGAGCTGGCTCTGGGCCAGGGGGTTGCCGAGCCTGTGCT
CCTGTGGGTGGTGTCTGCTGGTGATGTGCTAGATAGGAAGAAAGCCCACTGGCTCGTTCCTTTC
CTGTTATGATACATTTGCACGTACAGCCCTGAATGCAGGTGCAGTTTTGGTTTTTTGTTTTCTT
AGCCAGTGGGCAAAGTGAAATGTAATTTTGGGTAAGCCAGGGCTTCTTTAGCTTTTATTCTGTG
AACAGATGTGACTCCTGTGCTGTGGGAAGGGGGCAGGACGGCTGGTGGGGGGCTGATGTGGCAC
CTTGAAAATAGAATAAGTCCACAATCTTTGTAAGAAAAGAATGTTTATGTTTCAATTTGAATCT
TGACATTAAAGTATATGTTTACAAAATCACCAGTAGGTAAACTAAATGTGTAAGACAATTAAAT
AGAAAAAGCTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039091623 ⟹ XP_038947551

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	76,861,110 - 76,882,822 (+)	NCBI
mRatBN7.2	14	72,648,824 - 72,670,521 (+)	NCBI

RefSeq Acc Id:

XM_063272865 ⟹ XP_063128935

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	76,863,046 - 76,882,822 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_077042	(Get FASTA)	NCBI Sequence Viewer
	XP_038947551	(Get FASTA)	NCBI Sequence Viewer
	XP_063128935	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH60538	(Get FASTA)	NCBI Sequence Viewer
	CAA24784	(Get FASTA)	NCBI Sequence Viewer
	CAA24785	(Get FASTA)	NCBI Sequence Viewer
	EDM00009	(Get FASTA)	NCBI Sequence Viewer
	EDM00010	(Get FASTA)	NCBI Sequence Viewer
	EDM00011	(Get FASTA)	NCBI Sequence Viewer
	EDM00012	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000097258
	ENSRNOP00000097258.1
GenBank Protein	P02683	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_077042 ⟸ NM_024128
- UniProtKB:	P02684 (UniProtKB/Swiss-Prot), Q6P9Y0 (UniProtKB/Swiss-Prot), P02683 (UniProtKB/Swiss-Prot), A6IJU5 (UniProtKB/TrEMBL), A0A8L2Q3K9 (UniProtKB/TrEMBL)
- Sequence:	show sequence MVKLGNNFAEKGTKQPLLEDGFDTIPLMTPLDVNQLQFPPPDKVVVKTKTEYEPDRKKGKARPP KIAEFTVSITEGVTERFKVSVLVLFALAFLTCVVFLVVYKVYKYDRACPDGFVLKNTQCIPEGL ESYYTEQDSSAREKFYTVINHYNLAKQSITRSVSPWMSVLSEEKLSEQETEAAEKSA hide sequence

Ensembl Acc Id:

ENSRNOP00000008030 ⟸ ENSRNOT00000008030

RefSeq Acc Id:	XP_038947551 ⟸ XM_039091623
- Peptide Label:	isoform X1
- UniProtKB:	P02684 (UniProtKB/Swiss-Prot), P02683 (UniProtKB/Swiss-Prot), Q6P9Y0 (UniProtKB/Swiss-Prot), A6IJU5 (UniProtKB/TrEMBL), A0A8L2Q3K9 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000097258 ⟸ ENSRNOT00000118922

Ensembl Acc Id:

ENSRNOP00000090551 ⟸ ENSRNOT00000116917

RefSeq Acc Id:	XP_063128935 ⟸ XM_063272865
- Peptide Label:	isoform X2

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P02683-F1-model_v2	AlphaFold	P02683	1-185	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13699370

Promoter ID:

EPDNEW_R9895

Type:

multiple initiation site

Name:

Nsg1_1

Description:

neuronal vesicle trafficking associated 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	14	77,380,237 - 77,380,297	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2222	AgrOrtholog
BioCyc Gene	G2FUF-15379	BioCyc
Ensembl Genes	ENSRNOG00000005700	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000118922	ENTREZGENE
	ENSRNOT00000118922.1	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:6921928	IMAGE-MGC_LOAD
InterPro	NSG	UniProtKB/Swiss-Prot
KEGG Report	rno:25247	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72656	IMAGE-MGC_LOAD
NCBI Gene	25247	ENTREZGENE
PANTHER	NEURONAL VESICLE TRAFFICKING-ASSOCIATED PROTEIN 1	UniProtKB/Swiss-Prot
	PTHR28546	UniProtKB/Swiss-Prot
Pfam	Calcyon	UniProtKB/Swiss-Prot
PhenoGen	Nsg1	PhenoGen
PIRSF	Calcyon	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000005700	RatGTEx
UniProt	A0A8L2Q3K9	ENTREZGENE, UniProtKB/TrEMBL
	A6IJU5	ENTREZGENE, UniProtKB/TrEMBL
	A6IJU7_RAT	UniProtKB/TrEMBL
	NSG1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	P02684	ENTREZGENE
	Q6P9Y0	ENTREZGENE
UniProt Secondary	P02684	UniProtKB/Swiss-Prot
	Q6P9Y0	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-07-18	Nsg1	neuronal vesicle trafficking associated 1	Nsg1	neuron specific gene family member 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Nsg1	neuron specific gene family member 1	Bsmrb	brain specific mRNA b	Symbol and Name updated	1299863	APPROVED
2002-06-10	Bsmrb	Brain specific mRNA B (clone p1a75)			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed specifically in the brain	634670
gene_function	may be a precursor for a novel neuronal fiber network neurotransmitter	634670

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message