Advanced Search (OLGA)

Gene: Oaz3 (ornithine decarboxylase antizyme 3) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Oaz3

Name:

ornithine decarboxylase antizyme 3

RGD ID:

1599278

Description:

Enables ankyrin repeat binding activity. Involved in negative regulation of stress fiber assembly. Located in sperm flagellum. Orthologous to human OAZ3 (ornithine decarboxylase antizyme 3); PARTICIPATES IN polyamine metabolic pathway; INTERACTS WITH bisphenol A; C60 fullerene; Cuprizon.

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

antizyme 3; Az3; Oaz-t; ODC-Az 3

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	OAZ3 (ornithine decarboxylase antizyme 3)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Oaz3 (ornithine decarboxylase antizyme 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Oaz3 (ornithine decarboxylase antizyme 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	OAZ3 (ornithine decarboxylase antizyme 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	OAZ3 (ornithine decarboxylase antizyme 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Oaz3 (ornithine decarboxylase antizyme 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	OAZ3 (ornithine decarboxylase antizyme 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	OAZ3 (ornithine decarboxylase antizyme 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Oaz3 (ornithine decarboxylase antizyme 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	OAZ3 (ornithine decarboxylase antizyme 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Oaz3 (ornithine decarboxylase antizyme 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	oaz-1	Alliance	DIOPT (OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	Oda	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	184,762,242 - 184,765,176 (-)	NCBI		GRCr8
mRatBN7.2	2	182,073,212 - 182,076,147 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	182,073,215 - 182,082,399 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	189,736,364 - 189,739,297 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	187,540,629 - 187,543,554 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	182,368,832 - 182,371,765 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	195,675,925 - 195,678,859 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	195,676,048 - 195,678,848 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	215,154,619 - 215,157,553 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	189,408,566 - 189,411,500 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	2	174,623,440 - 174,626,374 (-)	NCBI		Celera
Cytogenetic Map	2	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Oaz3	Rat	gastrointestinal stromal tumor		ISO	OAZ3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Gastrointestinal stromal tumor	ClinVar	PMID:28492532
Oaz3	Rat	immunodeficiency 42		ISO	OAZ3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Autosomal recessive mendelian susceptibility to mycobacterial diseases due to complete RORgamma receptor deficiency	ClinVar	PMID:28492532
Oaz3	Rat	MHC class II deficiency		ISO	OAZ3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: MHC class II deficiency	ClinVar	PMID:28492532
Oaz3	Rat	parathyroid carcinoma		ISO	OAZ3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Parathyroid carcinoma	ClinVar	PMID:28492532
Oaz3	Rat	severe congenital neutropenia 3		ISO	OAZ3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Kostmann syndrome	ClinVar	PMID:28492532
Oaz3	Rat	severe congenital neutropenia 5		ISO	OAZ3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Congenital neutropenia-myelofibrosis-nephromegaly syndrome	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Oaz3	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	Oaz3 (Mus musculus)	6480464	Tetrachlorodibenzodioxin results in decreased expression of OAZ3 mRNA	CTD	PMID:19933214
Oaz3	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Oaz3 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of OAZ3 mRNA	CTD	PMID:21570461
Oaz3	Rat	2-butan-2-yl-4-[4-[4-[4-[[2-(2,4-dichlorophenyl)-2-(1,2,4-triazol-1-ylmethyl)-1,3-dioxolan-4-yl]methoxy]phenyl]-1-piperazinyl]phenyl]-1,2,4-triazol-3-one	decreases expression	ISO	Oaz3 (Mus musculus)	6480464	Itraconazole results in decreased expression of OAZ3 mRNA	CTD	PMID:31099283
Oaz3	Rat	acrylamide	increases expression	ISO	OAZ3 (Homo sapiens)	6480464	Acrylamide results in increased expression of OAZ3 mRNA	CTD	PMID:32763439
Oaz3	Rat	afimoxifene	increases expression	ISO	OAZ3 (Homo sapiens)	6480464	afimoxifene results in increased expression of OAZ3 mRNA	CTD	PMID:16849584
Oaz3	Rat	aflatoxin B1	increases methylation	ISO	OAZ3 (Homo sapiens)	6480464	Aflatoxin B1 results in increased methylation of OAZ3 gene	CTD	PMID:27153756
Oaz3	Rat	aristolochic acid A	increases expression	ISO	OAZ3 (Homo sapiens)	6480464	aristolochic acid I results in increased expression of OAZ3 mRNA	CTD	PMID:33212167
Oaz3	Rat	arsane	affects methylation	ISO	OAZ3 (Homo sapiens)	6480464	Arsenic affects the methylation of OAZ3 gene	CTD	PMID:25304211
Oaz3	Rat	arsenic atom	affects methylation	ISO	OAZ3 (Homo sapiens)	6480464	Arsenic affects the methylation of OAZ3 gene	CTD	PMID:25304211
Oaz3	Rat	benzo[a]pyrene	increases methylation	ISO	OAZ3 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of OAZ3 3' UTR and Benzo(a)pyrene results in increased methylation of OAZ3 promoter	CTD	PMID:27901495
Oaz3	Rat	bis(2-ethylhexyl) phthalate	decreases expression	ISO	Oaz3 (Mus musculus)	6480464	Diethylhexyl Phthalate results in decreased expression of OAZ3 mRNA	CTD	PMID:33162236
Oaz3	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of OAZ3 mRNA	CTD	PMID:25181051
Oaz3	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of OAZ3 mRNA	CTD	PMID:30816183 and PMID:32528016
Oaz3	Rat	C60 fullerene	decreases expression	EXP		6480464	fullerene C60 results in decreased expression of OAZ3 mRNA	CTD	PMID:19167457
Oaz3	Rat	chlordecone	increases expression	ISO	Oaz3 (Mus musculus)	6480464	Chlordecone results in increased expression of OAZ3 mRNA	CTD	PMID:33711761
Oaz3	Rat	chlorpyrifos	increases expression	ISO	Oaz3 (Mus musculus)	6480464	Chlorpyrifos results in increased expression of OAZ3 mRNA	CTD	PMID:37019170
Oaz3	Rat	cisplatin	decreases expression	ISO	OAZ3 (Homo sapiens)	6480464	Cisplatin results in decreased expression of OAZ3 mRNA	CTD	PMID:27392435
Oaz3	Rat	clofibrate	multiple interactions	ISO	Oaz3 (Mus musculus)	6480464	[Clofibrate co-treated with Acetaminophen] affects the expression of OAZ3 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of OAZ3 mRNA]	CTD	PMID:17585979
Oaz3	Rat	Cuprizon	decreases expression	EXP		6480464	Cuprizone results in decreased expression of OAZ3 mRNA	CTD	PMID:27523638
Oaz3	Rat	Cuprizon	increases expression	EXP		6480464	Cuprizone results in increased expression of OAZ3 mRNA	CTD	PMID:26577399
Oaz3	Rat	ethanol	affects expression	ISO	Oaz3 (Mus musculus)	6480464	Ethanol affects the expression of OAZ3 mRNA	CTD	PMID:30319688
Oaz3	Rat	furan	decreases methylation	EXP		6480464	furan results in decreased methylation of OAZ3 gene	CTD	PMID:22079235
Oaz3	Rat	genistein	decreases expression	ISO	Oaz3 (Mus musculus)	6480464	Genistein results in decreased expression of OAZ3 mRNA	CTD	PMID:32186404
Oaz3	Rat	indinavir	multiple interactions	ISO	Oaz3 (Mus musculus)	6480464	[Zidovudine co-treated with Lamivudine co-treated with Indinavir] results in increased expression of OAZ3 mRNA	CTD	PMID:16931933
Oaz3	Rat	itraconazole	decreases expression	ISO	Oaz3 (Mus musculus)	6480464	Itraconazole results in decreased expression of OAZ3 mRNA	CTD	PMID:31099283
Oaz3	Rat	lamivudine	multiple interactions	ISO	Oaz3 (Mus musculus)	6480464	[Zidovudine co-treated with Lamivudine co-treated with Indinavir] results in increased expression of OAZ3 mRNA and [Zidovudine co-treated with Lamivudine co-treated with Saquinavir] results in increased expression of OAZ3 mRNA	CTD	PMID:16931933
Oaz3	Rat	methotrexate	increases expression	ISO	OAZ3 (Homo sapiens)	6480464	Methotrexate results in increased expression of OAZ3 mRNA	CTD	PMID:24449571
Oaz3	Rat	mono(2-ethylhexyl) phthalate	decreases expression	ISO	OAZ3 (Homo sapiens)	6480464	mono-(2-ethylhexyl)phthalate results in decreased expression of OAZ3 mRNA	CTD	PMID:36695872
Oaz3	Rat	nickel atom	increases expression	ISO	OAZ3 (Homo sapiens)	6480464	Nickel results in increased expression of OAZ3 mRNA	CTD	PMID:24768652 and PMID:25583101
Oaz3	Rat	niclosamide	increases expression	ISO	OAZ3 (Homo sapiens)	6480464	Niclosamide results in increased expression of OAZ3 mRNA	CTD	PMID:36318118
Oaz3	Rat	paracetamol	affects expression	ISO	Oaz3 (Mus musculus)	6480464	Acetaminophen affects the expression of OAZ3 mRNA	CTD	PMID:17562736
Oaz3	Rat	paracetamol	multiple interactions	ISO	Oaz3 (Mus musculus)	6480464	[Clofibrate co-treated with Acetaminophen] affects the expression of OAZ3 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of OAZ3 mRNA]	CTD	PMID:17585979
Oaz3	Rat	pirinixic acid	multiple interactions	ISO	Oaz3 (Mus musculus)	6480464	[pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of OAZ3 mRNA and [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of OAZ3 mRNA	CTD	PMID:19710929
Oaz3	Rat	saquinavir	multiple interactions	ISO	Oaz3 (Mus musculus)	6480464	[Zidovudine co-treated with Lamivudine co-treated with Saquinavir] results in increased expression of OAZ3 mRNA	CTD	PMID:16931933
Oaz3	Rat	sodium arsenite	decreases expression	ISO	Oaz3 (Mus musculus)	6480464	sodium arsenite results in decreased expression of OAZ3 mRNA	CTD	PMID:36209798
Oaz3	Rat	triphenyl phosphate	affects expression	ISO	OAZ3 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of OAZ3 mRNA	CTD	PMID:37042841
Oaz3	Rat	Triptolide	increases expression	ISO	Oaz3 (Mus musculus)	6480464	triptolide results in increased expression of OAZ3 mRNA	CTD	PMID:32835833
Oaz3	Rat	triptonide	increases expression	ISO	Oaz3 (Mus musculus)	6480464	triptonide results in increased expression of OAZ3 mRNA	CTD	PMID:33045310
Oaz3	Rat	valproic acid	affects expression	ISO	Oaz3 (Mus musculus)	6480464	Valproic Acid affects the expression of OAZ3 mRNA	CTD	PMID:17963808
Oaz3	Rat	valproic acid	increases expression	EXP		6480464	Valproic Acid results in increased expression of OAZ3 mRNA	CTD	PMID:35594946
Oaz3	Rat	vinclozolin	increases expression	EXP		6480464	vinclozolin results in increased expression of OAZ3 mRNA	CTD	PMID:23034163
Oaz3	Rat	zidovudine	multiple interactions	ISO	Oaz3 (Mus musculus)	6480464	[Zidovudine co-treated with Lamivudine co-treated with Indinavir] results in increased expression of OAZ3 mRNA and [Zidovudine co-treated with Lamivudine co-treated with Saquinavir] results in increased expression of OAZ3 mRNA	CTD	PMID:16931933

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Oaz3	Rat	negative regulation of polyamine transmembrane transport	involved_in	IEA	UniProtKB:Q9R109 and ensembl:ENSMUSP00000143080	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Oaz3	Rat	negative regulation of polyamine transmembrane transport	involved_in	ISO	Oaz3 (Mus musculus)	1624291	PMID:18508777 and PMID:24967154	RGD	PMID:18508777 and PMID:24967154
Oaz3	Rat	negative regulation of stress fiber assembly		IDA		7245493		RGD
Oaz3	Rat	positive regulation of intracellular protein transport	involved_in	IEA	UniProtKB:Q9R109 and ensembl:ENSMUSP00000143080	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Oaz3	Rat	positive regulation of intracellular protein transport	involved_in	ISO	Oaz3 (Mus musculus)	1624291	PMID:19449338	RGD	PMID:19449338
Oaz3	Rat	positive regulation of protein catabolic process	involved_in	IBA	MGI:109433 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Oaz3	Rat	positive regulation of protein catabolic process	involved_in	ISO	Oaz3 (Mus musculus)	1624291	PMID:24967154	RGD	PMID:24967154
Oaz3	Rat	positive regulation of protein catabolic process	involved_in	IEA	UniProtKB:Q9R109 and ensembl:ENSMUSP00000143080	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Oaz3	Rat	viral translational frameshifting	involved_in	IEA	UniProtKB-KW:KW-0688	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Oaz3	Rat	cell projection	located_in	IEA	UniProtKB-KW:KW-0966	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Oaz3	Rat	cilium	located_in	IEA	UniProtKB-KW:KW-0969	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Oaz3	Rat	cytoplasm	is_active_in	IBA	MGI:1858170 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Oaz3	Rat	cytoplasm	located_in	ISO	Oaz3 (Mus musculus)	1624291	PMID:15642376	RGD	PMID:15642376
Oaz3	Rat	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Oaz3	Rat	cytoplasm	located_in	IEA	UniProtKB:Q9R109 and ensembl:ENSMUSP00000143080	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Oaz3	Rat	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Oaz3	Rat	motile cilium	located_in	IEA	UniProtKB-KW:KW-0282	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Oaz3	Rat	motile cilium	located_in	IEA	UniProtKB-SubCell:SL-0117	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Oaz3	Rat	nucleoplasm	located_in	IEA	UniProtKB:A8MW57 and ensembl:ENSP00000383784	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Oaz3	Rat	nucleoplasm	located_in	ISO	OAZ3 (Homo sapiens) and UniProtKB:Q9UMX2-1	1624291		RGD	GO_REF:0000052
Oaz3	Rat	nucleoplasm	located_in	IEA	UniProtKB:Q9UMX2 and ensembl:ENSP00000383784	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Oaz3	Rat	nucleus	is_active_in	IBA	MGI:1858170 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Oaz3	Rat	nucleus	located_in	ISO	Oaz3 (Mus musculus)	1624291	PMID:15642376	RGD	PMID:15642376
Oaz3	Rat	nucleus	located_in	IEA	UniProtKB:Q9R109 and ensembl:ENSMUSP00000143080	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Oaz3	Rat	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Oaz3	Rat	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Oaz3	Rat	sperm flagellum		IDA		7245493		RGD

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Oaz3	Rat	ankyrin repeat binding		IDA		7245493		RGD
Oaz3	Rat	ornithine decarboxylase inhibitor activity	enables	IEA	UniProtKB:Q9R109 and ensembl:ENSMUSP00000143080	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Oaz3	Rat	ornithine decarboxylase inhibitor activity	enables	IBA	MGI:109433 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Oaz3	Rat	ornithine decarboxylase inhibitor activity	enables	ISO	Oaz3 (Mus musculus)	1624291	MGI:97402 PMID:10781085 more ...	RGD	PMID:10781085 more ...
Oaz3	Rat	ornithine decarboxylase inhibitor activity	enables	IEA	InterPro:IPR002993	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Oaz3	Rat	ornithine decarboxylase inhibitor activity	enables	ISO	OAZ3 (Homo sapiens)	1624291	PMID:17900240	RGD	PMID:17900240
Oaz3	Rat	ornithine decarboxylase inhibitor activity	enables	IEA	UniProtKB:Q9UMX2 and ensembl:ENSP00000383784	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Oaz3	Rat	protein binding	enables	ISO	OAZ3 (Homo sapiens) and UniProtKB:Q9UMX2-2	1624291	UniProtKB:B2RXF5 more ...	RGD	PMID:32296183
Oaz3	Rat	protein binding	enables	ISO	OAZ3 (Homo sapiens)	1624291	UniProtKB:O14977 more ...	RGD	PMID:17900240 more ...
Oaz3	Rat	protein binding	enables	ISO	Oaz3 (Mus musculus)	1624291	PR:Q80WJ1 more ...	RGD	PMID:15642376 more ...

RGD Manual Annotations

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Oaz3	Rat	polyamine metabolic pathway		ISO	OAZ3 (Homo sapiens)	7244195		RGD

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Evidence of a role for antizyme and antizyme inhibitor as regulators of human cancer.	Olsen RR and Zetter BR, Mol Cancer Res. 2011 Oct;9(10):1285-93. doi: 10.1158/1541-7786.MCR-11-0178. Epub 2011 Aug 17.
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
4.	Ornithine decarboxylase antizyme Oaz3 modulates protein phosphatase activity.	Ruan Y, etal., J Biol Chem. 2011 Aug 19;286(33):29417-27. doi: 10.1074/jbc.M111.274647. Epub 2011 Jun 28.

PMID:8889548	PMID:10781085	PMID:15642376	PMID:16916800	PMID:17040916	PMID:17900240	PMID:18508777	PMID:19449338	PMID:21630459	PMID:22516433	PMID:24967154

Oaz3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	184,762,242 - 184,765,176 (-)	NCBI		GRCr8
mRatBN7.2	2	182,073,212 - 182,076,147 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	182,073,215 - 182,082,399 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	189,736,364 - 189,739,297 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	187,540,629 - 187,543,554 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	182,368,832 - 182,371,765 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	195,675,925 - 195,678,859 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	195,676,048 - 195,678,848 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	215,154,619 - 215,157,553 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	189,408,566 - 189,411,500 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	2	174,623,440 - 174,626,374 (-)	NCBI		Celera
Cytogenetic Map	2	q34	NCBI

OAZ3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	151,762,969 - 151,771,330 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	151,762,899 - 151,771,334 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	151,735,445 - 151,743,806 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	150,005,755 - 150,010,429 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	148,552,203 - 148,556,878	NCBI
Celera	1	124,850,058 - 124,858,481 (+)	NCBI		Celera
Cytogenetic Map	1	q21.3	NCBI
HuRef	1	123,112,255 - 123,120,706 (+)	NCBI		HuRef
CHM1_1	1	153,130,577 - 153,138,934 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	150,886,358 - 150,894,807 (+)	NCBI		T2T-CHM13v2.0

Oaz3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	94,340,694 - 94,343,958 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	94,339,721 - 94,351,222 (-)	Ensembl		GRCm39 Ensembl
GRCm38	3	94,433,387 - 94,436,651 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	94,432,414 - 94,443,915 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	94,237,088 - 94,240,538 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	3	94,518,794 - 94,522,020 (-)	NCBI		MGSCv36	mm8
Celera	3	95,877,993 - 95,881,443 (-)	NCBI		Celera
Cytogenetic Map	3	F2.1	NCBI
cM Map	3	40.66	NCBI

Oaz3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955589	654,088 - 658,003 (-)	NCBI	ChiLan1.0	ChiLan1.0

OAZ3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	98,052,408 - 98,060,973 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	97,803,599 - 97,812,162 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	127,121,375 - 127,129,940 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	130,765,003 - 130,773,974 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	130,765,290 - 130,773,859 (+)	Ensembl	panpan1.1		panPan2

OAZ3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	17	60,789,541 - 60,792,954 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	17	60,786,963 - 60,792,954 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	17	60,230,905 - 60,234,318 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	17	61,806,097 - 61,809,510 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	17	61,803,498 - 61,809,510 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	17	60,632,865 - 60,636,278 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	17	60,719,198 - 60,722,609 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	17	61,448,108 - 61,451,521 (+)	NCBI		UU_Cfam_GSD_1.0

Oaz3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	22,932,990 - 22,935,704 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936580	1,963,415 - 1,965,950 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936580	1,963,372 - 1,966,086 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

OAZ3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	97,439,993 - 97,448,493 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	97,439,993 - 97,448,493 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	106,463,000 - 106,471,500 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

OAZ3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	11,916,163 - 11,922,770 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666038	11,486,262 - 11,492,728 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Oaz3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624772	19,442,015 - 19,445,182 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624772	19,438,742 - 19,445,293 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Oaz3
7 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	159
Count of miRNA genes:	127
Interacting mature miRNAs:	143
Transcripts:	ENSRNOT00000028303, ENSRNOT00000075569
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578648	Bss11	Bone structure and strength QTL 11	4.7		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	2	114837527	211674221	Rat
1358356	Srcrt1	Stress Responsive Cort QTL1	3.66		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	2	161699179	222436696	Rat
1331734	Bp204	Blood pressure QTL 204	3.61192		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	168358098	223265385	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118463	226797303	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	81754530	227146641	Rat
10755499	Bp389	Blood pressure QTL 389	2.61		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	18960362	228801039	Rat
1298076	Bp166	Blood pressure QTL 166		0.0009	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	136445150	202447032	Rat
152025245	Scl81	Serum cholesterol level QTL 81	3.49		blood cholesterol amount (VT:0000180)		2	122609194	206936711	Rat
70162	Bp63	Blood pressure QTL 63	5.64		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	2	169745596	214745596	Rat
1554319	Bmd2	Bone mineral density QTL 2	13.4	0.0001	lumbar vertebra area (VT:0010570)	lumbar vertebra cross-sectional area (CMO:0001689)	2	114837675	212549332	Rat
12879836	Kidm61	Kidney mass QTL 61		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	152413072	185122374	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	78665619	219826953	Rat
10043136	Iddm54	Insulin dependent diabetes mellitus QTL 54	3.4	0.0001	blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	2	143657411	190602963	Rat
12879837	Am2	Aortic mass QTL 2		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	2	152413072	185122374	Rat
12879838	Cm86	Cardiac mass QTL 86		0.002	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	152413072	185122374	Rat
1302793	Bw16	Body weight QTL 16	5	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	2	157142209	202446871	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	43154682	202446871	Rat
12879839	Cm85	Cardiac mass QTL 85		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	2	152413072	185122374	Rat
61469	Bp16	Blood pressure QTL 16	5.64		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	2	169745596	214745596	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	2	135552573	202446871	Rat
1549833	Bp257	Blood pressure QTL 257		0.003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	168354880	185122374	Rat
1358900	Bw48	Body weight QTL 48	4.88		body mass (VT:0001259)	body weight (CMO:0000012)	2	157142078	211086598	Rat
1359030	Bp277	Blood pressure QTL 277			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	114837527	185876470	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	56043031	202447032	Rat
12879840	Bw179	Body weight QTL 179		0.005	body mass (VT:0001259)	body weight (CMO:0000012)	2	152413072	185122374	Rat
1581502	Esta3	Estrogen-induced thymic atrophy QTL 3			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	2	136916935	189599348	Rat
1359032	Hrtrt18	Heart rate QTL 18			heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	2	157142078	192625452	Rat
2301966	Bp322	Blood pressure QTL 322	3.58		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	150540301	202447032	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118275	202447032	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	81689826	221035911	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
1359022	Ppulsi1	Prepulse inhibition QTL 1	3.63		prepulse inhibition trait (VT:0003088)	acoustic startle response measurement (CMO:0001519)	2	136916935	213594495	Rat
1641891	Alcrsp17	Alcohol response QTL 17			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	249053267	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	78665619	249053267	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	76539322	202447032	Rat
2300189	Bmd48	Bone mineral density QTL 48	5.8	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	2	179335906	224335906	Rat
8662843	Vetf9	Vascular elastic tissue fragility QTL 9	2.05		thoracic aorta molecular composition trait (VT:0010568)	aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003)	2	157142078	226277316	Rat
631501	Bp101	Blood pressure QTL 101	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	150341684	202446871	Rat
2307174	Activ3	Activity QTL 3	4.83	0.000058	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	2	168594495	213594495	Rat
1331794	Bp202	Blood pressure QTL 202	3.66819		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	141194931	223265385	Rat
71113	Cari2	Carrageenan-induced inflammation QTL 2	2.7	0.009	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	2	141596551	202447032	Rat
1331805	Cm29	Cardiac mass QTL 29	3.50746		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	2	141194931	223265385	Rat
634308	Sach6	Saccharin preference QTL 6	4.9		taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	2	112456140	212696837	Rat
1598805	Memor8	Memory QTL 8	3		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	2	150341585	189039377	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
724568	Uae13	Urinary albumin excretion QTL 13	4.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	2	143157029	210020885	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1300165	Rf9	Renal function QTL 9	3.28		kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	2	133914684	202447032	Rat
61401	Niddm2	Non-insulin dependent diabetes mellitus QTL 2	4.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	144599348	189599348	Rat
631507	Bp105	Blood pressure QTL 105		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	112456140	212696837	Rat
1641925	Alcrsp2	Alcohol response QTL 2			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	221167075	Rat
1354609	Niddm62	Non-insulin dependent diabetes mellitus QTL 62	4.72	0.000006	insulin secretion trait (VT:0003564)	plasma insulin level (CMO:0000342)	2	150540301	202447032	Rat
1598833	Bp295	Blood pressure QTL 295	3.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	147798556	192798556	Rat
61417	Cia10	Collagen induced arthritis QTL 10	3.4		joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	2	179946951	224946951	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	81754530	222436696	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	46123260	202447032	Rat
631522	Bp74	Blood pressure QTL 74		0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	172710921	184114403	Rat
7488927	Bp365	Blood pressure QTL 365		0.008	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	162765032	207765032	Rat
1598838	Bp290	Blood pressure QTL 290	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	166539266	211539266	Rat
7488925	Bp364	Blood pressure QTL 364		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	160564068	205564068	Rat
2306901	Bp337	Blood pressure QTL 337		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	164073756	227146641	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	74786664	206665859	Rat
6903312	Bw112	Body weight QTL 112	3.2	0.0013	body mass (VT:0001259)	body weight (CMO:0000012)	2	143657569	184114274	Rat
1354601	Slep1	Serum leptin concentration QTL 1	5.39		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	2	43171017	184114403	Rat
2293084	Iddm26	Insulin dependent diabetes mellitus QTL 26	2.9		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	174930955	213594495	Rat

UniSTS:492264

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	182,074,803 - 182,076,160 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	195,677,516 - 195,678,872	NCBI	Rnor6.0
Rnor_5.0	2	215,156,210 - 215,157,566	UniSTS	Rnor5.0
RGSC_v3.4	2	189,410,157 - 189,411,513	UniSTS	RGSC3.4
Celera	2	174,625,031 - 174,626,387	UniSTS
Cytogenetic Map	2	q34	UniSTS

Oaz3

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	182,074,310 - 182,075,627 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	195,677,023 - 195,678,339	NCBI	Rnor6.0
Rnor_5.0	2	215,155,717 - 215,157,033	UniSTS	Rnor5.0
Celera	2	174,624,538 - 174,625,854	UniSTS
Cytogenetic Map	2	q34	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
6	10	36	107	59	57	27	22	27	4	153	78	89	35	57	30


RefSeq Transcripts	NM_001101018	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC133978	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AW529628	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ431008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000028303 ⟹ ENSRNOP00000028303

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	182,073,215 - 182,076,147 (-)	Ensembl
Rnor_6.0 Ensembl	2	195,676,048 - 195,678,848 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000075569 ⟹ ENSRNOP00000066758

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	182,075,556 - 182,076,136 (-)	Ensembl
Rnor_6.0 Ensembl	2	195,678,268 - 195,678,848 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000117338 ⟹ ENSRNOP00000088385

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	182,073,215 - 182,082,399 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000118718 ⟹ ENSRNOP00000078559

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	182,073,215 - 182,082,399 (-)	Ensembl

RefSeq Acc Id:

NM_001101018 ⟹ NP_001094488

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	184,762,242 - 184,765,176 (-)	NCBI
mRatBN7.2	2	182,073,212 - 182,076,147 (-)	NCBI
Rnor_6.0	2	195,675,925 - 195,678,859 (-)	NCBI
Rnor_5.0	2	215,154,619 - 215,157,553 (-)	NCBI
RGSC_v3.4	2	189,408,566 - 189,411,500 (-)	RGD
Celera	2	174,623,440 - 174,626,374 (-)	RGD

Sequence:

show sequence

GAACAGAGAAACTGCCTTGTACCAGGTCCCGCCCCTCTCTCTACTCCCTTTCTTATATTAAGAGGGGAAAAACACGGAACTGCCTCTACCCATTCTGGTCACCATACGCCTATTACCTCTACTGTTAC
AAATACCGGATCACCCTCCGGGAGAAGATGCTGCCTTGTTGTTACAGAAGCATCACTTACAAGGAACAGGAGGACCTGACTCTCCGGCCCCATTGCTGCCTCCCGTGCTCCTGCCTCCCGTACTCCTG
CCTCCCGTGCTCCTGAGTCCCTAGAAGGACTCCAGGTGGGTAGGAGCACTGCACAGGAAAAAGACCACAGCCAGCTTAAAGAACTCTATTCAGCTGGGAACCTGACAGTGCTATCAGCCGACCCCCTG
CTTCACCAAGACCCAGTTCAGTTAGACTTCCACTTTCGTCTTACCCCCCATTCCTCTGCTCATTGGCACGGCCTTCTGTGTGACCACCAACTCTTCCTGGATATCCCATTTCAGGCCTTGGAGCAAGG
CAACCGAGAAAGTTTGACAGCAACACTGGAGTATGTGGAGGAGAAAACCAATGTGGACTCTGTGTTTGTGAACTTCCAAAGCAATCATAAGGACAGAGGTGCCCTGCTTCGAGCCTTTAGCTACATGG
GCTTTGAGGTGGTCAGACCAGATCATCCAGCCCTCCCTCCCTGGGACAATGTCATCTTCATGGTGTATCCCCTTGAAAGGGACCTTGGCCAGCCTGGCCAGTGAGCCTCCCTAAACATGTTCTCTCTC
TGTGAGGGGTTGAAAACCTCAACACACGGGACTCTGGGGCCCAGGATGTGATTTAAGACACTTCCATCCTAGGAAATAAAGGGTAGTGCAATCAAAAAAAAAAAAAAAAA

hide sequence


Protein RefSeqs	NP_001094488	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	A1BPI0	(Get FASTA)	NCBI Sequence Viewer
	ABF59049	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000028303

RefSeq Acc Id:

NP_001094488 ⟸ NM_001101018

- UniProtKB:

F1LSS2 (UniProtKB/Swiss-Prot), A1BPI0 (UniProtKB/Swiss-Prot), A0A096P6M0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MPCTRSRPSLYSLSYIKRGKTRNCLYPFWSPYAYYLYCYKYRITLREKMLPCCYRSITYKEQEDLTLRPHCCLPCSCLPYSCLPCSESLEGLQVGRSTAQEKDHSQLKELYSAGNLTVLSADPLLHQD
PVQLDFHFRLTPHSSAHWHGLLCDHQLFLDIPFQALEQGNRESLTATLEYVEEKTNVDSVFVNFQSNHKDRGALLRAFSYMGFEVVRPDHPALPPWDNVIFMVYPLERDLGQPGQ

hide sequence

Ensembl Acc Id:

ENSRNOP00000066758 ⟸ ENSRNOT00000075569

Ensembl Acc Id:

ENSRNOP00000028303 ⟸ ENSRNOT00000028303

Ensembl Acc Id:

ENSRNOP00000078559 ⟸ ENSRNOT00000118718

Ensembl Acc Id:

ENSRNOP00000088385 ⟸ ENSRNOT00000117338

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A1BPI0-F1-model_v2	AlphaFold	A1BPI0	1-243	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13691528

Promoter ID:

EPDNEW_R2048

Type:

multiple initiation site

Name:

Oaz3_1

Description:

ornithine decarboxylase antizyme 3

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	2	195,678,880 - 195,678,940	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-52164	BioCyc
Ensembl Genes	ENSRNOG00000020863	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000028303	ENTREZGENE
Gene3D-CATH	3.40.630.60	UniProtKB/Swiss-Prot
InterPro	Acyl_CoA_acyltransferase	UniProtKB/Swiss-Prot
	ODC_AZ	UniProtKB/Swiss-Prot
	ODC_AZ_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:689588	UniProtKB/Swiss-Prot
NCBI Gene	689588	ENTREZGENE
PANTHER	PTHR10279	UniProtKB/Swiss-Prot
	PTHR10279:SF9	UniProtKB/Swiss-Prot
Pfam	ODC_AZ	UniProtKB/Swiss-Prot
PhenoGen	Oaz3	PhenoGen
PROSITE	ODC_AZ	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000020863	RatGTEx
Superfamily-SCOP	SSF55729	UniProtKB/Swiss-Prot
UniProt	A0A096P6M0	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I5ZN91_RAT	UniProtKB/TrEMBL
	A0A8I6A7R9_RAT	UniProtKB/TrEMBL
	A1BPI0	ENTREZGENE
	F1LSS2	ENTREZGENE
	M0RB36_RAT	UniProtKB/TrEMBL
	OAZ3_RAT	UniProtKB/Swiss-Prot
UniProt Secondary	F1LSS2	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2007-01-28	Oaz3	ornithine decarboxylase antizyme 3			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations