Advanced Search (OLGA)

Gene: Dtnbp1 (dystrobrevin binding protein 1) Rattus norvegicus

Analyze

Symbol:

Dtnbp1

Name:

dystrobrevin binding protein 1

RGD ID:

1590759

Description:

Involved in several processes, including negative regulation of dendritic spine morphogenesis; positive regulation of transport; and regulation of dopamine receptor signaling pathway. Located in several cellular components, including dendritic spine; neuronal cell body; and synaptic vesicle membrane. Biomarker of temporal lobe epilepsy. Human ortholog(s) of this gene implicated in Hermansky-Pudlak syndrome 7 and schizophrenia. Orthologous to human DTNBP1 (dystrobrevin binding protein 1); INTERACTS WITH 1,3-dinitrobenzene; bisphenol A; Cuprizon.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

biogenesis of lysosome-related organelles complex 1 subunit 8; BLOC-1 subunit 8; distrobrevin binding protein 1; dysbindin; dysbindin-1; dystrobrevin-binding protein 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	DTNBP1 (dystrobrevin binding protein 1)	RGD	RGD
Mus musculus (house mouse):	Dtnbp1 (dystrobrevin binding protein 1)	RGD	RGD
Chinchilla lanigera (long-tailed chinchilla):	Dtnbp1 (dystrobrevin binding protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	DTNBP1 (dystrobrevin binding protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	DTNBP1 (dystrobrevin binding protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Dtnbp1 (dystrobrevin binding protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	DTNBP1 (dystrobrevin binding protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	DTNBP1 (dystrobrevin binding protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Dtnbp1 (dystrobrevin binding protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Dtnbp1 (dystrobrevin binding protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	PEX13 (peroxisomal biogenesis factor 13)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	DTNBP1 (dystrobrevin binding protein 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Dtnbp1 (dystrobrevin binding protein 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	dtnbp1a (dystrobrevin binding protein 1a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	dtnbp1a (dystrobrevin binding protein 1a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Dysb	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Dysb	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	dtnbp1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	19,891,313 - 19,982,770 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	17	19,891,337 - 19,984,418 (+)	Ensembl				GRCr8
mRatBN7.2	17	19,685,218 - 19,776,668 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	19,685,215 - 19,776,661 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	17	19,569,853 - 19,660,683 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	21,173,678 - 21,264,514 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	19,496,978 - 19,587,817 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	20,090,136 - 20,182,332 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	20,090,246 - 20,182,206 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	17	22,105,208 - 22,193,087 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Celera	17	19,386,624 - 19,477,026 (+)	NCBI		Celera
Cytogenetic Map	17	p14	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

disease of mental health (ISO)

genetic disease (ISO)

Hermansky-Pudlak syndrome (ISO)

Hermansky-Pudlak syndrome 7 (ISO,ISS)

interstitial lung disease 2 (ISO)

platelet storage pool deficiency (ISS)

schizophrenia (ISO,ISS)

temporal lobe epilepsy (IEP,ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

1,3-dinitrobenzene (EXP)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

4,4'-sulfonyldiphenol (ISO)

antirheumatic drug (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

butanal (ISO)

cadmium dichloride (ISO)

caffeine (ISO)

chromium(6+) (ISO)

ciguatoxin CTX1B (ISO)

clozapine (ISO)

copper(II) sulfate (ISO)

coumarin (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

dibutyl phthalate (ISO)

dioxygen (ISO)

dorsomorphin (ISO)

enzyme inhibitor (ISO)

FR900359 (ISO)

glyphosate (EXP)

GSK-J4 (ISO)

haloperidol (ISO)

methyl methanesulfonate (ISO)

nitrates (ISO)

oxaliplatin (EXP)

paracetamol (ISO)

potassium chromate (ISO)

rotenone (ISO)

SB 431542 (ISO)

serpentine asbestos (ISO)

silicon dioxide (ISO)

sodium arsenate (ISO)

tamoxifen (ISO)

testosterone (ISO)

tetrachloroethene (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

topotecan (EXP)

trichostatin A (ISO)

Triptolide (EXP)

trovafloxacin (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

actin cytoskeleton organization (IEA,ISO,ISS)

anterograde axonal transport (IEA,ISO,ISS)

anterograde synaptic vesicle transport (IBA,IEA,ISO,ISS)

blood coagulation (ISO)

cilium assembly (ISO)

dendrite morphogenesis (ISO)

kidney development (ISO)

memory (ISO)

negative regulation of dendritic spine morphogenesis (IDA,IMP)

negative regulation of protein serine/threonine kinase activity (ISO)

neuron projection development (IBA,IEA,ISO,ISS)

neuron projection morphogenesis (IEA,ISO,ISS)

platelet dense granule organization (IBA,ISO)

positive regulation of gene expression (IEA,ISO,ISS)

positive regulation of glutamate neurotransmitter secretion in response to membrane depolarization (IMP)

positive regulation of neurotransmitter secretion (IEA,ISO,ISS)

positive regulation of protein phosphorylation (IMP)

positive regulation of receptor internalization (IMP)

protein transmembrane transport (ISO)

regulation of dopamine receptor signaling pathway (IDA)

regulation of dopamine secretion (IEA,ISO,ISS)

regulation of JUN kinase activity (ISO)

regulation of signal transduction (IBA)

regulation of synaptic vesicle exocytosis (IBA,IEA,ISO)

retina development in camera-type eye (IEP)

Cellular Component

axon (IDA,IEA,ISO,ISS)

axon cytoplasm (IEA)

BLOC-1 complex (IBA,IEA,ISO,ISS)

cytoplasm (IEA,ISO)

cytoplasmic vesicle (IEA)

cytoplasmic vesicle membrane (IEA)

dendritic spine (IDA,IEA,ISO,ISS)

endoplasmic reticulum (IEA)

endoplasmic reticulum membrane (IEA,ISO,ISS)

endosome membrane (IEA)

glutamatergic synapse (IEA,ISO)

growth cone (IEA,ISO,ISS)

hippocampal mossy fiber to CA3 synapse (IEA,ISO)

melanosome membrane (IEA)

microtubule cytoskeleton (IEA,ISO)

neuron projection (IBA,IEA,ISO,ISS)

neuronal cell body (IDA)

nucleus (IEA,ISO)

plasma membrane (IBA,IEA,ISO)

postsynaptic density (IEA,ISO,ISS)

presynaptic membrane (IEA)

sarcolemma (IEA,ISO)

sarcoplasm (IEA,ISO)

Schaffer collateral - CA1 synapse (IEA,ISO)

synaptic vesicle membrane (IBA,IDA,IEA,ISO,ISS)

Molecular Function

protein binding (IPI,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Nucleocytoplasmic shuttling of dysbindin-1, a schizophrenia-related protein, regulates synapsin I expression.	Fei E, etal., J Biol Chem. 2010 Dec 3;285(49):38630-40. doi: 10.1074/jbc.M110.107912. Epub 2010 Oct 4.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Evidence that the BLOC-1 protein dysbindin modulates dopamine D2 receptor internalization and signaling but not D1 internalization.	Iizuka Y, etal., J Neurosci. 2007 Nov 7;27(45):12390-5.
4.	Dysbindin-1, WAVE2 and Abi-1 form a complex that regulates dendritic spine formation.	Ito H, etal., Mol Psychiatry. 2010 Oct;15(10):976-86. doi: 10.1038/mp.2010.69. Epub 2010 Jun 8.
5.	Hermansky-Pudlak syndrome type 7 (HPS-7) results from mutant dysbindin, a member of the biogenesis of lysosome-related organelles complex 1 (BLOC-1).	Li W, etal., Nat Genet. 2003 Sep;35(1):84-9. Epub 2003 Aug 17.
6.	Developmental expression of dysbindin in Muller cells of rat retina.	Matteucci A, etal., Exp Eye Res. 2013 Nov;116:1-8. doi: 10.1016/j.exer.2013.08.006. Epub 2013 Aug 14.
7.	Evidence of novel neuronal functions of dysbindin, a susceptibility gene for schizophrenia.	Numakawa T, etal., Hum Mol Genet. 2004 Nov 1;13(21):2699-708. Epub 2004 Sep 2.
8.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
9.	Dysbindin is a potent inducer of RhoA-SRF-mediated cardiomyocyte hypertrophy.	Rangrez AY, etal., J Cell Biol. 2013 Nov 25;203(4):643-56. doi: 10.1083/jcb.201303052.
10.	GOA pipeline	RGD automated data pipeline
11.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
13.	Support for association of schizophrenia with genetic variation in the 6p22.3 gene, dysbindin, in sib-pair families with linkage and in an additional sample of triad families.	Schwab SG, etal., Am J Hum Genet 2003 Jan;72(1):185-90. Epub 2002 Dec 9.
14.	Direct interaction of Dysbindin with the AP-3 complex via its mu subunit.	Taneichi-Kuroda S, etal., Neurochem Int. 2009 Jun;54(7):431-8. doi: 10.1016/j.neuint.2009.01.014. Epub 2009 Jan 31.
15.	Upregulation of dysbindin in temporal lobe epileptic foci of human and experimental animals.	Zhang Y, etal., Synapse. 2012 Jul;66(7):622-9. doi: 10.1002/syn.21548. Epub 2012 Mar 30.

Additional References at PubMed

PMID:1936982	PMID:11316798	PMID:12477932	PMID:14688250	PMID:15102850	PMID:15489334	PMID:16288221	PMID:16448387	PMID:16980328	PMID:17182842	PMID:18504299	PMID:19094965
PMID:19546860	PMID:19887632	PMID:21998198	PMID:22203680	PMID:25297099	PMID:27927957

Genomics

Comparative Map Data

Dtnbp1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	19,891,313 - 19,982,770 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	17	19,891,337 - 19,984,418 (+)	Ensembl				GRCr8
mRatBN7.2	17	19,685,218 - 19,776,668 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	19,685,215 - 19,776,661 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	17	19,569,853 - 19,660,683 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	21,173,678 - 21,264,514 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	19,496,978 - 19,587,817 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	20,090,136 - 20,182,332 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	20,090,246 - 20,182,206 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	17	22,105,208 - 22,193,087 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Celera	17	19,386,624 - 19,477,026 (+)	NCBI		Celera
Cytogenetic Map	17	p14	NCBI

DTNBP1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	15,522,807 - 15,663,058 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	15,522,807 - 15,663,058 (-)	Ensembl			hg38	GRCh38
GRCh37	6	15,523,038 - 15,663,289 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	15,631,017 - 15,771,250 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	6	15,631,019 - 15,771,250	NCBI
Celera	6	16,760,985 - 16,901,244 (-)	NCBI		Celera
Cytogenetic Map	6	p22.3	NCBI
HuRef	6	15,470,266 - 15,609,971 (-)	NCBI		HuRef
CHM1_1	6	15,525,522 - 15,665,696 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	6	15,395,977 - 15,536,251 (-)	NCBI		T2T-CHM13v2.0

Dtnbp1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	13	45,075,552 - 45,155,614 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	13	45,075,551 - 45,155,623 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	13	44,922,079 - 45,002,096 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	13	44,922,075 - 45,002,147 (-)	Ensembl			mm10	GRCm38
MGSCv37	13	45,017,448 - 45,097,465 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	13	44,933,051 - 45,013,068 (-)	NCBI		MGSCv36	mm8
Celera	13	45,997,733 - 46,077,631 (-)	NCBI		Celera
Cytogenetic Map	13	A5	NCBI
cM Map	13	21.73	NCBI

Dtnbp1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955590	281,704 - 386,189 (+)	Ensembl
ChiLan1.0	NW_004955590	276,143 - 382,812 (+)	NCBI	ChiLan1.0	ChiLan1.0

DTNBP1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	30,187,857 - 30,334,277 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	26,176,679 - 26,319,812 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	15,377,263 - 15,523,317 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	15,741,698 - 15,887,039 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	15,741,698 - 15,887,256 (-)	Ensembl			panPan2	panpan1.1

DTNBP1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	35	14,738,025 - 14,862,609 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	35	14,738,029 - 14,864,169 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	35	14,686,008 - 14,811,763 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	35	14,835,041 - 14,960,915 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	35	14,833,870 - 14,961,018 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	35	14,660,216 - 14,785,689 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	35	14,712,028 - 14,837,283 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	35	16,038,025 - 16,163,457 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Dtnbp1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	9,804,409 - 9,943,254 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936552	1,787,687 - 1,926,516 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

DTNBP1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	11,600,795 - 11,720,318 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	7	11,602,470 - 11,720,156 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	12,191,535 - 12,309,282 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

DTNBP1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	17	56,500,523 - 56,650,925 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	17	56,500,574 - 56,651,491 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666044	15,563,141 - 15,713,959 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Dtnbp1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624756	10,810,413 - 10,942,034 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624756	10,810,368 - 10,932,801 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Dtnbp1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	14	63,913,600 - 64,105,232 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Dtnbp1
423 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	22
Count of miRNA genes:	22
Interacting mature miRNAs:	22
Transcripts:	ENSRNOT00000074600
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354581	Bp247	Blood pressure QTL 247	4.5		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	17	1	43999106	Rat
2300002	Iddm36	Insulin dependent diabetes mellitus QTL 36	1.98		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	17	9266755	40968173	Rat
2293664	Bmd28	Bone mineral density QTL 28	5.1	0.0001	femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	17	4360057	27233623	Rat
8552966	Pigfal18	Plasma insulin-like growth factor 1 level QTL 18	8.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	17	12860942	57860942	Rat
1300123	Bp194	Blood pressure QTL 194	2.82		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	2120843	42054133	Rat
1582224	Epfw4	Epididymal fat weight QTL 4	3.5	0.0058	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	17	9206505	23859062	Rat
1582225	Bw67	Body weight QTL 67	6.2	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	17	9206505	23859062	Rat
2302377	Scl61	Serum cholesterol level QTL 61	4.36		blood HDL cholesterol amount (VT:0000184)	serum high density lipoprotein cholesterol level (CMO:0000361)	17	6221998	58177198	Rat
1582226	Bw64	Body weight QTL 64	4.2	0.0017	body mass (VT:0001259)	body weight (CMO:0000012)	17	9206505	23859062	Rat
9589151	Insul30	Insulin level QTL 30	8.82	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	17	12860942	57860942	Rat
10401807	Kidm52	Kidney mass QTL 52			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	17	1	31706603	Rat
10054088	Scort28	Serum corticosterone level QTL 28	2.04	0.0102	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	17	4733534	49733534	Rat
9589057	Scfw6	Subcutaneous fat weight QTL 6	8.62	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	17	12860942	57860942	Rat
1582208	Kidm32	Kidney mass QTL 32	3.9	0.0018	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	17	9206505	23859062	Rat
9590154	Scort9	Serum corticosterone level QTL 9	23.57	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	17	12860942	57860942	Rat
9590088	Insglur7	Insulin/glucose ratio QTL 7	20.38	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	17	12860942	57860942	Rat
1549900	Iddm20	Insulin dependent diabetes mellitus QTL 20	3.7		pancreas integrity trait (VT:0010560)	percentage of study population developing diabetes mellitus during a period of time (CMO:0001114)	17	1	22181410	Rat
1331720	Rf43	Renal function QTL 43	2.881		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	17	15537025	28637951	Rat
2317053	Aia25	Adjuvant induced arthritis QTL 25	2.69		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	17	10604694	55604694	Rat
1354613	Kidm14	Kidney mass QTL 14	6.2		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	17	1	36045694	Rat
1331765	Hrtrt15	Heart rate QTL 15	4.094		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	17	15537025	60531414	Rat
7411666	Foco31	Food consumption QTL 31	11.4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	17	12860942	57860942	Rat
2324619	Coatc4	Coat color QTL 4		0.001	coat/hair pigmentation trait (VT:0010463)	pigmented dorsal coat/hair area to total dorsal coat/hair area ratio (CMO:0001811)	17	1	21499218	Rat
2303627	Vencon8	Ventilatory control QTL 8		0.001	respiration trait (VT:0001943)	tidal volume (CMO:0000222)	17	4733534	49733534	Rat
70184	BpQTLcluster14	Blood pressure QTL cluster 14	3.38		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	8574342	32199534	Rat
1582258	Bw76	Body weight QTL 76	4.6	0.0005	body mass (VT:0001259)	body weight (CMO:0000012)	17	9206505	23859062	Rat
631207	Niddm41	Non-insulin dependent diabetes mellitus QTL 41			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	17	1	38037084	Rat
1582199	Insul5	Insulin level QTL 5	3.4	0.0119	blood insulin amount (VT:0001560)	calculated serum insulin level (CMO:0000359)	17	9206505	23859062	Rat
1354662	Rf49	Renal function QTL 49	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	17	1	43999106	Rat
2293648	Bmd31	Bone mineral density QTL 31	4.5	0.0001	femur size trait (VT:1000369)	femoral neck cortical cross-sectional area (CMO:0001702)	17	4360057	27233623	Rat
1354658	Spl8	Serum phospholipid level QTL 8	3.8		blood VLDL phospholipid amount (VT:0010507)	blood very low density lipoprotein phospholipid level (CMO:0001571)	17	1	43999106	Rat
1641902	Colcr7	Colorectal carcinoma resistance QTL 7	3.35	0.0044	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	17	2120843	22087569	Rat
1582241	Bw70	Body weight QTL 70	4.6	0.0003	body mass (VT:0001259)	body weight (CMO:0000012)	17	9206505	23859062	Rat
1582245	Bw73	Body weight QTL 73	4.6	0.0004	body mass (VT:0001259)	body weight (CMO:0000012)	17	9206505	23859062	Rat
9590316	Scort21	Serum corticosterone level QTL 21	4.75	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	17	1	22877318	Rat

Markers in Region

D17Got123

Rat Assembly	Chr	Position (strand)	Source
Celera	17	19,438,366 - 19,438,535	UniSTS
RH 3.4 Map	17	238.9	RGD
RH 3.4 Map	17	238.9	UniSTS
RH 2.0 Map	17	180.6	RGD

RH129878

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	19,776,508 - 19,776,658 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	20,182,180 - 20,182,329	NCBI	Rnor6.0
Rnor_5.0	17	22,192,935 - 22,193,084	UniSTS	Rnor5.0
Celera	17	19,476,874 - 19,477,023	UniSTS
RH 3.4 Map	17	248.3	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001037664	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039096045	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039096047	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039096048	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039096049	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063276720	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063276721	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063276723	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AY623025	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY623026	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC088267	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473977	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000017	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000074600 ⟹ ENSRNOP00000067149

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	17	19,907,262 - 19,982,778 (+)	Ensembl
mRatBN7.2 Ensembl	17	19,685,319 - 19,776,649 (+)	Ensembl
Rnor_6.0 Ensembl	17	20,090,246 - 20,182,206 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000102493 ⟹ ENSRNOP00000091788

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	17	19,891,340 - 19,982,767 (+)	Ensembl
mRatBN7.2 Ensembl	17	19,685,218 - 19,776,658 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000111857 ⟹ ENSRNOP00000082433

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	17	19,892,762 - 19,982,767 (+)	Ensembl
mRatBN7.2 Ensembl	17	19,686,545 - 19,776,661 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000115732 ⟹ ENSRNOP00000081366

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	17	19,891,337 - 19,938,783 (+)	Ensembl
mRatBN7.2 Ensembl	17	19,685,215 - 19,732,665 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000145594 ⟹ ENSRNOP00000099408

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	17	19,891,345 - 19,984,418 (+)	Ensembl

RefSeq Acc Id:

NM_001037664 ⟹ NP_001032753

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	19,891,337 - 19,982,770 (+)	NCBI
mRatBN7.2	17	19,685,218 - 19,776,661 (+)	NCBI
Rnor_6.0	17	20,090,136 - 20,182,332 (+)	NCBI
Rnor_5.0	17	22,105,208 - 22,193,087 (+)	NCBI
Celera	17	19,386,624 - 19,477,026 (+)	RGD

Sequence:

show sequence

GACGCGGAAGGCTCGGCGGCTGCGGCGTGAAGCGAGAACGGGCGTGCGGGGCGGGGGCGCCCGA
CGGCGTCCGAGGGCGCGGCGGAGCGAGGCCTGAGGGAGGGGACGCGATGCTGGAGACCCTGCGC
GAGCGGCTGCTGAGCGTGCAGCAGGATTTCACCTCCGGGCTAAAGACGTTAAGCGACAAGTCAA
AAGAAGCAAAAGTAAAAAGCAGACCCAGGACTGCTCCCTACTTACCAAAGTACTCTGCTGGACT
GGACTTACTTAGCAGGTATGAGGATACGTGGGCTGCACTTCACAGAAGAGCCAAGGAATGTGCA
GACGCTGGCGAGCTGGTGGACAGCGAGGTGGTCATGCTGTCTGCCCACTGGGAGAAGAAGAGGA
CCAGCCTGGCCGAGCTGCAGGAGCAGCTGCAGCAGCTGCCAGCTCTCCTCCAGGACGTGGAGTC
CTTGATGGCAAGCCTGGCTCATTTAGAGACGAGTTTTGAAGAGGTAGAAAACCATCTGTTGCAT
CTGGAGGACTTGTGTGGGCAGTGTGAGTTAGAAAGACATAAACAGGCCCATGCCCGACACCTGG
AGGATTACAAGAAAAGTAAGAGGAAGGAGCTTGAAGCCTTCAAAGCTGAACTCGATACAGAACA
CGCACAGAAGATCCTGGAAATGGAGCACACCCAGCAGCTGAAGCTGAAGGAGCGGCAGAAGTTC
TTCGAGGAGGCTTTCCAGCAGGACATGGAGCAATACCTGTCCACAGGTCACCTGCAGATTGCAG
AGAGGCGAGAGCCCATGGGCAGCATGTCCTCCATGGAAGTGAATGTGGACGTGCTGGAGCAGAT
GGACCTGATGGACCTCTCTGACCAGGAGGCGCTCGATGTCTTCTTGAACTCTGGCGGAGAGGAC
AATACTGTGATATCCCCTGGTTTGGAGATGGAATCCAACCCCAGTCAGAATGAAATGAATCTTC
AGATTCCAAATCCCTCAGAATCAGCGTCCCAGCCACCTGCCTCACCCTCTGCCTGCACTGACCT
GGACACTGCTGATGCTCCCCTCATCCAGGCTGATGAAGAGGAGGTACAAGTGGACACGGCCTTG
GTCACATTAAACACTGACAGAAAGTCCACCCCAGGTGTCAGTGATGACAGTGACCAGTGTGACT
CAACTCAGGACATTTAAGTGACTTCTCAGCTGTAGGCAGAATCTTCCTACAAAGCCAGGTGCTT
GGGTTTTTTGGTTTTACACAATTGCTAATGAGATGTGAGAACTGTTAGAGAAGTGGTCACAATA
AAGCTATGGACTAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039096045 ⟹ XP_038951973

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	19,891,509 - 19,982,770 (+)	NCBI
mRatBN7.2	17	19,685,483 - 19,776,668 (+)	NCBI

RefSeq Acc Id:

XM_039096047 ⟹ XP_038951975

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	19,940,453 - 19,982,770 (+)	NCBI
mRatBN7.2	17	19,738,267 - 19,776,668 (+)	NCBI

RefSeq Acc Id:

XM_039096048 ⟹ XP_038951976

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	19,911,339 - 19,982,770 (+)	NCBI
mRatBN7.2	17	19,705,220 - 19,776,668 (+)	NCBI

RefSeq Acc Id:

XM_039096049 ⟹ XP_038951977

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	19,941,209 - 19,982,770 (+)	NCBI
mRatBN7.2	17	19,738,301 - 19,776,666 (+)	NCBI

RefSeq Acc Id:

XM_063276720 ⟹ XP_063132790

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	19,891,313 - 19,982,770 (+)	NCBI

RefSeq Acc Id:

XM_063276721 ⟹ XP_063132791

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	19,906,197 - 19,982,770 (+)	NCBI

RefSeq Acc Id:

XM_063276723 ⟹ XP_063132793

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	19,906,202 - 19,982,770 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001032753	(Get FASTA)	NCBI Sequence Viewer
	XP_038951973	(Get FASTA)	NCBI Sequence Viewer
	XP_038951975	(Get FASTA)	NCBI Sequence Viewer
	XP_038951976	(Get FASTA)	NCBI Sequence Viewer
	XP_038951977	(Get FASTA)	NCBI Sequence Viewer
	XP_063132790	(Get FASTA)	NCBI Sequence Viewer
	XP_063132791	(Get FASTA)	NCBI Sequence Viewer
	XP_063132793	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH88267	(Get FASTA)	NCBI Sequence Viewer
	AAT46042	(Get FASTA)	NCBI Sequence Viewer
	AAT46043	(Get FASTA)	NCBI Sequence Viewer
	EDL98175	(Get FASTA)	NCBI Sequence Viewer
	EDL98176	(Get FASTA)	NCBI Sequence Viewer
	EDL98177	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000091788
	ENSRNOP00000091788.1
	ENSRNOP00000099408
GenBank Protein	Q5M834	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001032753 ⟸ NM_001037664

- UniProtKB:

Q6GX90 (UniProtKB/Swiss-Prot), Q5M834 (UniProtKB/Swiss-Prot), A6J725 (UniProtKB/TrEMBL), M0RC42 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MLETLRERLLSVQQDFTSGLKTLSDKSKEAKVKSRPRTAPYLPKYSAGLDLLSRYEDTWAALHR
RAKECADAGELVDSEVVMLSAHWEKKRTSLAELQEQLQQLPALLQDVESLMASLAHLETSFEEV
ENHLLHLEDLCGQCELERHKQAHARHLEDYKKSKRKELEAFKAELDTEHAQKILEMEHTQQLKL
KERQKFFEEAFQQDMEQYLSTGHLQIAERREPMGSMSSMEVNVDVLEQMDLMDLSDQEALDVFL
NSGGEDNTVISPGLEMESNPSQNEMNLQIPNPSESASQPPASPSACTDLDTADAPLIQADEEEV
QVDTALVTLNTDRKSTPGVSDDSDQCDSTQDI

hide sequence

Ensembl Acc Id:

ENSRNOP00000067149 ⟸ ENSRNOT00000074600

RefSeq Acc Id:	XP_038951973 ⟸ XM_039096045
- Peptide Label:	isoform X2
- UniProtKB:	A0A8I6G7E8 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038951976 ⟸ XM_039096048
- Peptide Label:	isoform X5
- UniProtKB:	A6J726 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038951975 ⟸ XM_039096047
- Peptide Label:	isoform X4

RefSeq Acc Id:	XP_038951977 ⟸ XM_039096049
- Peptide Label:	isoform X6
- UniProtKB:	A6J727 (UniProtKB/TrEMBL), A6J726 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000091788 ⟸ ENSRNOT00000102493

Ensembl Acc Id:

ENSRNOP00000081366 ⟸ ENSRNOT00000115732

Ensembl Acc Id:

ENSRNOP00000082433 ⟸ ENSRNOT00000111857

RefSeq Acc Id:	XP_063132790 ⟸ XM_063276720
- Peptide Label:	isoform X1
- UniProtKB:	M0RC42 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063132791 ⟸ XM_063276721
- Peptide Label:	isoform X2
- UniProtKB:	A0A8I6G7E8 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063132793 ⟸ XM_063276723
- Peptide Label:	isoform X3
- UniProtKB:	A0A8I6G7E8 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000099408 ⟸ ENSRNOT00000145594

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5M834-F1-model_v2	AlphaFold	Q5M834	1-352	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13700375

Promoter ID:

EPDNEW_R10896

Type:

single initiation site

Name:

Dtnbp1_1

Description:

Dysbindin

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	17	20,090,281 - 20,090,341	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1590759	AgrOrtholog
BioCyc Gene	G2FUF-9848	BioCyc
Ensembl Genes	ENSRNOG00000048719	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000102493	ENTREZGENE
	ENSRNOT00000102493.1	UniProtKB/Swiss-Prot
	ENSRNOT00000145594	ENTREZGENE
IMAGE_CLONE	IMAGE:7379090	IMAGE-MGC_LOAD
InterPro	Dysbindin	UniProtKB/Swiss-Prot
KEGG Report	rno:641528	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:109105	IMAGE-MGC_LOAD
NCBI Gene	641528	ENTREZGENE
PANTHER	DYSBINDIN	UniProtKB/Swiss-Prot
	PTHR16294	UniProtKB/Swiss-Prot
Pfam	Dysbindin	UniProtKB/Swiss-Prot
PhenoGen	Dtnbp1	PhenoGen
RatGTEx	ENSRNOG00000048719	RatGTEx
UniProt	A0A8I5ZUW2_RAT	UniProtKB/TrEMBL
	A0A8I6G7E8	ENTREZGENE, UniProtKB/TrEMBL
	A6J725	ENTREZGENE, UniProtKB/TrEMBL
	A6J726	ENTREZGENE, UniProtKB/TrEMBL
	A6J727	ENTREZGENE, UniProtKB/TrEMBL
	DTBP1_RAT	UniProtKB/Swiss-Prot
	M0RC42	ENTREZGENE, UniProtKB/TrEMBL
	Q5M834	ENTREZGENE
	Q6GX90	ENTREZGENE
UniProt Secondary	Q6GX90	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-03-20	Dtnbp1	dystrobrevin binding protein 1	Dtnbp1	distrobrevin binding protein 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-20	Dtnbp1	distrobrevin binding protein 1			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM