Advanced Search (OLGA)

Gene: Gmps (guanine monophosphate synthase) Rattus norvegicus

Analyze

Symbol:

Gmps

Name:

guanine monophosphate synthase

RGD ID:

1310063

Description:

Enables GMP synthase activity and enzyme binding activity. Involved in GMP biosynthetic process; response to L-cysteine; and response to xenobiotic stimulus. Acts upstream of or within GMP salvage. Predicted to be located in cytoplasm. Predicted to be active in cytosol. Biomarker of hepatocellular carcinoma. Human ortholog(s) of this gene implicated in acute myelomonocytic leukemia. Orthologous to human GMPS (guanine monophosphate synthase); PARTICIPATES IN 2-hydroxyglutaric aciduria pathway; adenine phoshoribosyltransferase deficiency pathway; adenosine monophosphate deaminase deficiency pathway; INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

glutamine amidotransferase; GMP synthase; GMP synthase [glutamine-hydrolyzing]; GMP synthetase; guanine monophosphate synthetase; LOC295088

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GMPS (guanine monophosphate synthase)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, Panther
Mus musculus (house mouse):	Gmps (guanine monophosphate synthetase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Gmps (guanine monophosphate synthase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GMPS (guanine monophosphate synthase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GMPS (guanine monophosphate synthase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Gmps (guanine monophosphate synthase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GMPS (guanine monophosphate synthase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GMPS (guanine monophosphate synthase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Gmps (guanine monophosphate synthase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Gmps (guanine monophosphate synthase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	GMPS (guanine monophosphate synthase)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Gmps (guanine monophosphate synthetase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gmps (guanine monophosphate synthase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	GUA1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	GUA1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	bur	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	gmps-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	gmps	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	150,587,824 - 150,641,564 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	150,587,854 - 150,648,986 (+)	Ensembl				GRCr8
mRatBN7.2	2	148,441,369 - 148,491,908 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	148,435,643 - 148,485,875 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	155,179,955 - 155,214,681 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	153,229,417 - 153,264,155 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	147,862,091 - 147,896,832 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	154,555,967 - 154,590,662 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	154,555,871 - 154,590,662 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	173,939,844 - 173,974,539 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	153,804,512 - 153,840,009 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	142,726,833 - 142,761,299 (+)	NCBI		Celera
RGSC_v3.1	2	153,754,474 - 153,789,970 (+)	NCBI
Cytogenetic Map	2	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

acute myelomonocytic leukemia (ISO)

Experimental Diabetes Mellitus (IEP)

hepatocellular carcinoma (IEP)

Neoplasms, Second Primary (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

1,2-dichloroethane (ISO)

1-chloro-2,4-dinitrobenzene (ISO)

17beta-estradiol (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,4'-trichlorobiphenyl (ISO)

2,6-dinitrotoluene (EXP)

4,4'-sulfonyldiphenol (ISO)

all-trans-retinoic acid (ISO)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

Aroclor 1254 (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

beta-naphthoflavone (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

Brodifacoum (EXP)

cadmium dichloride (ISO)

caffeine (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chlorpyrifos (ISO)

chromium(6+) (ISO)

cisplatin (ISO)

copper atom (ISO)

copper(0) (ISO)

coumarin (ISO)

coumestrol (ISO)

diarsenic trioxide (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (ISO)

diethylstilbestrol (ISO)

dimethyl sulfoxide (ISO)

disodium selenite (ISO)

Enterolactone (ISO)

enzyme inhibitor (ISO)

fenvalerate (EXP)

flutamide (EXP)

folic acid (ISO)

FR900359 (ISO)

gentamycin (EXP)

gold atom (ISO)

gold(0) (ISO)

ivermectin (ISO)

lovastatin (ISO)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

nefazodone (EXP)

nimesulide (EXP)

oxaliplatin (EXP)

PCB138 (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

phenobarbital (ISO)

poly(propylene imine) macromolecule (ISO)

sodium arsenite (ISO)

Soman (EXP)

succimer (ISO)

tetrachloromethane (EXP,ISO)

titanium dioxide (ISO)

topotecan (EXP)

trimellitic anhydride (ISO)

triphenyl phosphate (ISO)

troglitazone (ISO)

tunicamycin (ISO)

valproic acid (ISO)

vinclozolin (EXP)

warfarin (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

GMP biosynthetic process (IBA,IDA,IEA,ISO)

GMP metabolic process (IEA)

GMP salvage (IDA)

purine nucleotide biosynthetic process (IEA)

response to L-cysteine (IDA)

response to xenobiotic stimulus (IEP)

Cellular Component

cytosol (IBA,IEA,ISO)

Molecular Function

ATP binding (IEA)

carbon-nitrogen ligase activity, with glutamine as amido-N-donor (IEA)

enzyme binding (IDA)

GMP synthase (glutamine-hydrolyzing) activity (IDA,IEA,ISO)

GMP synthase activity (IBA,IDA,IEA,ISO)

ligase activity (IEA)

nucleotide binding (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

2-hydroxyglutaric aciduria pathway (ISO)

adenine phoshoribosyltransferase deficiency pathway (ISO)

adenosine monophosphate deaminase deficiency pathway (ISO)

adenylosuccinate lyase deficiency pathway (ISO)

AICA-ribosuria pathway (ISO)

azathioprine pharmacodynamics pathway (ISO)

de novo purine biosynthetic pathway (ISO)

glutamic acid/glutamate metabolic pathway (ISO)

homocarnosinosis pathway (ISO)

Kelley-Seegmiller syndrome pathway (ISO)

Lesch-Nyhan syndrome pathway (ISO)

mercaptopurine pharmacodynamics pathway (ISO)

mercaptopurine pharmacokinetics pathway (ISO)

molybdenum cofactor deficiency pathway (ISO)

purine metabolic pathway (IEA,ISO)

purine nucleoside phosphorylase deficiency pathway (ISO)

succinic semialdehyde dehydrogenase deficiency pathway (ISO)

tioguanine pharmacodynamics pathway (ISO)

xanthinuria type I pathway (ISO)

xanthinuria pathway (ISO)

xanthinuria type II pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Pediatric neurological syndromes and inborn errors of purine metabolism.	Camici M, etal., Neurochem Int. 2010 Feb;56(3):367-78. Epub 2009 Dec 11.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Purification and characterization of GMP synthetase from Yoshida sarcoma ascites cells.	Hirai K, etal., J Biochem (Tokyo). 1987 Oct;102(4):893-902.
5.	Oncolytic activity and mechanism of action of a novel L-cysteine derivative, L-cysteine, ethyl ester, S-(N-methylcarbamate) monohydrochloride.	Jayaram HN, etal., Cancer Chemother Pharmacol. 1990;26(2):88-92.
6.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
7.	t(3;11) translocation in treatment-related acute myeloid leukemia fuses MLL with the GMPS (GUANOSINE 5' MONOPHOSPHATE SYNTHETASE) gene.	Pegram LD, etal., Blood. 2000 Dec 15;96(13):4360-2.
8.	Insulin regulatory effects on purine- and pyrimidine metabolism in alloxan diabetic rat liver.	Pillwein K, etal., Padiatr Padol. 1988;23(2):135-44.
9.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
10.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
11.	Enzymic programs of rat bone marrow and the impact of acivicin and tiazofurin.	Prajda N, etal., Biochem Pharmacol. 1988 Mar 1;37(5):875-80.
12.	GOA pipeline	RGD automated data pipeline
13.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
14.	Enzymes of purine metabolism in cancer.	Weber G Clin Biochem. 1983 Feb;16(1):57-63.
15.	Characterization of purine nucleotide metabolism in primary rat muscle cultures.	Zoref-Shani E, etal., Biochim Biophys Acta. 1982 Jun 16;716(3):324-30. doi: 10.1016/0304-4165(82)90023-x.

Additional References at PubMed

PMID:7706277	PMID:8081953	PMID:8089153	PMID:12477932	PMID:31505169

Genomics

Comparative Map Data

Gmps
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	150,587,824 - 150,641,564 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	150,587,854 - 150,648,986 (+)	Ensembl				GRCr8
mRatBN7.2	2	148,441,369 - 148,491,908 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	148,435,643 - 148,485,875 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	155,179,955 - 155,214,681 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	153,229,417 - 153,264,155 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	147,862,091 - 147,896,832 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	154,555,967 - 154,590,662 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	154,555,871 - 154,590,662 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	173,939,844 - 173,974,539 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	153,804,512 - 153,840,009 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	142,726,833 - 142,761,299 (+)	NCBI		Celera
RGSC_v3.1	2	153,754,474 - 153,789,970 (+)	NCBI
Cytogenetic Map	2	q31	NCBI

GMPS
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	155,869,430 - 155,944,020 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	155,870,591 - 155,944,020 (+)	Ensembl			hg38	GRCh38
GRCh37	3	155,588,439 - 155,661,809 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	157,071,019 - 157,138,215 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	3	157,071,026 - 157,138,223	NCBI
Celera	3	154,009,947 - 154,077,188 (+)	NCBI		Celera
Cytogenetic Map	3	q25.31	NCBI
HuRef	3	152,982,759 - 153,049,917 (+)	NCBI		HuRef
CHM1_1	3	155,551,614 - 155,618,831 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	3	158,644,070 - 158,718,668 (+)	NCBI		T2T-CHM13v2.0

Gmps
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	63,871,054 - 63,928,975 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	63,883,527 - 63,930,000 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	3	63,963,633 - 64,021,554 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	63,976,106 - 64,022,579 (+)	Ensembl			mm10	GRCm38
MGSCv37	3	63,780,065 - 63,823,000 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	3	64,064,072 - 64,107,007 (+)	NCBI		MGSCv36	mm8
Celera	3	63,647,946 - 63,691,053 (+)	NCBI		Celera
Cytogenetic Map	3	E1	NCBI
cM Map	3	30.08	NCBI

Gmps
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955448	6,932,926 - 6,984,662 (+)	Ensembl
ChiLan1.0	NW_004955448	6,931,891 - 6,984,662 (+)	NCBI	ChiLan1.0	ChiLan1.0

GMPS
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	153,783,747 - 153,852,239 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	153,788,477 - 153,862,949 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	152,925,905 - 152,999,180 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	160,977,222 - 161,045,214 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	160,977,222 - 161,045,214 (+)	Ensembl			panPan2	panpan1.1

GMPS
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	23	49,569,571 - 49,645,999 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	23	49,569,531 - 49,699,199 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	23	49,445,713 - 49,522,068 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	23	50,203,908 - 50,286,767 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	23	50,203,868 - 50,333,624 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	23	49,789,609 - 49,866,167 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	23	49,838,479 - 49,915,927 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	23	50,126,162 - 50,202,992 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Gmps
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	86,587,606 - 86,639,212 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936519	3,104,701 - 3,141,549 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936519	3,094,763 - 3,143,322 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GMPS
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	95,738,659 - 95,819,759 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	13	95,742,342 - 95,820,903 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	103,766,547 - 103,819,693 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GMPS
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	15	34,817,603 - 34,885,363 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	15	34,815,066 - 34,885,228 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666041	7,450,006 - 7,520,263 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gmps
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624730	33,460,566 - 33,535,593 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624730	33,459,059 - 33,535,593 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Gmps
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	3	91,228,592 - 91,273,502 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Gmps
362 total Variants

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2293671	Bss44	Bone structure and strength QTL 44	10.97	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	2	105628029	150628029	Rat
631566	Bp90	Blood pressure QTL 90		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	149957381	221199885	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	44537979	205135428	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	67845370	229470703	Rat
1358360	Sradr2	Stress Responsive Adrenal Weight QTL 2	10.24		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	2	124103798	154505346	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	83465462	229820014	Rat
10755499	Bp389	Blood pressure QTL 389	2.61		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	20695736	231474293	Rat
1298076	Bp166	Blood pressure QTL 166		0.0009	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	138595962	205135428	Rat
1581576	Pur7	Proteinuria QTL 7		0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	2	80396178	220931218	Rat
152025245	Scl81	Serum cholesterol level QTL 81	3.49		blood cholesterol amount (VT:0000180)		2	124537199	209621565	Rat
1581578	Cm49	Cardiac mass QTL 49	4.9	0.01	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	145807215	220931416	Rat
631198	Cm22	Cardiac mass QTL 22	4.3	0.0008	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	78269809	208420281	Rat
1554319	Bmd2	Bone mineral density QTL 2	13.4	0.0001	lumbar vertebra area (VT:0010570)	lumbar vertebra cross-sectional area (CMO:0001689)	2	122597372	215234002	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	80396178	220931218	Rat
10043136	Iddm54	Insulin dependent diabetes mellitus QTL 54	3.4	0.0001	blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	2	145807215	190807215	Rat
10043139	Iddm55	Insulin dependent diabetes mellitus QTL 55	3.1	0.0001	blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	2	150313808	195313808	Rat
1358901	Cm38	Cardiac mass QTL 38	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	159440891	Rat
1359030	Bp277	Blood pressure QTL 277			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	143565208	188565208	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	4265106	205135428	Rat
1581502	Esta3	Estrogen-induced thymic atrophy QTL 3			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	2	139067258	192287892	Rat
1358899	Kidm23	Kidney mass QTL 23	3.88		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
1358908	Bw49	Body weight QTL 49	3.36		body mass (VT:0001259)	body weight (CMO:0000012)	2	27148557	159440760	Rat
1582257	Gluco21	Glucose level QTL 21	3.1	0.0035	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	120039407	159440891	Rat
1358910	Kidm27	Kidney mass QTL 27	5.77		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
1358911	Kidm28	Kidney mass QTL 28	5.42		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
1358904	Cm39	Cardiac mass QTL 39	2.26		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	159440891	Rat
2301966	Bp322	Blood pressure QTL 322	3.58		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	144882354	205135428	Rat
8662836	Vetf8	Vascular elastic tissue fragility QTL 8	0.66		thoracic aorta molecular composition trait (VT:0010568)	aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003)	2	106869825	151869825	Rat
1358887	Bw50	Body weight QTL 50	2.39		body mass (VT:0001259)	body weight (CMO:0000012)	2	27148557	159440760	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	67845182	205135428	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	83400752	223709938	Rat
5135226	Leukc2	Leukocyte quantity QTL 2			eosinophil quantity (VT:0002602)	blood eosinophil count (CMO:0000033)	2	120039407	151869825	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	44537979	205135428	Rat
1358894	Kidm24	Kidney mass QTL 24	4.03		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
1359022	Ppulsi1	Prepulse inhibition QTL 1	3.63		prepulse inhibition trait (VT:0003088)	acoustic startle response measurement (CMO:0001519)	2	139067258	184067258	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	80396034	220931416	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	78269809	205135428	Rat
1331794	Bp202	Blood pressure QTL 202	3.66819		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	143344967	251712708	Rat
71113	Cari2	Carrageenan-induced inflammation QTL 2	2.7	0.009	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	2	143746578	205135428	Rat
1331805	Cm29	Cardiac mass QTL 29	3.50746		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	2	143344967	251712708	Rat
634308	Sach6	Saccharin preference QTL 6	4.9		taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	2	114384617	215381366	Rat
1598805	Memor8	Memory QTL 8	3		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	2	150096616	195096616	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
724568	Uae13	Urinary albumin excretion QTL 13	4.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	2	145306936	212705578	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
1300165	Rf9	Renal function QTL 9	3.28		kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	2	113746222	205135428	Rat
61401	Niddm2	Non-insulin dependent diabetes mellitus QTL 2	4.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	147287892	192287892	Rat
631507	Bp105	Blood pressure QTL 105		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	114384617	215381366	Rat
738007	Anxrr7	Anxiety related response QTL 7	4.4		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	2	120339555	165339555	Rat
1354609	Niddm62	Non-insulin dependent diabetes mellitus QTL 62	4.72	0.000006	insulin secretion trait (VT:0003564)	plasma insulin level (CMO:0000342)	2	117415288	205135428	Rat
2293835	Kiddil5	Kidney dilation QTL 5	3.8		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	44537979	159440891	Rat
631520	Bp73	Blood pressure QTL 73		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	149806826	170653323	Rat
1598833	Bp295	Blood pressure QTL 295	3.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	150096616	195096616	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	83465462	225110681	Rat
1558653	Prcr1	Prostate cancer resistance QTL 1	5		prostate integrity trait (VT:0010571)	area of ventral prostate occupied by tumorous lesions to total ventral prostate area ratio (CMO:0000899)	2	114440891	159440891	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	47856345	205135428	Rat
2293843	Kiddil6	Kidney dilation QTL 6	3.1		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	44537979	184731399	Rat
1354594	Despr10	Despair related QTL 10		2e-06	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	2	116804572	161804572	Rat
152025206	Hrtrt23	Heart rate QTL 23	5.98		heart pumping trait (VT:2000009)		2	30219200	171802126	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	76328396	209350714	Rat
6903312	Bw112	Body weight QTL 112	3.2	0.0013	body mass (VT:0001259)	body weight (CMO:0000012)	2	145807215	173074435	Rat
152025204	Hrtrt22	Heart rate QTL 22	5.6		heart pumping trait (VT:2000009)		2	30219200	171802126	Rat

Markers in Region

D2Rat181

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	2	150,627,832 - 150,628,029 (+)	Marker Load Pipeline
mRatBN7.2	2	148,478,176 - 148,478,373 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	154,582,964 - 154,583,160	NCBI	Rnor6.0
Rnor_5.0	2	173,966,841 - 173,967,037	UniSTS	Rnor5.0
RGSC_v3.4	2	153,832,311 - 153,832,507	UniSTS	RGSC3.4
RGSC_v3.4	2	153,832,310 - 153,832,507	RGD	RGSC3.4
Celera	2	142,753,601 - 142,753,797	UniSTS
RGSC_v3.1	2	153,782,274 - 153,782,470	RGD
RH 3.4 Map	2	941.0	RGD
RH 3.4 Map	2	941.0	UniSTS
RH 2.0 Map	2	696.8	RGD
SHRSP x BN Map	2	60.5598	RGD
Cytogenetic Map	2	q31	UniSTS

BE108044

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	148,479,491 - 148,479,656 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	154,584,279 - 154,584,443	NCBI	Rnor6.0
Rnor_5.0	2	173,968,156 - 173,968,320	UniSTS	Rnor5.0
RGSC_v3.4	2	153,833,626 - 153,833,790	UniSTS	RGSC3.4
Celera	2	142,754,916 - 142,755,080	UniSTS
RH 3.4 Map	2	947.4	UniSTS
Cytogenetic Map	2	q31	UniSTS

RH135286

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	148,478,935 - 148,479,122 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	154,583,723 - 154,583,909	NCBI	Rnor6.0
Rnor_5.0	2	173,967,600 - 173,967,786	UniSTS	Rnor5.0
RGSC_v3.4	2	153,833,070 - 153,833,256	UniSTS	RGSC3.4
Celera	2	142,754,360 - 142,754,546	UniSTS
RH 3.4 Map	2	936.0	UniSTS
Cytogenetic Map	2	q31	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001024754	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102016	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102017	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063281587	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC098016	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230925	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000076292 ⟹ ENSRNOP00000068021

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	150,600,450 - 150,648,986 (+)	Ensembl
mRatBN7.2 Ensembl	2	148,450,915 - 148,485,873 (+)	Ensembl
Rnor_6.0 Ensembl	2	154,555,871 - 154,576,770 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000076880 ⟹ ENSRNOP00000068212

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	150,587,854 - 150,648,722 (+)	Ensembl
mRatBN7.2 Ensembl	2	148,435,643 - 148,485,875 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000076976 ⟹ ENSRNOP00000068164

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	2	154,580,558 - 154,590,662 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000084238 ⟹ ENSRNOP00000072183

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	150,604,040 - 150,635,526 (+)	Ensembl
mRatBN7.2 Ensembl	2	148,454,384 - 148,485,875 (+)	Ensembl
Rnor_6.0 Ensembl	2	154,556,029 - 154,590,643 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000144456 ⟹ ENSRNOP00000101354

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	150,600,756 - 150,636,896 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000167462 ⟹ ENSRNOP00000109550

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	150,600,800 - 150,635,525 (+)	Ensembl

RefSeq Acc Id:

NM_001024754 ⟹ NP_001019925

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	150,600,829 - 150,635,531 (+)	NCBI
mRatBN7.2	2	148,451,173 - 148,485,875 (+)	NCBI
Rnor_6.0	2	154,555,967 - 154,590,662 (+)	NCBI
Rnor_5.0	2	173,939,844 - 173,974,539 (+)	NCBI
RGSC_v3.4	2	153,804,512 - 153,840,009 (+)	RGD
Celera	2	142,726,833 - 142,761,299 (+)	RGD

Sequence:

show sequence

CGGTGCTGTGCTGCTCGCGTCCAGGCCTTGCCAGCGGTCTGCGCCCGCCGCGCTGGTCCCCGAT
GGCCCTGTGCAACGGAGATTCCAAGCCGGAGAATGCTGGAGGAGACCTTAAGGATGGTTGTCAC
CACTACGAAGGAGCTGTTGTCATTCTGGATGCTGGGGCTCAGTATGGAAAAGTCATTGACCGAA
GAGTGCGGGAGCTCTTTGTACAGTCTGAAATCTTTCCTTTGGAAACACCAGCTTTTGCCATAAA
GGAACAAGGATTTCGGGCTATTATCATATCTGGAGGACCTAATTCTGTGTATGCAGAGGATGCT
CCCTGGTTTGATCCAGCAATATTTACCATTGGCAAGCCTGTCCTAGGAATTTGCTATGGAATGC
AGATGATGAATAAGGTTTTTGGAGGCACTGTGCATAAAAAAAGTGTTAGAGAGGATGGCGTTTT
CAACATTAGTATGGACAATACATGTTCATTGTTCAGGGGCCTGCAGAAGGAAGAAATTGTTTTA
CTTACACATGGAGACAGTGTAGACAAAGTAGCTGATGGATTCAAGGTTGTAGCTCGTTCTGGGA
ACATTGTTGCAGGTATAGCCAATGAATCTAAGAAGCTATATGGTGTACAGTTCCACCCTGAAGT
TGGCCTTACAGAAAATGGAAAAGTAATACTGAAGAATTTCCTATATGATATAGCTGGATGCAGT
GGGAACTTTACTGTGCAGAACCGAGAACTTGAGTGCATTCGAGAGATTAAAGAGAAAGTAGGAA
CGTCAAAAGTGTTGGTTTTACTCAGTGGTGGTGTAGATTCAACTGTTTGTACTGCTTTGCTAAA
TCGTGCTTTGAACCAAGATCAAGTCATTGCTGTACACATTGATAATGGCTTTATGAGAAAACGA
GAAAGCCAGTCTGTTGAAGAGGCCCTCAAAAAGCTTGGAATTCAGGTCAAAGTGATAAATGCTG
CTCATTCCTTCTATAATGGAACAACTACTCTGCCAATATCAGATGAAGACAGGACCCCACGGAA
AAGAATTAGCAAAACATTAAATATGACAACAAGTCCTGAGGAGAAAAGAAAAATTATTGGTGAT
ACTTTTGTTAAGATTGCCAATGAAGTCATTGGAGAAATGAGTCTGAAGCCAGAGGAGGTTTTTC
TTGCCCAAGGCACTTTACGGCCTGATCTAATCGAAAGTGCATCCCTTGTTGCAAGCGGCAAAGC
TGAACTCATCAAAACCCACCACAACGACACAGAGCTTATCAGGAAGTTAAGGGAAGAGGGGAAA
GTAATAGAACCTCTGAAAGATTTTCATAAAGATGAAGTTAGGATTTTAGGCAGAGAGCTTGACC
TGCCAGAAGAATTGGTTTCCAGGCATCCTTTTCCAGGTCCTGGCCTGGCAATCAGAGTAATATG
TGCTGAAGAACCTTATATTTGTAAAGACTTTCCTGAAACCAACAATATTTTGAAAATAGTAGCT
GATTTTTCTGCAAGTGTTAAGAAGCCTCATACACTGTTACAAAGAGTCAAAGCTTGCACAACAG
AAGAGGACCAGGAGAAACTCATGGAAATTACAAGTCAGCATTCATTGAATGCTTTCTTGCTGCC
AATTAAGACTGTGGGTGTGCAGGGTGACTGTCGTTCTTATAGTTATGTGTGTGGAATCTCCAGT
AAAGATGAACCTGACTGGGAATCTCTTATTTTCCTTGCCAGACTTATACCTCGAATGTGTCATA
ACATTAACAGAGTTGTCTATATCTTTGGCCCACCAGTTAAAGAACCTCCTACAGATGTTACTCC
AACATTTTTGACAACAGGGGTGCTCAGTACTTTACGCCAAGCTGATTTTGAGGCCCATAACATT
CTCCGGGAGTCTGGGTATGCTGGGAAAATCAGCCAGATGCCAGTGATTTTGACCCCATTACATT
TCGATCGAGATCCACTTCAGAAGCAGCCTTCATGCCAGAGGTCTGTGGTTATTCGAACCTTTAT
TACTAGTGACTTCATGACTGGAGTACCTGCAACACCTGGCAATGAAATTCCTGTAGAGGTGGTG
CTAAAGATGGTCACTGAGATAAAGAAGATTCCTGGAATTTCTAGAATTATGTATGACCTAACGT
CAAAGCCCCCGGGAACCACTGAGTGGGAGTAATAAATGTGTTGTTGAAGAAAAAAAAAAAAAAA
AAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039102016 ⟹ XP_038957944

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	150,587,824 - 150,641,564 (+)	NCBI
mRatBN7.2	2	148,441,369 - 148,491,908 (+)	NCBI

RefSeq Acc Id:

XM_039102017 ⟹ XP_038957945

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	150,600,684 - 150,629,330 (+)	NCBI
mRatBN7.2	2	148,451,056 - 148,479,656 (+)	NCBI

RefSeq Acc Id:

XM_063281587 ⟹ XP_063137657

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	150,589,703 - 150,641,564 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001019925	(Get FASTA)	NCBI Sequence Viewer
	XP_038957944	(Get FASTA)	NCBI Sequence Viewer
	XP_038957945	(Get FASTA)	NCBI Sequence Viewer
	XP_063137657	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH98016	(Get FASTA)	NCBI Sequence Viewer
	EDM14805	(Get FASTA)	NCBI Sequence Viewer
	EDM14806	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000109550
GenBank Protein	Q4V7C6	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001019925 ⟸ NM_001024754

- UniProtKB:

Q4V7C6 (UniProtKB/Swiss-Prot), A0A0G2K2C2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MALCNGDSKPENAGGDLKDGCHHYEGAVVILDAGAQYGKVIDRRVRELFVQSEIFPLETPAFAI
KEQGFRAIIISGGPNSVYAEDAPWFDPAIFTIGKPVLGICYGMQMMNKVFGGTVHKKSVREDGV
FNISMDNTCSLFRGLQKEEIVLLTHGDSVDKVADGFKVVARSGNIVAGIANESKKLYGVQFHPE
VGLTENGKVILKNFLYDIAGCSGNFTVQNRELECIREIKEKVGTSKVLVLLSGGVDSTVCTALL
NRALNQDQVIAVHIDNGFMRKRESQSVEEALKKLGIQVKVINAAHSFYNGTTTLPISDEDRTPR
KRISKTLNMTTSPEEKRKIIGDTFVKIANEVIGEMSLKPEEVFLAQGTLRPDLIESASLVASGK
AELIKTHHNDTELIRKLREEGKVIEPLKDFHKDEVRILGRELDLPEELVSRHPFPGPGLAIRVI
CAEEPYICKDFPETNNILKIVADFSASVKKPHTLLQRVKACTTEEDQEKLMEITSQHSLNAFLL
PIKTVGVQGDCRSYSYVCGISSKDEPDWESLIFLARLIPRMCHNINRVVYIFGPPVKEPPTDVT
PTFLTTGVLSTLRQADFEAHNILRESGYAGKISQMPVILTPLHFDRDPLQKQPSCQRSVVIRTF
ITSDFMTGVPATPGNEIPVEVVLKMVTEIKKIPGISRIMYDLTSKPPGTTEWE

hide sequence

Ensembl Acc Id:

ENSRNOP00000068164 ⟸ ENSRNOT00000076976

Ensembl Acc Id:

ENSRNOP00000072183 ⟸ ENSRNOT00000084238

Ensembl Acc Id:

ENSRNOP00000068021 ⟸ ENSRNOT00000076292

RefSeq Acc Id:	XP_038957944 ⟸ XM_039102016
- Peptide Label:	isoform X1
- UniProtKB:	A0A8L2R0S7 (UniProtKB/TrEMBL), A0A0G2K2C2 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038957945 ⟸ XM_039102017
- Peptide Label:	isoform X2
- UniProtKB:	A6JVP6 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000068212 ⟸ ENSRNOT00000076880

RefSeq Acc Id:	XP_063137657 ⟸ XM_063281587
- Peptide Label:	isoform X1
- UniProtKB:	A0A0G2K2C2 (UniProtKB/TrEMBL), A0A8L2R0S7 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000109550 ⟸ ENSRNOT00000167462

Ensembl Acc Id:

ENSRNOP00000101354 ⟸ ENSRNOT00000144456

Protein Domains

Glutamine amidotransferase type-1 GMPS ATP-PPase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q4V7C6-F1-model_v2	AlphaFold	Q4V7C6	1-693	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13691360

Promoter ID:

EPDNEW_R1882

Type:

initiation region

Name:

Gmps_1

Description:

guanine monophosphate synthase

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	2	154,555,894 - 154,555,954	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1310063	AgrOrtholog
BioCyc Gene	G2FUF-52923	BioCyc
BioCyc Pathway	CITRULBIO-PWY [L-citrulline biosynthesis]	BioCyc
	GLUTAMINDEG-PWY [L-glutamine degradation I]	BioCyc
	PWY-5921 [glutaminyl-tRNAgln biosynthesis via transamidation]	BioCyc
	PWY-7221 [guanosine ribonucleotides de novo biosynthesis]	BioCyc
BioCyc Pathway Image	CITRULBIO-PWY	BioCyc
	GLUTAMINDEG-PWY	BioCyc
	PWY-5921	BioCyc
	PWY-7221	BioCyc
Ensembl Genes	ENSRNOG00000051151	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000167462	ENTREZGENE
Gene3D-CATH	3.30.300.10	UniProtKB/Swiss-Prot
	3.40.50.620	UniProtKB/Swiss-Prot
	3.40.50.880	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7454908	IMAGE-MGC_LOAD
InterPro	Class_I_gatase-like	UniProtKB/Swiss-Prot
	GATASE	UniProtKB/Swiss-Prot
	GMP_synth_C	UniProtKB/Swiss-Prot
	GMP_synth_GATase	UniProtKB/Swiss-Prot
	GMPS_ATP_PPase_dom	UniProtKB/Swiss-Prot
	NAD/GMP_synthase	UniProtKB/Swiss-Prot
	Rossmann-like_a/b/a_fold	UniProtKB/Swiss-Prot
KEGG Report	rno:295088	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:116167	IMAGE-MGC_LOAD
NCBI Gene	295088	ENTREZGENE
PANTHER	GMP SYNTHASE [GLUTAMINE-HYDROLYZING]	UniProtKB/Swiss-Prot
	GMP SYNTHASE-RELATED	UniProtKB/Swiss-Prot
Pfam	GATase	UniProtKB/Swiss-Prot
	GMP_synt_C	UniProtKB/Swiss-Prot
	NAD_synthase	UniProtKB/Swiss-Prot
PhenoGen	Gmps	PhenoGen
PRINTS	ANTSNTHASEII	UniProtKB/Swiss-Prot
	GATASE	UniProtKB/Swiss-Prot
PROSITE	GATASE_TYPE_1	UniProtKB/Swiss-Prot
	GMPS_ATP_PPASE	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000051151	RatGTEx
Superfamily-SCOP	Adenine nucleotide alpha hydrolases-like	UniProtKB/Swiss-Prot
	GMP synthetase C-terminal dimerisation domain	UniProtKB/Swiss-Prot
	SSF52317	UniProtKB/Swiss-Prot
UniProt	A0A096MJ75_RAT	UniProtKB/TrEMBL
	A0A0G2K2C2	ENTREZGENE, UniProtKB/TrEMBL
	A0A8L2R0S7	ENTREZGENE, UniProtKB/TrEMBL
	A0ABK0LAE1_RAT	UniProtKB/TrEMBL
	A0ABK0LFI0_RAT	UniProtKB/TrEMBL
	A6JVP6	ENTREZGENE, UniProtKB/TrEMBL
	A6JVP7_RAT	UniProtKB/TrEMBL
	GUAA_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-09-04	Gmps	guanine monophosphate synthase	Gmps	guanine monphosphate synthase	Name changed	629549	APPROVED
2013-07-09	Gmps	guanine monphosphate synthase	Gmps	guanine monphosphate synthetase	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Gmps	guanine monphosphate synthetase	Gmps_predicted	guanine monphosphate synthetase (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Gmps_predicted	guanine monphosphate synthetase (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways

Send us a Message

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways