Symbol:
Dicer1
Name:
dicer 1 ribonuclease III
RGD ID:
1309381
Description:
Predicted to enable several functions, including double-stranded RNA binding activity; endonuclease activity, active with either ribo- or deoxyribonucleic acids and producing 5'-phosphomonoesters; and regulatory RNA binding activity. Predicted to contribute to pre-miRNA binding activity. Involved in several processes, including positive regulation of cell population proliferation; positive regulation of collagen biosynthetic process; and positive regulation of endothelial cell-matrix adhesion via fibronectin. Located in dendrite; endoplasmic reticulum-Golgi intermediate compartment; and growth cone. Biomarker of middle cerebral artery infarction. Human ortholog(s) of this gene implicated in DICER1 syndrome; gastrointestinal system cancer (multiple); multinodular goiter; nephroma; and pleuropulmonary blastoma. Orthologous to human DICER1 (dicer 1, ribonuclease III); PARTICIPATES IN microRNA pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; amphetamine; bisphenol A.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
dicer 1, ribonuclease type III; Dicer1, Dcr-1 homolog; Dicer1, Dcr-1 homolog (Drosophila); endoribonuclease Dicer; LOC299284
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
DICER1 (dicer 1, ribonuclease III) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Dicer1 (dicer 1, ribonuclease type III) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Dicer1 (dicer 1, ribonuclease III) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
DICER1 (dicer 1, ribonuclease III) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
DICER1 (dicer 1, ribonuclease III) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Dicer1 (dicer 1, ribonuclease III) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
DICER1 (dicer 1, ribonuclease III) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
DICER1 (dicer 1, ribonuclease III) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Dicer1 (dicer 1, ribonuclease III) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
DICER1 (dicer 1, ribonuclease III)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Dicer1 (dicer 1, ribonuclease type III)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
dicer1 (dicer 1, ribonuclease type III)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Dcr-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
dcr-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
dicer1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 129,392,298 - 129,457,252 (-) NCBI GRCr8 mRatBN7.2 6 123,627,529 - 123,692,278 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 123,631,250 - 123,693,965 (-) Ensembl mRatBN7.2 Ensembl Rnor_6.0 6 128,388,084 - 128,453,234 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 128,388,053 - 128,434,183 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 137,586,335 - 137,633,706 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 128,777,468 - 128,838,780 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 128,781,378 - 128,842,495 (-) NCBI Celera 6 121,106,680 - 121,167,957 (-) NCBI Celera Cytogenetic Map 6 q32 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Dicer1 Rat 1,2-dimethylhydrazine increases expression ISO Dicer1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of DICER1 mRNA CTD PMID:22206623 Dicer1 Rat 17beta-estradiol decreases expression ISO DICER1 (Homo sapiens) 6480464 Estradiol results in decreased expression of DICER1 mRNA CTD PMID:20106945 and PMID:21632981 Dicer1 Rat 17beta-estradiol increases expression ISO Dicer1 (Mus musculus) 6480464 Estradiol results in increased expression of DICER1 mRNA CTD PMID:39298647 Dicer1 Rat 17beta-estradiol increases expression ISO DICER1 (Homo sapiens) 6480464 Estradiol results in increased expression of DICER1 mRNA CTD PMID:23019147 Dicer1 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO DICER1 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Dicer1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Dicer1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of DICER1 mRNA CTD PMID:21570461 Dicer1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of DICER1 mRNA CTD PMID:33387578 Dicer1 Rat 2,4,6-tribromophenol decreases expression ISO DICER1 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Dicer1 Rat 2,4-D multiple interactions ISO Dicer1 (Mus musculus) 6480464 2 and 4-Dichlorophenoxyacetic Acid inhibits the reaction [[Sucrose co-treated with Dietary Fats] results in increased expression of DICER1 mRNA] CTD PMID:37516258 Dicer1 Rat 2,5-hexanedione increases expression ISO Dicer1 (Mus musculus) 6480464 2 and 5-hexanedione results in increased expression of DICER1 mRNA CTD PMID:33197454 Dicer1 Rat 4,4'-sulfonyldiphenol increases expression ISO Dicer1 (Mus musculus) 6480464 bisphenol S results in increased expression of DICER1 mRNA CTD PMID:39298647 Dicer1 Rat 5-chloro-7-iodoquinolin-8-ol multiple interactions ISO DICER1 (Homo sapiens) 6480464 [Clioquinol co-treated with zinc chloride] results in decreased expression of DICER1 protein CTD PMID:22415087 Dicer1 Rat 5-fluorouracil decreases expression ISO DICER1 (Homo sapiens) 6480464 Fluorouracil results in decreased expression of DICER1 mRNA CTD PMID:16510598 Dicer1 Rat 7,12-dimethyltetraphene increases expression ISO Dicer1 (Mus musculus) 6480464 9 more ... CTD PMID:24792773 Dicer1 Rat 7,12-dimethyltetraphene multiple interactions ISO Dicer1 (Mus musculus) 6480464 Butyric Acid affects the reaction [9 more ... CTD PMID:24792773 Dicer1 Rat aflatoxin B1 increases expression ISO Dicer1 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of DICER1 mRNA CTD PMID:19770486 Dicer1 Rat aflatoxin B1 decreases methylation ISO DICER1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of DICER1 gene CTD PMID:27153756 Dicer1 Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of DICER1 mRNA CTD PMID:30779732 Dicer1 Rat amphotericin B decreases expression ISO DICER1 (Homo sapiens) 6480464 Amphotericin B analog results in decreased expression of DICER1 mRNA CTD PMID:28534445 Dicer1 Rat aristolochic acid A decreases expression ISO DICER1 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of DICER1 mRNA CTD PMID:33212167 Dicer1 Rat arsane affects methylation ISO DICER1 (Homo sapiens) 6480464 Arsenic affects the methylation of DICER1 gene CTD PMID:25304211 Dicer1 Rat arsenic atom affects methylation ISO DICER1 (Homo sapiens) 6480464 Arsenic affects the methylation of DICER1 gene CTD PMID:25304211 Dicer1 Rat arsenite(3-) multiple interactions ISO DICER1 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to DICER1 mRNA] CTD PMID:32406909 Dicer1 Rat benzo[a]pyrene decreases expression ISO DICER1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of DICER1 mRNA CTD PMID:20106945 and PMID:21632981 Dicer1 Rat benzo[a]pyrene diol epoxide I decreases expression ISO DICER1 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 and PMID:20018196 Dicer1 Rat beta-lapachone decreases expression ISO DICER1 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of DICER1 mRNA CTD PMID:38218311 Dicer1 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Dicer1 (Mus musculus) 6480464 [Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with nonylphenol co-treated with octylphenol] results in increased expression of DICER1 mRNA CTD PMID:33086190 Dicer1 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Dicer1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of DICER1 mRNA CTD PMID:33754040 Dicer1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of DICER1 mRNA CTD PMID:25181051 and PMID:30816183 Dicer1 Rat bisphenol A decreases expression ISO Dicer1 (Mus musculus) 6480464 bisphenol A results in decreased expression of DICER1 mRNA CTD PMID:37761913 Dicer1 Rat bisphenol A increases expression ISO Dicer1 (Mus musculus) 6480464 bisphenol A results in increased expression of DICER1 mRNA CTD PMID:35598803 Dicer1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of DICER1 mRNA CTD PMID:32528016 Dicer1 Rat bisphenol A decreases expression ISO DICER1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of DICER1 protein CTD PMID:31675489 Dicer1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of DICER1 mRNA CTD PMID:34947998 Dicer1 Rat butanal decreases expression ISO DICER1 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of DICER1 mRNA CTD PMID:26079696 Dicer1 Rat Butylbenzyl phthalate multiple interactions ISO Dicer1 (Mus musculus) 6480464 [Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with nonylphenol co-treated with octylphenol] results in increased expression of DICER1 mRNA CTD PMID:33086190 Dicer1 Rat butyric acid multiple interactions ISO Dicer1 (Mus musculus) 6480464 Butyric Acid affects the reaction [9 more ... CTD PMID:24792773 Dicer1 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of DICER1 mRNA CTD PMID:33453195 and PMID:35525383 Dicer1 Rat caffeine affects phosphorylation ISO DICER1 (Homo sapiens) 6480464 Caffeine affects the phosphorylation of DICER1 protein CTD PMID:35688186 Dicer1 Rat calyculin a decreases expression ISO Dicer1 (Mus musculus) 6480464 calyculin A results in decreased expression of DICER1 mRNA CTD PMID:25270620 Dicer1 Rat CGP 52608 multiple interactions ISO DICER1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to DICER1 gene] CTD PMID:28238834 Dicer1 Rat chlorpyrifos decreases expression ISO Dicer1 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of DICER1 mRNA CTD PMID:37019170 Dicer1 Rat choline multiple interactions ISO Dicer1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of DICER1 gene CTD PMID:20938992 Dicer1 Rat chrysene increases expression ISO Dicer1 (Mus musculus) 6480464 chrysene results in increased expression of DICER1 mRNA CTD PMID:26377693 Dicer1 Rat cisplatin decreases expression ISO DICER1 (Homo sapiens) 6480464 Cisplatin results in decreased expression of DICER1 mRNA CTD PMID:27594783 Dicer1 Rat cisplatin increases response to substance ISO DICER1 (Homo sapiens) 6480464 DICER1 protein results in increased susceptibility to Cisplatin CTD PMID:21274007 Dicer1 Rat cisplatin increases expression ISO DICER1 (Homo sapiens) 6480464 Cisplatin results in increased expression of DICER1 protein CTD PMID:21274007 Dicer1 Rat cisplatin multiple interactions ISO DICER1 (Homo sapiens) 6480464 [Cisplatin results in increased expression of DICER1 protein] which results in increased metabolism of MIR630 more ... CTD PMID:21274007 and PMID:25940438 Dicer1 Rat cobalt dichloride multiple interactions ISO DICER1 (Homo sapiens) 6480464 EZH2 mRNA promotes the reaction [cobaltous chloride deficiency results in decreased expression of DICER1 mRNA] CTD PMID:25351418 Dicer1 Rat cobalt dichloride decreases expression ISO DICER1 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of DICER1 mRNA and cobaltous chloride results in decreased expression of DICER1 protein CTD PMID:25351418 Dicer1 Rat copper(II) sulfate decreases expression ISO DICER1 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of DICER1 mRNA CTD PMID:19549813 Dicer1 Rat coumestrol decreases expression ISO DICER1 (Homo sapiens) 6480464 Coumestrol results in decreased expression of DICER1 mRNA CTD PMID:19167446 Dicer1 Rat cyclosporin A decreases expression ISO DICER1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of DICER1 mRNA CTD PMID:21632981 Dicer1 Rat desferrioxamine B decreases expression ISO DICER1 (Homo sapiens) 6480464 Deferoxamine results in decreased expression of DICER1 mRNA and Deferoxamine results in decreased expression of DICER1 protein CTD PMID:25351418 Dicer1 Rat dexamethasone increases expression ISO DICER1 (Homo sapiens) 6480464 Dexamethasone results in increased expression of DICER1 mRNA CTD PMID:32234517 Dicer1 Rat dexamethasone increases expression EXP 6480464 Dexamethasone results in increased expression of DICER1 mRNA CTD PMID:32234517 Dicer1 Rat Dibutyl phosphate affects expression ISO DICER1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of DICER1 mRNA CTD PMID:37042841 Dicer1 Rat dibutyl phthalate decreases expression ISO Dicer1 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of DICER1 mRNA CTD PMID:17361019 Dicer1 Rat dibutyl phthalate multiple interactions ISO Dicer1 (Mus musculus) 6480464 [Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with nonylphenol co-treated with octylphenol] results in increased expression of DICER1 mRNA CTD PMID:33086190 Dicer1 Rat dioxygen decreases expression ISO DICER1 (Homo sapiens) 6480464 Oxygen deficiency results in decreased expression of DICER1 mRNA and Oxygen deficiency results in decreased expression of DICER1 protein CTD PMID:25351418 Dicer1 Rat dioxygen multiple interactions ISO DICER1 (Homo sapiens) 6480464 DICER1 protein inhibits the reaction [Oxygen deficiency results in decreased cleavage of MIR200A mRNA] more ... CTD PMID:25351418 Dicer1 Rat doxorubicin decreases expression ISO DICER1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of DICER1 mRNA CTD PMID:29803840 Dicer1 Rat elemental selenium decreases expression ISO DICER1 (Homo sapiens) 6480464 Selenium results in decreased expression of DICER1 mRNA CTD PMID:19244175 Dicer1 Rat enzyme inhibitor multiple interactions ISO DICER1 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of DICER1 protein CTD PMID:23301498 Dicer1 Rat ethyl methanesulfonate decreases expression ISO DICER1 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in decreased expression of DICER1 mRNA CTD PMID:23649840 Dicer1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of DICER1 mRNA CTD PMID:24136188 Dicer1 Rat folic acid multiple interactions ISO Dicer1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of DICER1 gene CTD PMID:20938992 Dicer1 Rat formaldehyde decreases expression ISO DICER1 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of DICER1 mRNA CTD PMID:23649840 Dicer1 Rat FR900359 decreases phosphorylation ISO DICER1 (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of DICER1 protein CTD PMID:37730182 Dicer1 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of DICER1 mRNA CTD PMID:33387578 Dicer1 Rat glucaric acid multiple interactions ISO Dicer1 (Mus musculus) 6480464 Glucaric Acid affects the reaction [9 more ... CTD PMID:24792773 Dicer1 Rat GSK343 increases expression ISO DICER1 (Homo sapiens) 6480464 GSK343 results in increased expression of DICER1 mRNA CTD PMID:25351418 Dicer1 Rat ivermectin decreases expression ISO DICER1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of DICER1 protein CTD PMID:32959892 Dicer1 Rat L-methionine multiple interactions ISO Dicer1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of DICER1 gene CTD PMID:20938992 Dicer1 Rat manganese atom multiple interactions ISO DICER1 (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in decreased expression of DICER1 mRNA CTD PMID:39836092 Dicer1 Rat manganese(0) multiple interactions ISO DICER1 (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in decreased expression of DICER1 mRNA CTD PMID:39836092 Dicer1 Rat manganese(II) chloride multiple interactions ISO DICER1 (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in decreased expression of DICER1 mRNA CTD PMID:39836092 Dicer1 Rat methamphetamine increases methylation ISO Dicer1 (Mus musculus) 6480464 Methamphetamine results in increased methylation of DICER1 promoter CTD PMID:26307267 Dicer1 Rat methyl methanesulfonate decreases expression ISO DICER1 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of DICER1 mRNA CTD PMID:23649840 Dicer1 Rat mono(2-ethylhexyl) phthalate multiple interactions ISO DICER1 (Homo sapiens) 6480464 [monoethyl phthalate co-treated with mono-(2-ethylhexyl)phthalate co-treated with monobutyl phthalate co-treated with mono-isobutyl phthalate co-treated with monoisononylphthalate co-treated with mono-benzyl phthalate] results in increased expression of DICER1 mRNA CTD PMID:35861251 Dicer1 Rat monobenzyl phthalate multiple interactions ISO DICER1 (Homo sapiens) 6480464 [monoethyl phthalate co-treated with mono-(2-ethylhexyl)phthalate co-treated with monobutyl phthalate co-treated with mono-isobutyl phthalate co-treated with monoisononylphthalate co-treated with mono-benzyl phthalate] results in increased expression of DICER1 mRNA CTD PMID:35861251 Dicer1 Rat Monobutylphthalate multiple interactions ISO DICER1 (Homo sapiens) 6480464 [monoethyl phthalate co-treated with mono-(2-ethylhexyl)phthalate co-treated with monobutyl phthalate co-treated with mono-isobutyl phthalate co-treated with monoisononylphthalate co-treated with mono-benzyl phthalate] results in increased expression of DICER1 mRNA CTD PMID:35861251 Dicer1 Rat monoethyl phthalate multiple interactions ISO DICER1 (Homo sapiens) 6480464 [monoethyl phthalate co-treated with mono-(2-ethylhexyl)phthalate co-treated with monobutyl phthalate co-treated with mono-isobutyl phthalate co-treated with monoisononylphthalate co-treated with mono-benzyl phthalate] results in increased expression of DICER1 mRNA CTD PMID:35861251 Dicer1 Rat N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine decreases expression ISO DICER1 (Homo sapiens) 6480464 N more ... CTD PMID:12756304 Dicer1 Rat N-ethyl-N-nitrosourea multiple interactions ISO Dicer1 (Mus musculus) 6480464 DICER1 protein affects the reaction [Ethylnitrosourea results in decreased expression of CCNE2 mRNA] more ... CTD PMID:24478143 Dicer1 Rat nickel dichloride decreases expression ISO DICER1 (Homo sapiens) 6480464 nickel chloride results in decreased expression of DICER1 mRNA CTD PMID:17312168 Dicer1 Rat nicotinamide multiple interactions ISO Dicer1 (Mus musculus) 6480464 Niacinamide affects the reaction [9 more ... CTD PMID:24792773 Dicer1 Rat Nonylphenol multiple interactions ISO Dicer1 (Mus musculus) 6480464 [Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with butylbenzyl phthalate co-treated with nonylphenol co-treated with octylphenol] results in increased expression of DICER1 mRNA CTD PMID:33086190 Dicer1 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of DICER1 mRNA CTD PMID:25729387 Dicer1 Rat paracetamol decreases expression ISO DICER1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of DICER1 mRNA CTD PMID:21420995 Dicer1 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of DICER1 mRNA CTD PMID:33387578 Dicer1 Rat perfluorohexanesulfonic acid decreases expression ISO Dicer1 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in decreased expression of DICER1 mRNA CTD PMID:37995155 Dicer1 Rat perfluorooctane-1-sulfonic acid decreases expression ISO DICER1 (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in decreased expression of DICER1 mRNA CTD PMID:27153767 Dicer1 Rat pirinixic acid multiple interactions ISO DICER1 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of DICER1 mRNA CTD PMID:19710929 Dicer1 Rat progesterone increases expression ISO Dicer1 (Mus musculus) 6480464 Progesterone results in increased expression of DICER1 mRNA CTD PMID:20852728 Dicer1 Rat raloxifene decreases expression ISO DICER1 (Homo sapiens) 6480464 Raloxifene Hydrochloride results in decreased expression of DICER1 mRNA CTD PMID:16497877 Dicer1 Rat resveratrol multiple interactions ISO DICER1 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of DICER1 mRNA CTD PMID:23557933 Dicer1 Rat selenium atom decreases expression ISO DICER1 (Homo sapiens) 6480464 Selenium results in decreased expression of DICER1 mRNA CTD PMID:19244175 Dicer1 Rat sodium arsenite increases expression ISO DICER1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of DICER1 mRNA CTD PMID:24431212 Dicer1 Rat sodium arsenite decreases expression ISO DICER1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of DICER1 protein CTD PMID:30528433 Dicer1 Rat sodium arsenite multiple interactions ISO DICER1 (Homo sapiens) 6480464 DICER1 protein promotes the reaction [sodium arsenite results in increased cleavage of TRA-CGC3-1] CTD PMID:30442959 Dicer1 Rat sucrose multiple interactions ISO Dicer1 (Mus musculus) 6480464 2 more ... CTD PMID:37516258 Dicer1 Rat sunitinib increases expression ISO DICER1 (Homo sapiens) 6480464 Sunitinib results in increased expression of DICER1 mRNA CTD PMID:31533062 Dicer1 Rat thiram increases expression ISO DICER1 (Homo sapiens) 6480464 Thiram results in increased expression of DICER1 mRNA CTD PMID:38568856 Dicer1 Rat titanium dioxide decreases methylation ISO Dicer1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of DICER1 gene CTD PMID:35295148 Dicer1 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of DICER1 mRNA CTD PMID:25729387 Dicer1 Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of DICER1 mRNA CTD PMID:25729387 Dicer1 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of DICER1 mRNA CTD PMID:33387578 Dicer1 Rat tungsten decreases expression ISO Dicer1 (Mus musculus) 6480464 Tungsten results in decreased expression of DICER1 mRNA CTD PMID:30912803 Dicer1 Rat tunicamycin decreases expression ISO Dicer1 (Mus musculus) 6480464 Tunicamycin results in decreased expression of DICER1 mRNA CTD PMID:17127020 Dicer1 Rat urethane decreases expression ISO DICER1 (Homo sapiens) 6480464 Urethane results in decreased expression of DICER1 mRNA CTD PMID:28818685 Dicer1 Rat valproic acid affects expression ISO Dicer1 (Mus musculus) 6480464 Valproic Acid affects the expression of DICER1 mRNA CTD PMID:17292431 Dicer1 Rat valproic acid decreases expression ISO DICER1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of DICER1 mRNA CTD PMID:23179753 and PMID:27188386 Dicer1 Rat valproic acid affects expression ISO DICER1 (Homo sapiens) 6480464 Valproic Acid affects the expression of DICER1 mRNA CTD PMID:25979313 Dicer1 Rat valproic acid decreases methylation ISO DICER1 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of DICER1 gene CTD PMID:29154799 Dicer1 Rat vitamin E decreases expression ISO DICER1 (Homo sapiens) 6480464 Vitamin E results in decreased expression of DICER1 mRNA CTD PMID:19244175 Dicer1 Rat zinc dichloride multiple interactions ISO DICER1 (Homo sapiens) 6480464 [Clioquinol co-treated with zinc chloride] results in decreased expression of DICER1 protein CTD PMID:22415087 Dicer1 Rat zinc sulfate increases expression ISO DICER1 (Homo sapiens) 6480464 Zinc Sulfate results in increased expression of DICER1 mRNA CTD PMID:12756304
1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (ISO) 2,4-D (ISO) 2,5-hexanedione (ISO) 4,4'-sulfonyldiphenol (ISO) 5-chloro-7-iodoquinolin-8-ol (ISO) 5-fluorouracil (ISO) 7,12-dimethyltetraphene (ISO) aflatoxin B1 (ISO) amphetamine (EXP) amphotericin B (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) butanal (ISO) Butylbenzyl phthalate (ISO) butyric acid (ISO) cadmium dichloride (EXP) caffeine (ISO) calyculin a (ISO) CGP 52608 (ISO) chlorpyrifos (ISO) choline (ISO) chrysene (ISO) cisplatin (ISO) cobalt dichloride (ISO) copper(II) sulfate (ISO) coumestrol (ISO) cyclosporin A (ISO) desferrioxamine B (ISO) dexamethasone (EXP,ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) dioxygen (ISO) doxorubicin (ISO) elemental selenium (ISO) enzyme inhibitor (ISO) ethyl methanesulfonate (ISO) flutamide (EXP) folic acid (ISO) formaldehyde (ISO) FR900359 (ISO) gentamycin (EXP) glucaric acid (ISO) GSK343 (ISO) ivermectin (ISO) L-methionine (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methamphetamine (ISO) methyl methanesulfonate (ISO) mono(2-ethylhexyl) phthalate (ISO) monobenzyl phthalate (ISO) Monobutylphthalate (ISO) monoethyl phthalate (ISO) N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine (ISO) N-ethyl-N-nitrosourea (ISO) nickel dichloride (ISO) nicotinamide (ISO) Nonylphenol (ISO) oxaliplatin (EXP) paracetamol (EXP,ISO) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) pirinixic acid (ISO) progesterone (ISO) raloxifene (ISO) resveratrol (ISO) selenium atom (ISO) sodium arsenite (ISO) sucrose (ISO) sunitinib (ISO) thiram (ISO) titanium dioxide (ISO) topotecan (EXP) trichloroethene (EXP) tungsten (ISO) tunicamycin (ISO) urethane (ISO) valproic acid (ISO) vitamin E (ISO) zinc dichloride (ISO) zinc sulfate (ISO)
1.
Clinicopathological and prognostic significance of the microRNA processing enzyme DICER1 mRNA expression in colorectal cancer patients.
Akahane T, Mol Clin Oncol. 2013 Mar;1(2):267-273. doi: 10.3892/mco.2012.43. Epub 2012 Nov 22.
2.
The dynamic recruitment of TRBP to neuronal membranes mediates dendritogenesis during development.
Antoniou A, etal., EMBO Rep. 2018 Mar;19(3). pii: embr.201744853. doi: 10.15252/embr.201744853. Epub 2017 Dec 20.
3.
Dicer expression and localization in post-mitotic neurons.
Barbato C, etal., Brain Res. 2007 Oct 17;1175:17-27. Epub 2007 Aug 22.
4.
DICER1 mutations in childhood cystic nephroma and its relationship to DICER1-renal sarcoma.
Doros LA, etal., Mod Pathol. 2014 Sep;27(9):1267-80. doi: 10.1038/modpathol.2013.242. Epub 2014 Jan 31.
5.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
7.
Functional and selective RNA interference in developing axons and growth cones.
Hengst U, etal., J Neurosci. 2006 May 24;26(21):5727-32.
8.
DICER1 mutations in familial pleuropulmonary blastoma.
Hill DA, etal., Science. 2009 Aug 21;325(5943):965. doi: 10.1126/science.1174334. Epub 2009 Jun 25.
9.
Beta-cell specific deletion of Dicer1 leads to defective insulin secretion and diabetes mellitus.
Kalis M, etal., PLoS One. 2011;6(12):e29166. doi: 10.1371/journal.pone.0029166. Epub 2011 Dec 27.
10.
Dietary Lutein Plus Zeaxanthin Intake and DICER1 rs3742330 A > G Polymorphism Relative to Colorectal Cancer Risk.
Kim J, etal., Sci Rep. 2019 Mar 4;9(1):3406. doi: 10.1038/s41598-019-39747-5.
11.
The widespread regulation of microRNA biogenesis, function and decay.
Krol J, etal., Nat Rev Genet. 2010 Sep;11(9):597-610. Epub 2010 Jul 27.
12.
Dicer1 functions as a haploinsufficient tumor suppressor.
Kumar MS, etal., Genes Dev. 2009 Dec 1;23(23):2700-4. doi: 10.1101/gad.1848209. Epub 2009 Nov 10.
13.
Monoallelic but not biallelic loss of Dicer1 promotes tumorigenesis in vivo.
Lambertz I, etal., Cell Death Differ. 2010 Apr;17(4):633-41. doi: 10.1038/cdd.2009.202. Epub 2009 Dec 18.
14.
MicroRNA-107 contributes to post-stroke angiogenesis by targeting Dicer-1.
Li Y, etal., Sci Rep. 2015 Aug 21;5:13316. doi: 10.1038/srep13316.
15.
Potentially functional genetic variants in microRNA processing genes and risk of HBV-related hepatocellular carcinoma.
Liu L, etal., Mol Carcinog. 2013 Nov;52 Suppl 1:E148-54. doi: 10.1002/mc.22062. Epub 2013 Jul 19.
16.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
17.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
18.
GOA pipeline
RGD automated data pipeline
19.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
20.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
21.
Comprehensive gene review and curation
RGD comprehensive gene curation
22.
Aging-induced dysregulation of dicer1-dependent microRNA expression impairs angiogenic capacity of rat cerebromicrovascular endothelial cells.
Ungvari Z, etal., J Gerontol A Biol Sci Med Sci. 2013 Aug;68(8):877-91. doi: 10.1093/gerona/gls242. Epub 2012 Dec 13.
23.
Cell- and developmental stage-specific Dicer1 ablation in the lung epithelium models cystic pleuropulmonary blastoma.
Wagh PK, etal., J Pathol. 2015 May;236(1):41-52. doi: 10.1002/path.4500. Epub 2015 Jan 20.
24.
Gonadotrope-specific deletion of Dicer results in severely suppressed gonadotropins and fertility defects.
Wang H, etal., J Biol Chem. 2015 Jan 30;290(5):2699-714. doi: 10.1074/jbc.M114.621565. Epub 2014 Dec 18.
25.
Suppression of collagen synthesis by Dicer gene silencing in hepatic stellate cells.
Yu F, etal., Mol Med Rep. 2014 Feb;9(2):707-14. doi: 10.3892/mmr.2013.1866. Epub 2013 Dec 16.
26.
Downregulated expression of Dicer1 predicts inferior survival in primary gastrointestinal diffuse large B-cell lymphoma treated with CHOP-like regimen and rituximab.
Zhao H, etal., Med Oncol. 2014 Oct;31(10):206. doi: 10.1007/s12032-014-0206-2. Epub 2014 Sep 7.
27.
Decreased expression of DICER1 in gastric cancer.
Zheng ZH, etal., Chin Med J (Engl). 2007 Dec 5;120(23):2099-104.
Dicer1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 129,392,298 - 129,457,252 (-) NCBI GRCr8 mRatBN7.2 6 123,627,529 - 123,692,278 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 123,631,250 - 123,693,965 (-) Ensembl mRatBN7.2 Ensembl Rnor_6.0 6 128,388,084 - 128,453,234 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 128,388,053 - 128,434,183 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 137,586,335 - 137,633,706 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 128,777,468 - 128,838,780 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 128,781,378 - 128,842,495 (-) NCBI Celera 6 121,106,680 - 121,167,957 (-) NCBI Celera Cytogenetic Map 6 q32 NCBI
DICER1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 14 95,086,228 - 95,158,010 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 14 95,086,228 - 95,158,010 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 14 95,552,565 - 95,624,347 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 14 94,622,319 - 94,693,512 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 14 94,622,318 - 94,693,512 NCBI Celera 14 75,608,684 - 75,679,876 (-) NCBI Celera Cytogenetic Map 14 q32.13 NCBI HuRef 14 75,736,521 - 75,807,615 (-) NCBI HuRef CHM1_1 14 95,490,915 - 95,561,989 (-) NCBI CHM1_1 T2T-CHM13v2.0 14 89,316,445 - 89,388,228 (-) NCBI T2T-CHM13v2.0
Dicer1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 12 104,654,001 - 104,718,331 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 12 104,654,001 - 104,718,211 (-) Ensembl GRCm39 Ensembl GRCm38 12 104,687,740 - 104,751,968 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 12 104,687,742 - 104,751,952 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 12 105,925,952 - 105,990,162 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 12 105,092,486 - 105,153,002 (-) NCBI MGSCv36 mm8 Celera 12 105,918,245 - 105,982,441 (-) NCBI Celera Cytogenetic Map 12 E NCBI cM Map 12 54.83 NCBI
Dicer1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955438 17,382,493 - 17,431,797 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955438 17,374,899 - 17,431,599 (+) NCBI ChiLan1.0 ChiLan1.0
DICER1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 15 96,234,748 - 96,307,196 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 14 95,451,254 - 95,523,061 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 14 75,709,029 - 75,780,779 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 14 95,036,385 - 95,107,940 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 14 95,036,385 - 95,107,940 (-) Ensembl panpan1.1 panPan2
DICER1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 8 63,970,245 - 64,029,438 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 8 63,972,027 - 64,019,879 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 8 63,546,706 - 63,619,316 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 8 64,236,992 - 64,309,618 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 8 64,238,043 - 64,309,589 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 8 63,912,041 - 63,984,637 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 8 63,970,646 - 64,043,228 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 8 64,295,524 - 64,368,151 (-) NCBI UU_Cfam_GSD_1.0
Dicer1
DICER1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 116,365,802 - 116,411,224 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 116,361,630 - 116,436,471 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 123,581,725 - 123,652,553 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
DICER1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 24 72,915,550 - 72,986,658 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 24 72,915,499 - 72,963,006 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666053 60,107,379 - 60,178,341 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Dicer1
.
Assembly: Rnor_6.0
Chromosome Start Pos End Pos Reference Nucleotide Variant Nucleotide Variant Type Strain Variant Page
6
128391961
128391962
C
A
snv
ACI/EurMcwi (MCW) , COP/CrCrl (MCW & UW) View more Information
6
128391985
128391986
G
A
snv
COP/CrCrl (MCW & UW) , ACI/EurMcwi (MCW), SS/JrHsdMcwi (MCW), GH/OmrMcwi (MCW) View more Information
6
128391998
128391999
G
A
snv
European Variation Archive Release 6 , ACI/EurMcwi (MCW), European Variation Archive Release 4, European Variation Archive Release 3, SS/JrHsdMcwi (MCW), SR/JrHsd (MCW), SBH/Ygl (MCW), GH/OmrMcwi (MCW), COP/CrCrl (MCW & UW) View more Information
6
128392013
128392014
C
A
snv
SS/JrHsdMcwi (MCW) , GH/OmrMcwi (MCW), COP/CrCrl (MCW & UW), ACI/EurMcwi (MCW), SR/JrHsd (MCW), SBH/Ygl (MCW) View more Information
6
128392016
128392017
C
T
snv
SS/JrHsdMcwi (MCW) , GH/OmrMcwi (MCW), ACI/EurMcwi (MCW), SBH/Ygl (MCW), SR/JrHsd (MCW), COP/CrCrl (MCW & UW) View more Information
6
128392043
128392044
G
A
snv
ACI/EurMcwi (MCW) , SS/JrHsdMcwi (MCW), COP/CrCrl (MCW & UW), SR/JrHsd (MCW), SBH/Ygl (MCW), GH/OmrMcwi (MCW) View more Information
6
128392046
128392047
C
T
snv
GH/OmrMcwi (MCW) , SS/JrHsdMcwi (MCW), ACI/EurMcwi (MCW), SR/JrHsd (MCW), COP/CrCrl (MCW & UW), SBH/Ygl (MCW) View more Information
Predicted Target Of
Count of predictions: 76 Count of miRNA genes: 64 Interacting mature miRNAs: 68 Transcripts: ENSRNOT00000014405 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
12801411 Schws8 Schwannoma susceptibility QTL 8 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 6 94968928 139968928 Rat 1331797 Bp213 Blood pressure QTL 213 3.291 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 104085867 128713626 Rat 1331799 Bp211 Blood pressure QTL 211 3.66407 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 72202632 130919985 Rat 71111 Iddm8 Insulin dependent diabetes mellitus QTL 8 1.9 0.002 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 6 105156861 140994061 Rat 1358355 Srcrt4 Stress Responsive Cort QTL 4 6.39 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 100364669 140994061 Rat 61329 Eae9 Experimental allergic encephalomyelitis QTL 9 3.7 body mass (VT:0001259) change in body weight (CMO:0002045) 6 122549046 140994061 Rat 2313399 Anxrr28 Anxiety related response QTL 28 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 6 100671796 132340886 Rat 1331725 Bp212 Blood pressure QTL 212 3.52475 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 93701310 128713626 Rat 8552796 Vie3 Viral induced encephalitis QTL 3 2.6 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 6 96833997 140994061 Rat 4145118 Mcs26 Mammary carcinoma susceptibility QTL 26 0.0001 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 6 106752656 132339866 Rat 1581563 Uae33 Urinary albumin excretion QTL 33 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 72227641 130729205 Rat 10054138 Gmadr3 Adrenal mass QTL 3 3.68 0.00045 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 6 85140138 130140138 Rat 1641917 Colcr5 Colorectal carcinoma resistance QTL 5 3.18 0.0009 intestine integrity trait (VT:0010554) benign colorectal tumor number (CMO:0001795) 6 122549046 137801795 Rat 61414 Pia3 Pristane induced arthritis QTL 3 4.5 joint integrity trait (VT:0010548) post-insult time to onset of experimental arthritis (CMO:0001450) 6 94968928 137848904 Rat 724513 Uae14 Urinary albumin excretion QTL 14 6.5 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 85311061 133478515 Rat 2303624 Vencon5 Ventilatory control QTL 5 4.45 respiration trait (VT:0001943) minute ventilation (CMO:0000132) 6 88047916 133047916 Rat 731173 Uae22 Urinary albumin excretion QTL 22 10.1 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 10054123 Srcrt6 Stress Responsive Cort QTL 6 2.5 0.0043 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 85140138 130140138 Rat 724536 Uae7 Urinary albumin excretion QTL 7 3.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 6 72202632 130729475 Rat 737976 Pia24 Pristane induced arthritis QTL 24 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 6 112636280 140994061 Rat 1298087 Iddm18 Insulin dependent diabetes mellitus QTL 18 0.0001 urine glucose amount (VT:0001758) percentage of study population developing diabetes mellitus during a period of time (CMO:0001114) 6 116506292 130245370 Rat 1581550 Pur8 Proteinuria QTL 8 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 6 72227641 130729205 Rat 738034 Anxrr5 Anxiety related response QTL 5 5.9 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 6 84130881 129130881 Rat 2290393 Uae37 Urinary albumin excretion QTL 37 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 1300076 Glom8 Glomerulus QTL 8 7 9e-09 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli directly contacting the kidney surface (CMO:0001001) 6 86894788 131894788 Rat 2293085 Iddm29 Insulin dependent diabetes mellitus QTL 29 7.66 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 6 122549046 140286318 Rat
D6Got177
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 6 129,440,866 - 129,441,105 (+) Marker Load Pipeline mRatBN7.2 6 123,676,097 - 123,676,336 (+) MAPPER mRatBN7.2 Rnor_6.0 6 128,436,877 - 128,437,115 NCBI Rnor6.0 Rnor_5.0 6 137,635,128 - 137,635,366 UniSTS Rnor5.0 RGSC_v3.4 6 128,822,544 - 128,822,931 RGD RGSC3.4 RGSC_v3.4 6 128,822,636 - 128,822,874 UniSTS RGSC3.4 RGSC_v3.1 6 128,826,383 - 128,826,621 RGD Celera 6 121,151,578 - 121,151,816 UniSTS RH 3.4 Map 6 819.5 UniSTS RH 3.4 Map 6 819.5 RGD Cytogenetic Map 6 q32 UniSTS
RH143307
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 123,692,615 - 123,692,727 (+) MAPPER mRatBN7.2 Rnor_6.0 6 128,453,383 - 128,453,494 NCBI Rnor6.0 Rnor_5.0 6 137,651,657 - 137,651,768 UniSTS Rnor5.0 RGSC_v3.4 6 128,839,054 - 128,839,165 UniSTS RGSC3.4 Celera 6 121,168,106 - 121,168,217 UniSTS RH 3.4 Map 6 823.3 UniSTS Cytogenetic Map 6 q32 UniSTS
UniSTS:498691
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 123,672,314 - 123,673,180 (+) MAPPER mRatBN7.2 Rnor_6.0 6 128,433,094 - 128,433,959 NCBI Rnor6.0 Rnor_5.0 6 137,631,345 - 137,632,210 UniSTS Rnor5.0 RGSC_v3.4 6 128,818,853 - 128,819,718 UniSTS RGSC3.4 Celera 6 121,147,795 - 121,148,660 UniSTS Cytogenetic Map 6 q32 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000014405 ⟹ ENSRNOP00000014405
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 123,631,250 - 123,693,965 (-) Ensembl Rnor_6.0 Ensembl 6 128,388,053 - 128,434,183 (-) Ensembl
RefSeq Acc Id:
NM_001427215 ⟹ NP_001414144
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 129,396,014 - 129,457,252 (-) NCBI
RefSeq Acc Id:
XM_017594505 ⟹ XP_017449994
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 129,392,298 - 129,436,256 (-) NCBI mRatBN7.2 6 123,631,245 - 123,671,487 (-) NCBI Rnor_6.0 6 128,388,084 - 128,432,219 (-) NCBI
Sequence:
TCTCAAGGTTGGGGAGTACTCAAACCTCGAAGTGAATGCATCTTGGACAAAAGAGAGATGGAGCCAAGAGTTTACTAAGCACCAGTTTTATTTTAGGTTCTCATTATGACTTGCTATGTCGCCTTGAA
hide sequence
RefSeq Acc Id:
XM_039113358 ⟹ XP_038969286
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 129,392,298 - 129,457,116 (-) NCBI mRatBN7.2 6 123,627,529 - 123,692,278 (-) NCBI
RefSeq Acc Id:
XM_039113362 ⟹ XP_038969290
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 129,392,298 - 129,457,116 (-) NCBI mRatBN7.2 6 123,631,245 - 123,692,278 (-) NCBI
RefSeq Acc Id:
XM_039113363 ⟹ XP_038969291
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 129,392,298 - 129,457,116 (-) NCBI mRatBN7.2 6 123,631,245 - 123,692,275 (-) NCBI
RefSeq Acc Id:
XM_039113364 ⟹ XP_038969292
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 129,392,298 - 129,457,116 (-) NCBI mRatBN7.2 6 123,631,245 - 123,692,275 (-) NCBI
RefSeq Acc Id:
XM_063261771 ⟹ XP_063117841
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 129,392,298 - 129,443,333 (-) NCBI
RefSeq Acc Id:
XM_063261772 ⟹ XP_063117842
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 129,392,298 - 129,457,116 (-) NCBI
RefSeq Acc Id:
XP_017449994 ⟸ XM_017594505
- Peptide Label:
isoform X4
- Sequence:
MTCYVALNVLKNGYLSLSDINLLVFDECHLAILDHPYREIMKLCDSCPSCPRILGLTASILNGKCDPDELEEKIQKLEKILKSGAETATDLVVLDRYTSQPCEIVVDCGPFTDRSGLYERLLMELEEA
hide sequence
Ensembl Acc Id:
ENSRNOP00000014405 ⟸ ENSRNOT00000014405
RefSeq Acc Id:
XP_038969286 ⟸ XM_039113358
- Peptide Label:
isoform X1
- UniProtKB:
E9PU15 (UniProtKB/TrEMBL), A6JER2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038969290 ⟸ XM_039113362
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_038969291 ⟸ XM_039113363
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_038969292 ⟸ XM_039113364
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_063117842 ⟸ XM_063261772
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_063117841 ⟸ XM_063261771
- Peptide Label:
isoform X1
- UniProtKB:
A6JER2 (UniProtKB/TrEMBL), E9PU15 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001414144 ⟸ NM_001427215
- UniProtKB:
A6JER2 (UniProtKB/TrEMBL), E9PU15 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-01-27
Dicer1
dicer 1 ribonuclease III
Dicer1
dicer 1, ribonuclease type III
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-09-26
Dicer1
dicer 1, ribonuclease type III
Dicer1
Dicer1, Dcr-1 homolog (Drosophila)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-12-06
Dicer1
Dicer1, Dcr-1 homolog (Drosophila)
Dicer1_predicted
Dicer1, Dcr-1 homolog (Drosophila) (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Dicer1_predicted
Dicer1, Dcr-1 homolog (Drosophila) (predicted)
Symbol and Name status set to approved
70820 APPROVED
