Advanced Search (OLGA)

Gene: Atp6v0d2 (ATPase H+ transporting V0 subunit D2) Rattus norvegicus

Analyze

Symbol:

Atp6v0d2

Name:

ATPase H+ transporting V0 subunit D2

RGD ID:

1306900

Description:

Predicted to enable proton-transporting ATPase activity, rotational mechanism. Predicted to be involved in vacuolar acidification and vacuolar transport. Located in apical plasma membrane and endosome. Orthologous to human ATP6V0D2 (ATPase H+ transporting V0 subunit d2); PARTICIPATES IN oxidative phosphorylation pathway; phagocytosis pathway; rheumatoid arthritis pathway; INTERACTS WITH 1-naphthyl isothiocyanate; acrylamide; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d2; ATPase, H+ transporting, lysosomal V0 subunit D2; ATPase, H+ transporting, V0 subunit D; ATPase, H+ transporting, V0 subunit D, isoform 2; LOC297932; MGC109196; V-ATPase subunit d 2; V-type proton ATPase subunit d 2; vacuolar proton pump subunit d 2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ATP6V0D2 (ATPase H+ transporting V0 subunit d2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Atp6v0d2 (ATPase, H+ transporting, lysosomal V0 subunit D2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Atp6v0d2 (ATPase H+ transporting V0 subunit d2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ATP6V0D2 (ATPase H+ transporting V0 subunit d2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ATP6V0D2 (ATPase H+ transporting V0 subunit d2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Atp6v0d2 (ATPase H+ transporting V0 subunit d2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ATP6V0D2 (ATPase H+ transporting V0 subunit d2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ATP6V0D2 (ATPase H+ transporting V0 subunit d2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Atp6v0d2 (ATPase H+ transporting V0 subunit d2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Atp6v0d2 (ATPase H+ transporting V0 subunit d2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	ATP6V0D2 (ATPase H+ transporting V0 subunit d2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Atp6v0d2 (ATPase, H+ transporting, lysosomal V0 subunit D2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	VMA6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	VMA6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	VhaAC39-1	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	VhaAC39-1	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	vha-16	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	vha-16	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	atp6v0d2	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	atp6v0d2	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	38,133,151 - 38,182,245 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	38,133,158 - 38,182,245 (-)	Ensembl				GRCr8
mRatBN7.2	5	33,336,257 - 33,385,354 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	33,336,264 - 33,385,354 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	35,456,598 - 35,505,752 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	37,048,803 - 37,097,953 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	36,988,308 - 37,037,462 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	33,843,591 - 33,892,446 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	33,843,519 - 33,892,462 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	38,499,081 - 38,547,691 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	34,476,045 - 34,524,995 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	32,423,635 - 32,472,662 (-)	NCBI		Celera
RGSC_v3.1	5	34,476,226 - 34,525,174 (-)	NCBI
Cytogenetic Map	5	q13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

ovarian cyst (ISO)

Stomach Neoplasms (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,1-dichloroethene (ISO)

1,4-dioxane (ISO)

1-naphthyl isothiocyanate (EXP)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2-aminopurine (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

3,4-dichloroaniline (ISO)

4,4'-sulfonyldiphenol (ISO)

acrylamide (EXP)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

Aroclor 1254 (ISO)

avobenzone (ISO)

Azoxymethane (ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

bromobenzene (EXP)

cadmium atom (EXP,ISO)

cadmium dichloride (EXP,ISO)

carbon nanotube (EXP,ISO)

choline (ISO)

cis-caffeic acid (ISO)

cisplatin (ISO)

clothianidin (ISO)

copper atom (ISO)

copper(0) (ISO)

cyclosporin A (ISO)

desferrioxamine B (ISO)

dextran sulfate (ISO)

dimethyl fumarate (ISO)

dioxygen (ISO)

diuron (ISO)

dorsomorphin (ISO)

endosulfan (EXP)

eugenol (EXP)

fenamidone (ISO)

folic acid (ISO)

furan (EXP,ISO)

GW 4064 (ISO)

indole-3-methanol (EXP)

L-methionine (ISO)

lidocaine (EXP)

lipopolysaccharide (ISO)

mangiferin (ISO)

metformin (EXP)

methapyrilene (ISO)

methotrexate (ISO)

methylmercury chloride (ISO)

Mitoquinone (ISO)

N-acetyl-L-cysteine (EXP,ISO)

N-nitrosodiethylamine (EXP)

naringin (ISO)

niclosamide (ISO)

okadaic acid (ISO)

osimertinib (EXP)

ozone (ISO)

panobinostat (ISO)

perfluorooctane-1-sulfonic acid (ISO)

permethrin (ISO)

phenobarbital (ISO)

pravastatin (EXP,ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 203580 (ISO)

SB 431542 (ISO)

sclareol (ISO)

silicon dioxide (EXP,ISO)

sodium arsenite (ISO)

sotorasib (ISO)

styrene (EXP)

succimer (ISO)

sulforaphane (ISO)

tamoxifen (ISO)

Testosterone propionate (ISO)

tetrachloroethene (ISO)

tetrachloromethane (ISO)

thapsigargin (ISO)

thioacetamide (EXP)

titanium dioxide (EXP,ISO)

trametinib (ISO)

trans-caffeic acid (ISO)

tremolite asbestos (ISO)

trichostatin A (ISO)

urethane (ISO)

valproic acid (ISO)

zaragozic acid A (EXP,ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

monoatomic ion transport (IEA)

proton transmembrane transport (IEA)

vacuolar acidification (IBA)

vacuolar transport (IBA)

Cellular Component

apical plasma membrane (IDA,IEA,ISO,ISS)

early endosome (IBA,IEA,ISO)

endosome (IDA,IEA)

membrane (IEA,ISO)

plasma membrane proton-transporting V-type ATPase complex (IBA)

proton-transporting V-type ATPase, V0 domain (IEA)

vacuolar proton-transporting V-type ATPase complex (IBA,IEA,ISO)

Molecular Function

protein binding (ISO)

proton-transporting ATPase activity, rotational mechanism (IBA,IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

oxidative phosphorylation pathway (IEA)

phagocytosis pathway (IEA)

rheumatoid arthritis pathway (IEA)

tuberculosis pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Distinct expression patterns of different subunit isoforms of the V-ATPase in the rat epididymis.	Pietrement C, etal., Biol Reprod. 2006 Jan;74(1):185-94. Epub 2005 Sep 28.
5.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
6.	GOA pipeline	RGD automated data pipeline
7.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Comprehensive gene review and curation	RGD comprehensive gene curation
10.	Vacuolar H+-ATPase d2 subunit: molecular characterization, developmental regulation, and localization to specialized proton pumps in kidney and bone.	Smith AN, etal., J Am Soc Nephrol. 2005 May;16(5):1245-56. Epub 2005 Mar 30.

Additional References at PubMed

PMID:9670047	PMID:12477932	PMID:18752060	PMID:19056867	PMID:23376485

Genomics

Comparative Map Data

Atp6v0d2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	38,133,151 - 38,182,245 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	38,133,158 - 38,182,245 (-)	Ensembl				GRCr8
mRatBN7.2	5	33,336,257 - 33,385,354 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	33,336,264 - 33,385,354 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	35,456,598 - 35,505,752 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	37,048,803 - 37,097,953 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	36,988,308 - 37,037,462 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	33,843,591 - 33,892,446 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	33,843,519 - 33,892,462 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	38,499,081 - 38,547,691 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	34,476,045 - 34,524,995 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	32,423,635 - 32,472,662 (-)	NCBI		Celera
RGSC_v3.1	5	34,476,226 - 34,525,174 (-)	NCBI
Cytogenetic Map	5	q13	NCBI

ATP6V0D2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	8	86,098,910 - 86,154,225 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	8	85,987,323 - 86,154,227 (+)	Ensembl			hg38	GRCh38
GRCh37	8	87,111,139 - 87,166,454 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	8	87,180,255 - 87,235,570 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	8	87,180,254 - 87,235,570	NCBI
Celera	8	83,305,507 - 83,360,717 (+)	NCBI		Celera
Cytogenetic Map	8	q21.3	NCBI
HuRef	8	82,320,757 - 82,376,003 (+)	NCBI		HuRef
CHM1_1	8	87,152,442 - 87,207,669 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	8	87,216,307 - 87,271,615 (+)	NCBI		T2T-CHM13v2.0

Atp6v0d2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	19,876,838 - 19,922,566 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	19,876,841 - 19,922,605 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	4	19,876,838 - 19,922,566 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	19,876,841 - 19,922,605 (-)	Ensembl			mm10	GRCm38
MGSCv37	4	19,803,985 - 19,849,713 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	4	19,803,988 - 19,849,713 (-)	NCBI		MGSCv36	mm8
Celera	4	19,634,311 - 19,678,717 (-)	NCBI		Celera
Cytogenetic Map	4	A3	NCBI
cM Map	4	7.67	NCBI

Atp6v0d2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955417	3,778,462 - 3,836,672 (+)	Ensembl
ChiLan1.0	NW_004955417	3,778,587 - 3,832,973 (+)	NCBI	ChiLan1.0	ChiLan1.0

ATP6V0D2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	7	103,507,650 - 103,563,060 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	8	79,045,991 - 79,101,384 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	8	82,800,353 - 82,855,741 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	8	84,771,532 - 84,826,406 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	8	84,771,427 - 84,826,406 (+)	Ensembl			panPan2	panpan1.1

ATP6V0D2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	29	32,336,304 - 32,378,818 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	29	32,336,467 - 32,378,527 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	29	32,557,003 - 32,599,242 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	29	32,491,620 - 32,533,856 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	29	32,491,605 - 32,533,570 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	29	32,535,987 - 32,578,019 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	29	32,560,242 - 32,602,461 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	29	32,980,580 - 33,022,805 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Atp6v0d2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	46,973,049 - 47,018,648 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936544	774,125 - 819,244 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936544	774,154 - 819,189 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ATP6V0D2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	50,694,189 - 50,749,378 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	4	50,694,188 - 50,749,373 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	55,660,240 - 55,715,444 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ATP6V0D2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	8	81,280,642 - 81,336,945 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	8	81,280,888 - 81,337,106 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666039	59,615,834 - 59,691,705 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Atp6v0d2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624744	5,617,711 - 5,664,006 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624744	5,618,144 - 5,663,794 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Atp6v0d2
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	1	123,830,126 - 123,877,025 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Atp6v0d2
622 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	29
Count of miRNA genes:	27
Interacting mature miRNAs:	29
Transcripts:	ENSRNOT00000009334
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2293666	Bmd38	Bone mineral density QTL 38	4.4		femur size trait (VT:1000369)	femoral neck cortical cross-sectional area (CMO:0001702)	5	13731153	43590997	Rat
1578776	Stresp18	Stress response QTL 18	2.9		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	5	32751649	77751649	Rat
1298067	Scl15	Serum cholesterol level QTL 15	4.8	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	38011670	83011670	Rat
6907115	Mcs29	Mammary carcinoma susceptibility QTL 29			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	38004331	83004331	Rat
1358353	Srcrtb2	Stress Responsive Cort Basal QTL 2	3.48	0.003	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	23671493	79046465	Rat
1300117	Hrtrt8	Heart rate QTL 8	3.49		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	5	8627230	52665523	Rat
634305	Mamtr1	Mammary tumor resistance QTL 1		0.0001	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	17576633	62576633	Rat
1578774	Tcas8	Tongue tumor susceptibility QTL 8	3.47		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	15707451	60707451	Rat
1598807	Glom12	Glomerulus QTL 12	2.7		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	5	38011670	83011670	Rat
1302786	Kidm8	Kidney mass QTL 8	28.15		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	5	38011670	83011670	Rat
6903292	Stl28	Serum triglyceride level QTL 28	2.6	0.0073	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	5	33311673	78311673	Rat
1578767	Stresp17	Stress response QTL 17	4.3	0.01	blood aldosterone amount (VT:0005346)	plasma aldosterone level (CMO:0000551)	5	32751649	77751649	Rat
1549901	Neudeg2	Neurodegradation QTL 2	4	0	nervous system integrity trait (VT:0010566)	mononuclear cell count (CMO:0002119)	5	31130421	48841739	Rat
1641922	Alcrsp8	Alcohol response QTL 8			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	5	17486080	62486080	Rat
2313085	Bss59	Bone structure and strength QTL 59	2.9	0.0001	long bone metaphysis morphology trait (VT:0000133)	tibia midshaft total cross-sectional area (CMO:0001715)	5	8627230	53627230	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	6922282	81330203	Rat
6903306	Scl35	Serum cholesterol QTL 35	2.6	0.0073	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	33311673	78311673	Rat
7394712	Emca13	Estrogen-induced mammary cancer QTL 13			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	14606078	59606078	Rat
1331771	Rf35	Renal function QTL 35	4.36965		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	10019064	91770353	Rat
8662454	Vetf3	Vascular elastic tissue fragility QTL 3	27.4		artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	5	7065535	74335773	Rat
2290448	Scl54	Serum cholesterol level QTL 54	2.93		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	36460764	136631402	Rat
1641903	Alcrsp3	Alcohol response QTL 3			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	17486080	62486080	Rat
1331756	Rf34	Renal function QTL 34	4.16275		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	10019064	87027358	Rat
8552954	Pigfal14	Plasma insulin-like growth factor 1 level QTL 14	9		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	26023211	71023211	Rat
2303577	Gluco47	Glucose level QTL 47	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	16520019	61520019	Rat
1600358	Mamtr5	Mammary tumor resistance QTL 5			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	23671493	68671493	Rat

Markers in Region

D5Uwm51

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	5	38,147,362 - 38,147,555 (+)	Marker Load Pipeline
mRatBN7.2	5	33,350,468 - 33,350,661 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	33,857,805 - 33,857,997	NCBI	Rnor6.0
Rnor_5.0	5	38,513,291 - 38,513,483	UniSTS	Rnor5.0
RGSC_v3.4	5	34,490,257 - 34,490,449	UniSTS	RGSC3.4
RGSC_v3.4	5	34,490,256 - 34,490,449	RGD	RGSC3.4
Celera	5	32,437,836 - 32,438,028	UniSTS
RGSC_v3.1	5	34,490,435 - 34,490,628	RGD
Cytogenetic Map	5	q13	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
14	9	7	98	56	63	37	8	37	6	176	38	11	83	81	65	26	9	9

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001011972	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC110971	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC089917	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473962	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000009334 ⟹ ENSRNOP00000009334

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	38,133,158 - 38,182,245 (-)	Ensembl
mRatBN7.2 Ensembl	5	33,336,264 - 33,385,354 (-)	Ensembl
Rnor_6.0 Ensembl	5	33,843,519 - 33,892,462 (-)	Ensembl

RefSeq Acc Id:

NM_001011972 ⟹ NP_001011972

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	38,133,151 - 38,182,245 (-)	NCBI
mRatBN7.2	5	33,336,257 - 33,385,354 (-)	NCBI
Rnor_6.0	5	33,843,591 - 33,892,446 (-)	NCBI
Rnor_5.0	5	38,499,081 - 38,547,691 (-)	NCBI
RGSC_v3.4	5	34,476,045 - 34,524,995 (-)	RGD
Celera	5	32,423,635 - 32,472,662 (-)	RGD

Sequence:

show sequence

CTGACTATCAGCTGAGCGACCACGACACCCACACTTCCCCAGACCAAGGCCAGTTCAGTGGCTC
TCCAGGACTCAGAGCCGATTCAGCCTGAGCAAGATGCTTGAGACGGCAGAGCTGTACTTCAATG
TGGACCATGGCTACCTGGAGGGCCTGGTGCGAGGGTGCAAAGCCAGCCTCCTAACTCAGCAGGA
CTATGTCAACTTAGTGCAGTGTGAGACCTTGGAAGATTTGAAAATTCATCTCCAGACCACTGAC
TATGGCAACTTCCTGGCTCATGAAACAAACCCTCTCACTGTTTCCAAAATTGACACGGAGATGA
GGAAGAAGCTATGCAGAGAGTTTGACTATTTCCGAAATCATTCCTTGGAGCCCCTCAGCACATT
TTTCACCTACATGACGTGCAGCTATATGATAGACAACATAATTCTACTGATGAATGGGGCATTG
CAAAAGAAATCCGTGAAAGAAGTTCTAGCCAAGTGTCACCCATTGGGCCGCTTCACTGAAATGG
AAGCCGTCAACATTGCAGAGAGCGCCTCAGAGCTCTTCAAGGCTGTGCTGGTTGAAACACCATT
AGCTCCATTCTTCCAAGATTGTATGTCTGAAAATACTCTTGATGAACTGAATATTGAATTACTG
CGCAATAAACTATACAAGTCTTACCTCGAGGCATTCTACAAATTCTGCAAGGATCACGGTGATG
TCACAGCAGAAGTTATGTGTCCCATTCTTGAGTTTGAGGCCGACAGACGCGCTTTAATCATCAC
TCTGAACTCATTTGGCACTGAACTGAGCAAAGAAGACAGGGAGACCCTCTTCCCCACCTGCGGC
AAGCTCTATCCGGAGGGACTGCGGCTGTTAGCCCAAGCCGAAGACTTCGAGCACATGAAGAGAG
TGGCAGATAATTACGGAGTTTACAAGCCTTTGTTTGACGCCGTAGGTGGCAGTGGGGGAAAGAC
ACTGGAAGATGTTTTCTATGAGCGAGAGGTACAGATGAATGTGCTGGCGTTCAACAGGCAATTC
CACTATGGTGTGTTTTATGCCTATGTAAAGTTGAAGGAGCAGGAGATGAGAAATATCGTGTGGA
TAGCAGAATGCATCTCACAGCGACATCGAACTAAAATCAACAGCTACATTCCAATTTTATAAGC
CAGGTTGGAGGCCACAAGTGCAGAAATGACAGGAAGTTATTGAACAAAGGAAAGGGGATTGTGT
TACATTATGTAGATTATATAAAAGTCAGTCATACCACTTTTCTCTGAACTGTGTGTCCACTGGA
AGCCCAGTAAACAGACTTGAAACAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001011972	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH89917	(Get FASTA)	NCBI Sequence Viewer
	EDL98503	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000009334
	ENSRNOP00000009334.5
GenBank Protein	Q5FVL0	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001011972 ⟸ NM_001011972

- UniProtKB:

Q5FVL0 (UniProtKB/Swiss-Prot), A6IID3 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MLETAELYFNVDHGYLEGLVRGCKASLLTQQDYVNLVQCETLEDLKIHLQTTDYGNFLAHETNP
LTVSKIDTEMRKKLCREFDYFRNHSLEPLSTFFTYMTCSYMIDNIILLMNGALQKKSVKEVLAK
CHPLGRFTEMEAVNIAESASELFKAVLVETPLAPFFQDCMSENTLDELNIELLRNKLYKSYLEA
FYKFCKDHGDVTAEVMCPILEFEADRRALIITLNSFGTELSKEDRETLFPTCGKLYPEGLRLLA
QAEDFEHMKRVADNYGVYKPLFDAVGGSGGKTLEDVFYEREVQMNVLAFNRQFHYGVFYAYVKL
KEQEMRNIVWIAECISQRHRTKINSYIPIL

hide sequence

Ensembl Acc Id:

ENSRNOP00000009334 ⟸ ENSRNOT00000009334

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5FVL0-F1-model_v2	AlphaFold	Q5FVL0	1-350	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693590

Promoter ID:

EPDNEW_R4115

Type:

initiation region

Name:

Atp6v0d2_1

Description:

ATPase H+ transporting V0 subunit D2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	33,892,459 - 33,892,519	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1306900	AgrOrtholog
BioCyc Gene	G2FUF-41834	BioCyc
BioCyc Pathway	PWY-7980 [ATP biosynthesis]	BioCyc
BioCyc Pathway Image	PWY-7980	BioCyc
Ensembl Genes	ENSRNOG00000006926	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000009334	ENTREZGENE
	ENSRNOT00000009334.7	UniProtKB/Swiss-Prot
Gene3D-CATH	1.10.132.50	UniProtKB/Swiss-Prot
	1.20.1690.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7306609	IMAGE-MGC_LOAD
InterPro	ATPase_su_C-like	UniProtKB/Swiss-Prot
	ATPase_V0-cplx_csu/dsu	UniProtKB/Swiss-Prot
	ATPase_V0-cplx_dsu	UniProtKB/Swiss-Prot
	V-type_ATPase_su_c/d_dom_3	UniProtKB/Swiss-Prot
	V-type_ATPase_suC	UniProtKB/Swiss-Prot
KEGG Report	rno:297932	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:109196	IMAGE-MGC_LOAD
NCBI Gene	297932	ENTREZGENE
PANTHER	PTHR11028	UniProtKB/Swiss-Prot
Pfam	vATP-synt_AC39	UniProtKB/Swiss-Prot
PhenoGen	Atp6v0d2	PhenoGen
PIRSF	V-ATP_synth_D	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000006926	RatGTEx
Superfamily-SCOP	SSF103486	UniProtKB/Swiss-Prot
UniProt	A6IID3	ENTREZGENE, UniProtKB/TrEMBL
	Q5FVL0	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-02-25	Atp6v0d2	ATPase H+ transporting V0 subunit D2	Atp6v0d2	ATPase, H+ transporting, lysosomal V0 subunit D2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2011-04-27	Atp6v0d2	ATPase, H+ transporting, lysosomal V0 subunit D2	Atp6v0d2	ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-25	Atp6v0d2	ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d2	Atp6v0d2	ATPase, H+ transporting, lysosomal V0 subunit D2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-03	Atp6v0d2	ATPase, H+ transporting, lysosomal V0 subunit D2	Atp6v0d2	ATPase, H+ transporting, V0 subunit D, isoform 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Atp6v0d2	ATPase, H+ transporting, V0 subunit D, isoform 2	Atp6v0d2_predicted	ATPase, H+ transporting, V0 subunit D, isoform 2 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Atp6v0d2_predicted	ATPase, H+ transporting, V0 subunit D, isoform 2 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

BioCyc Pathways

Send us a Message

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

BioCyc Pathways