Advanced Search (OLGA)

Gene: Tyrobp (transmembrane immune signaling adaptor Tyrobp) Rattus norvegicus

Analyze

Symbol:

Tyrobp

Name:

transmembrane immune signaling adaptor Tyrobp

RGD ID:

1303081

Description:

Predicted to enable protein homodimerization activity; protein-macromolecule adaptor activity; and signaling receptor binding activity. Predicted to be involved in several processes, including cell surface receptor signaling pathway; myeloid cell activation involved in immune response; and regulation of cytokine production. Predicted to act upstream of or within several processes, including cellular response to amyloid-beta; osteoclast differentiation; and regulation of type I interferon production. Predicted to be located in plasma membrane. Predicted to be active in cell surface. Biomarker of rheumatoid arthritis. Human ortholog(s) of this gene implicated in Nasu-Hakola disease. Orthologous to human TYROBP (transmembrane immune signaling adaptor TYROBP); INTERACTS WITH 1-naphthyl isothiocyanate; 17beta-estradiol; 17beta-estradiol 3-benzoate.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

DAP12; DNAX-activation protein 12; Karap; killer cell activating receptor-associated protein; LOC361537; Tyro protein tyrosine kinase binding protein; TYRO protein tyrosine kinase-binding protein

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	94,800,372 - 94,804,307 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	94,800,117 - 94,804,299 (+)	Ensembl				GRCr8
mRatBN7.2	1	85,672,931 - 85,676,856 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	85,672,994 - 85,676,848 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	91,088,757 - 91,092,672 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	99,556,044 - 99,559,908 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	92,847,020 - 92,850,937 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	88,875,370 - 88,879,305 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	88,875,375 - 88,879,303 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	90,031,123 - 90,034,976 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	85,365,371 - 85,369,224 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	80,045,174 - 80,049,027 (+)	NCBI		Celera
RGSC_v3.1	1	85,443,481 - 85,447,330 (+)	NCBI
Cytogenetic Map	1	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Desbuquois dysplasia (ISO)

Experimental Liver Cirrhosis (ISO)

genetic disease (ISO)

liver disease (ISO)

Memory Disorders (ISO)

Nasu-Hakola disease (ISO,ISS)

rheumatoid arthritis (IEP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,1-dichloroethene (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

1-chloro-2,4-dinitrobenzene (ISO)

1-naphthyl isothiocyanate (EXP)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

17beta-estradiol 3-benzoate (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-trinitrobenzenesulfonic acid (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2-butoxyethanol (ISO)

3-chloropropane-1,2-diol (EXP)

4,4'-diaminodiphenylmethane (EXP)

4,4'-sulfonyldiphenol (ISO)

5-aza-2'-deoxycytidine (ISO)

6-propyl-2-thiouracil (EXP)

7,12-dimethyltetraphene (ISO)

acetamide (EXP)

acrylamide (EXP)

actinomycin D (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

alpha-amanitin (ISO)

amitrole (EXP)

amphetamine (EXP)

antirheumatic drug (ISO)

bathocuproine disulfonic acid (ISO)

benzo[a]pyrene (ISO)

Benzo[k]fluoranthene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

calcitriol (ISO)

carbon nanotube (ISO)

choline (ISO)

cisplatin (ISO)

copper atom (EXP)

copper(0) (EXP)

Cuprizon (EXP)

curcumin (ISO)

cyclophosphamide (ISO)

cyclosporin A (ISO)

dexamethasone (ISO)

dextran sulfate (ISO)

dibenz[a,h]anthracene (ISO)

dibenzo[a,l]pyrene (ISO)

diclofenac (ISO)

dicyclanil (ISO)

diethylstilbestrol (ISO)

dioxygen (EXP,ISO)

diquat (ISO)

doxorubicin (ISO)

entinostat (ISO)

fluoranthene (ISO)

flutamide (EXP)

folic acid (ISO)

genistein (ISO)

gentamycin (EXP)

GSK-J4 (ISO)

ionomycin (ISO)

irinotecan (ISO)

Jujuboside A (ISO)

kainic acid (ISO)

L-methionine (ISO)

lidocaine (EXP)

lipopolysaccharide (ISO)

methimazole (EXP)

methotrexate (ISO)

midazolam (ISO)

N-nitrosodiethylamine (EXP)

N-nitrosodimethylamine (EXP)

nickel atom (ISO)

Nutlin-3 (ISO)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenylarsine oxide (ISO)

phorbol 13-acetate 12-myristate (ISO)

pirinixic acid (ISO)

pyrrolidine dithiocarbamate (ISO)

resveratrol (EXP)

rotenone (EXP)

sodium arsenite (ISO)

sodium fluoride (EXP)

streptozocin (EXP)

sulforaphane (ISO)

tamibarotene (ISO)

testosterone (EXP)

tetrachloromethane (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trimellitic acid (ISO)

triphenyl phosphate (ISO)

troglitazone (ISO)

tungsten (ISO)

valproic acid (ISO)

vancomycin (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

actin cytoskeleton organization (ISO)

amyloid-beta clearance (IEA,ISO)

apoptotic cell clearance (ISO,ISS)

cell surface receptor signaling pathway (IEA)

cellular response to amyloid-beta (IEA,ISO)

defense response (IEA)

forebrain development (ISO)

immune effector process (IEA)

immune response (IEA)

immune system process (IEA)

integrin-mediated signaling pathway (ISO)

macrophage activation involved in immune response (ISO)

microglial cell activation involved in immune response (IBA,ISO)

myeloid leukocyte activation (IEA,ISO)

natural killer cell mediated immunity (IEA,ISO)

negative regulation of B cell proliferation (IBA,IEA,ISO)

negative regulation of cytokine production (IEA)

negative regulation of interleukin-10 production (ISO)

negative regulation of long-term synaptic potentiation (ISO)

negative regulation of transforming growth factor beta1 production (IBA,ISO)

negative regulation of type I interferon production (IEA,ISO)

neutrophil activation involved in immune response (IBA,ISO)

osteoclast differentiation (IEA,ISO)

positive regulation of gene expression (ISO)

positive regulation of immune system process (IEA)

positive regulation of interleukin-1 beta production (ISO)

positive regulation of interleukin-6 production (ISO)

positive regulation of macrophage fusion (IBA,IEA,ISO)

positive regulation of microglial cell mediated cytotoxicity (IBA,ISO)

positive regulation of natural killer cell activation (IBA,ISO)

positive regulation of osteoclast development (ISO)

positive regulation of protein localization to cell surface (IEA,ISO)

positive regulation of receptor localization to synapse (ISO)

positive regulation of superoxide anion generation (ISO)

positive regulation of tumor necrosis factor production (ISO)

protein stabilization (IEA,ISO)

regulation of osteoclast development (ISO)

response to axon injury (ISO)

semaphorin-plexin signaling pathway (ISO,ISS)

stimulatory C-type lectin receptor signaling pathway (IEA,ISO,ISS)

stimulatory killer cell immunoglobulin-like receptor signaling pathway (IEA,ISO,ISS)

T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell (ISO,ISS)

Cellular Component

cell surface (IBA,IEA,ISO,ISS)

plasma membrane (IEA,ISO,ISS)

Molecular Function

identical protein binding (IEA,ISO)

metal ion binding (IEA)

molecular adaptor activity (IEA,ISO)

protein binding (IPI,ISO)

protein homodimerization activity (IEA,ISO,ISS)

protein-macromolecule adaptor activity (IEA,ISO)

signaling receptor binding (IBA,IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Triptolide Modulates TREM-1 Signal Pathway to Inhibit the Inflammatory Response in Rheumatoid Arthritis.	Fan D, etal., Int J Mol Sci. 2016 Apr 2;17(4):498. doi: 10.3390/ijms17040498.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Ly-49s3 is a promiscuous activating rat NK cell receptor for nonclassical MHC class I-encoded target ligands.	Naper C, etal., J Immunol 2002 Jul 1;169(1):22-30.
4.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
5.	GOA pipeline	RGD automated data pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	Gene structure, expression pattern, and biological activity of mouse killer cell activating receptor-associated protein (KARAP)/DAP-12.	Tomasello E, etal., J Biol Chem 1998 Dec 18;273(51):34115-9.

Additional References at PubMed

PMID:9647200	PMID:10604985	PMID:11602640	PMID:14969392	PMID:15294961	PMID:15601948	PMID:15728241	PMID:17086186	PMID:18685038	PMID:18691974	PMID:18957693	PMID:20890284
PMID:21727189	PMID:21841309	PMID:22084441	PMID:22451653	PMID:23715743	PMID:25690660	PMID:25957402	PMID:29518356	PMID:38639190

Genomics

Comparative Map Data

Tyrobp
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	94,800,372 - 94,804,307 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	94,800,117 - 94,804,299 (+)	Ensembl				GRCr8
mRatBN7.2	1	85,672,931 - 85,676,856 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	85,672,994 - 85,676,848 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	91,088,757 - 91,092,672 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	99,556,044 - 99,559,908 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	92,847,020 - 92,850,937 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	88,875,370 - 88,879,305 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	88,875,375 - 88,879,303 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	90,031,123 - 90,034,976 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	85,365,371 - 85,369,224 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	80,045,174 - 80,049,027 (+)	NCBI		Celera
RGSC_v3.1	1	85,443,481 - 85,447,330 (+)	NCBI
Cytogenetic Map	1	q21	NCBI

TYROBP
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	35,904,403 - 35,908,295 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	35,904,401 - 35,908,301 (-)	Ensembl			hg38	GRCh38
GRCh37	19	36,395,305 - 36,399,197 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	41,087,143 - 41,091,026 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	19	41,087,143 - 41,091,026	NCBI
Celera	19	33,109,494 - 33,113,402 (-)	NCBI		Celera
Cytogenetic Map	19	q13.12	NCBI
HuRef	19	32,900,548 - 32,904,456 (-)	NCBI		HuRef
CHM1_1	19	36,396,596 - 36,400,504 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	19	38,450,168 - 38,454,060 (-)	NCBI		T2T-CHM13v2.0

Tyrobp
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	30,113,207 - 30,117,007 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	30,113,185 - 30,117,010 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	7	30,413,782 - 30,417,582 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	30,413,760 - 30,417,585 (+)	Ensembl			mm10	GRCm38
MGSCv37	7	31,198,807 - 31,202,601 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	7	30,122,548 - 30,126,342 (+)	NCBI		MGSCv36	mm8
Celera	7	25,005,487 - 25,009,294 (+)	NCBI		Celera
Cytogenetic Map	7	B1	NCBI
cM Map	7	17.45	NCBI

Tyrobp
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955468	2,673,980 - 2,677,321 (+)	Ensembl
ChiLan1.0	NW_004955468	2,673,657 - 2,677,633 (+)	NCBI	ChiLan1.0	ChiLan1.0

TYROBP
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	41,902,807 - 41,907,241 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	43,887,571 - 43,891,929 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	32,821,279 - 32,825,488 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	41,570,674 - 41,575,226 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	41,570,683 - 41,575,226 (-)	Ensembl			panPan2	panpan1.1

TYROBP
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	116,757,271 - 116,760,453 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	116,757,289 - 116,772,325 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	116,162,854 - 116,166,018 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	117,360,454 - 117,363,633 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	117,359,870 - 117,363,633 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	116,924,025 - 116,927,189 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	116,547,561 - 116,550,722 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	117,603,321 - 117,606,485 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Tyrobp
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	11,185,145 - 11,187,925 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936570	458,054 - 460,579 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936570	457,993 - 460,735 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TYROBP
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	45,309,201 - 45,312,539 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	6	45,309,199 - 45,312,562 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	40,711,873 - 40,716,395 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TYROBP
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	30,816,675 - 30,820,816 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	30,816,678 - 30,820,597 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666073	8,609,470 - 8,613,375 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tyrobp
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624794	10,183,515 - 10,187,244 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624794	10,183,934 - 10,187,180 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Tyrobp
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	2	165,586,803 - 165,591,263 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Tyrobp
4 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	86
Count of miRNA genes:	71
Interacting mature miRNAs:	72
Transcripts:	ENSRNOT00000028284
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	51940904	101229020	Rat
1582234	Gluco18	Glucose level QTL 18	3.4	0.0003	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	87889942	132889942	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	51941022	208479811	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	39728272	132889942	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	51940904	168768703	Rat
2300324	Fetw1	Fetal weight QTL 1	12.1	0.005	fetal growth trait (VT:0004201)	fetal body weight (CMO:0002080)	1	92963855	109494029	Rat
1331800	Scl25	Serum cholesterol level QTL 25	3.013		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	87785026	142582336	Rat
7421628	Bp361	Blood pressure QTL 361		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	83019780	128019780	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	66404680	111404680	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34184556	172281316	Rat
631512	Scl6	Serum cholesterol level QTL 6	9.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	81269860	99645535	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	66009857	160501508	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34565911	208798288	Rat
631519	Pia11	Pristane induced arthritis QTL 11	5.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	93903998	191260518	Rat
1302788	Scl19	Serum cholesterol QTL 19	4.6	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	66400974	132889942	Rat
1549903	Bp267	Blood pressure QTL 267			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	84107164	115183752	Rat
2313083	Bmd74	Bone mineral density QTL 74	4	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	91302413	136302413	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	51511344	153680016	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	65405637	96805205	Rat
1358192	Ept13	Estrogen-induced pituitary tumorigenesis QTL 13	3.4		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	86622262	131622262	Rat
6903308	Scl36	Serum cholesterol QTL 36	2	0.0125	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	58769992	103769992	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	66077886	111077886	Rat
738022	Anxrr13	Anxiety related response QTL 13	4.6	0.00039	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of, or within a discrete space in an open field apparatus (CMO:0001514)	1	92683681	137683681	Rat
10054135	Gmadr2	Adrenal mass QTL 2	1.97	0.0129	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	86993904	131993904	Rat
152025249	Scl82	Serum cholesterol level QTL 82	4.77		blood cholesterol amount (VT:0000180)		1	52891222	109116986	Rat
1331749	Hrtrt11	Heart rate QTL 11	2.973		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	92683681	137683681	Rat
7411712	Strs4	Sensitivity to stroke QTL 4	8.7		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	1	87558587	132558587	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	159	91	90	59	92	59	6	356	192	11	137	81	92	31	11	11

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_212525	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008759166	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AY247021	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ211365	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000028284 ⟹ ENSRNOP00000028284

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	94,800,117 - 94,804,299 (+)	Ensembl
mRatBN7.2 Ensembl	1	85,672,994 - 85,676,848 (+)	Ensembl
Rnor_6.0 Ensembl	1	88,875,375 - 88,879,303 (+)	Ensembl

RefSeq Acc Id:

NM_212525 ⟹ NP_997690

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	94,800,451 - 94,804,304 (+)	NCBI
mRatBN7.2	1	85,673,000 - 85,676,853 (+)	NCBI
Rnor_6.0	1	88,875,449 - 88,879,302 (+)	NCBI
Rnor_5.0	1	90,031,123 - 90,034,976 (+)	NCBI
RGSC_v3.4	1	85,365,371 - 85,369,224 (+)	RGD
Celera	1	80,045,174 - 80,049,027 (+)	RGD

Sequence:

show sequence

CTGGCCACCATGGGGGCCCCAGAGCCCTCCTGGTGCTTTCTGTTCCTTCCTGTCCTCCTGACTG
TGGGAGGATTAAGTCCCGTACAGGCCCAGAGTGACAATTACCCAGGATGCGAATGTTCCTCTGT
GAGCCCGGGTGTACTGGCTGGGATTGTGCTGGGCGACTTGGTGCTGACTCTGCTCATCGCCCTG
GCGGTGTACTCTCTGGGCCGCCTGGTCTCTCGAGGCCGAGGGACTGCAGACGGGACCCGGAAAC
AGCACATGGCTGAGACTGAGTCACCTTATCAGGAGCTTCAGGGTCAGAGGCCAGAAGTATACAG
TGACCTCAACACACAGAGGCAGTATTACAGATGAACCCACCCTATGCCCACCAACAACCTGATG
CCCGGATCCACTCATTCCAGACGCTTACTCAACAAACCCTCCCTGGGATCAGGACTCCCGCTGG
AATAAATATCCACAGAGTGCCCTCTGGGAGATATCTGACCTTGTACCGTTTCTGTCCCCAAATA
AAAGACGAAGCAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_008759166 ⟹ XP_008757388

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	94,800,372 - 94,804,307 (+)	NCBI
mRatBN7.2	1	85,672,931 - 85,676,856 (+)	NCBI
Rnor_6.0	1	88,875,370 - 88,879,305 (+)	NCBI

Sequence:

show sequence

CCTCAGACTTCCTCCTTCACTTGGTTGGACGTCACACCACGGCCCCACCAGCCCCTGGACTGTG
GTGTCCAGTGCACGTCTGGCCACCATGGGGGCCCCAGAGCCCTCCTGGTGCTTTCTGTTCCTTC
CTGTCCTCCTGACTGTGGGAGGATTAAGTCCCGTACAGGCCCAGAGTGGATGCGAATGTTCCTC
TGTGAGCCCGGGTGTACTGGCTGGGATTGTGCTGGGCGACTTGGTGCTGACTCTGCTCATCGCC
CTGGCGGTGTACTCTCTGGGCCGCCTGGTCTCTCGAGGCCGAGGGACTGCAGACGGGACCCGGA
AACAGCACATGGCTGAGACTGAGTCACCTTATCAGGAGCTTCAGGGTCAGAGGCCAGAAGTATA
CAGTGACCTCAACACACAGAGGCAGTATTACAGATGAACCCACCCTATGCCCACCAACAACCTG
ATGCCCGGATCCACTCATTCCAGACGCTTACTCAACAAACCCTCCCTGGGATCAGGACTCCCGC
TGGAATAAATATCCACAGAGTGCCCTCTGGGAGATATCTGACCTTGTACCGTTTCTGTCCCCAA
ATAAAAGACGAAGCAAAAACAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_997690	(Get FASTA)	NCBI Sequence Viewer
	XP_008757388	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAP79987	(Get FASTA)	NCBI Sequence Viewer
	EDM07764	(Get FASTA)	NCBI Sequence Viewer
	EDM07765	(Get FASTA)	NCBI Sequence Viewer
	EDM07766	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000028284.3
GenBank Protein	Q6X9T7	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_997690 ⟸ NM_212525
- Peptide Label:	precursor
- UniProtKB:	Q6X9T7 (UniProtKB/Swiss-Prot), A6J9W9 (UniProtKB/TrEMBL), A6J9W8 (UniProtKB/TrEMBL)
- Sequence:	show sequence MGAPEPSWCFLFLPVLLTVGGLSPVQAQSDNYPGCECSSVSPGVLAGIVLGDLVLTLLIALAVY SLGRLVSRGRGTADGTRKQHMAETESPYQELQGQRPEVYSDLNTQRQYYR hide sequence

RefSeq Acc Id:	XP_008757388 ⟸ XM_008759166
- Peptide Label:	isoform X1
- UniProtKB:	A6J9W8 (UniProtKB/TrEMBL)
- Sequence:	show sequence MGAPEPSWCFLFLPVLLTVGGLSPVQAQSGCECSSVSPGVLAGIVLGDLVLTLLIALAVYSLGR LVSRGRGTADGTRKQHMAETESPYQELQGQRPEVYSDLNTQRQYYR hide sequence

Ensembl Acc Id:

ENSRNOP00000028284 ⟸ ENSRNOT00000028284

Protein Domains

ITAM

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6X9T7-F1-model_v2	AlphaFold	Q6X9T7	1-114	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13689912

Promoter ID:

EPDNEW_R437

Type:

initiation region

Name:

Tyrobp_1

Description:

Tyro protein tyrosine kinase binding protein

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	88,875,440 - 88,875,500	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1303081	AgrOrtholog
BioCyc Gene	G2FUF-60113	BioCyc
Ensembl Genes	ENSRNOG00000020845	Ensembl, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000028284.7	UniProtKB/Swiss-Prot
Gene3D-CATH	YojJ-like	UniProtKB/Swiss-Prot
InterPro	Tyrobp	UniProtKB/Swiss-Prot
KEGG Report	rno:361537	UniProtKB/Swiss-Prot
NCBI Gene	361537	ENTREZGENE
PANTHER	PTHR17554	UniProtKB/Swiss-Prot
	TYRO PROTEIN TYROSINE KINASE-BINDING PROTEIN	UniProtKB/Swiss-Prot
PharmGKB	TYROBP	RGD
PhenoGen	Tyrobp	PhenoGen
RatGTEx	ENSRNOG00000020845	RatGTEx
UniProt	A6J9W8	ENTREZGENE, UniProtKB/TrEMBL
	A6J9W9	ENTREZGENE, UniProtKB/TrEMBL
	A6J9X0_RAT	UniProtKB/TrEMBL
	Q6X9T7	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2019-11-11	Tyrobp	transmembrane immune signaling adaptor Tyrobp	Tyrobp	Tyro protein tyrosine kinase binding protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-11	Tyrobp	Tyro protein tyrosine kinase binding protein	LOC361537	DAP12	Symbol and Name updated	1299863	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM