Gpr27 (G protein-coupled receptor 27)

Gene: Gpr27 (G protein-coupled receptor 27) Rattus norvegicus

Analyze

Symbol:

Gpr27

Name:

G protein-coupled receptor 27

RGD ID:

71067

Description:

Predicted to enable G protein-coupled receptor activity. Predicted to be involved in G protein-coupled receptor signaling pathway. Predicted to act upstream of or within positive regulation of insulin secretion involved in cellular response to glucose stimulus and positive regulation of phospholipase C-activating G protein-coupled receptor signaling pathway. Predicted to be active in plasma membrane. Orthologous to human GPR27 (G protein-coupled receptor 27); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; ammonium chloride.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

probable G-protein coupled receptor 27; Sreb1; super conserved receptor expressed in brain 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GPR27 (G protein-coupled receptor 27)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Gpr27 (G protein-coupled receptor 27)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Gpr27 (G protein-coupled receptor 27)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GPR27 (G protein-coupled receptor 27)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GPR27 (G protein-coupled receptor 27)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Gpr27 (G protein-coupled receptor 27)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GPR27 (G protein-coupled receptor 27)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GPR27 (G protein-coupled receptor 27)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Gpr27 (G protein-coupled receptor 27)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	GPR27 (G protein-coupled receptor 27)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Gpr27 (G protein-coupled receptor 27)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gpr27 (G protein-coupled receptor 27)	Alliance	DIOPT (Ensembl Compara\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	gpr27	Alliance	DIOPT (PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	133,884,894 - 133,886,027 (+)	NCBI		GRCr8
mRatBN7.2	4	132,328,364 - 132,329,497 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	132,328,364 - 132,329,497 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	137,745,693 - 137,746,826 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	133,526,475 - 133,527,608 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	132,144,746 - 132,145,879 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	132,137,793 - 132,138,926 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	132,137,793 - 132,138,926 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	196,629,031 - 196,630,164 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	134,541,534 - 134,542,667 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	134,786,374 - 134,787,508 (+)	NCBI
Celera	4	121,187,535 - 121,188,668 (+)	NCBI		Celera
Cytogenetic Map	4	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

malignant mesothelioma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

ammonium chloride (EXP)

atrazine (ISO)

belinostat (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

cisplatin (ISO)

clofibrate (ISO)

cobalt dichloride (ISO)

copper atom (EXP)

copper(0) (EXP)

dextran sulfate (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

gentamycin (EXP)

maneb (ISO)

mercury dibromide (ISO)

panobinostat (ISO)

paracetamol (EXP)

paraquat (ISO)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

resveratrol (ISO)

sarin (ISO)

SB 431542 (ISO)

sunitinib (ISO)

tetrachloromethane (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

tunicamycin (ISO)

valproic acid (ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

G protein-coupled receptor signaling pathway (IEA)

positive regulation of insulin secretion involved in cellular response to glucose stimulus (ISO)

positive regulation of phospholipase C-activating G protein-coupled receptor signaling pathway (ISO)

Cellular Component

plasma membrane (IBA,ISO)

Molecular Function

G protein-coupled receptor activity (IBA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	An evolutionarily conserved G-protein coupled receptor family, SREB, expressed in the central nervous system.	Matsumoto M, etal., Biochem Biophys Res Commun 2000 Jun 7;272(2):576-82.
4.	Gene Data Set	MGD Curation, June 12, 2002
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	GOA pipeline	RGD automated data pipeline
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Two coding regions closely linked to the rat apolipoprotein E gene: nucleotide sequences of rat apolipoprotein C-I and ECL cDNA.	Shen P and Howlett GJ, Arch Biochem Biophys 1992 Sep;297(2):345-53.

Additional References at PubMed

PMID:9479505	PMID:22253604	PMID:35326460

Genomics

Comparative Map Data

Gpr27
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	133,884,894 - 133,886,027 (+)	NCBI		GRCr8
mRatBN7.2	4	132,328,364 - 132,329,497 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	132,328,364 - 132,329,497 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	137,745,693 - 137,746,826 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	133,526,475 - 133,527,608 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	132,144,746 - 132,145,879 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	132,137,793 - 132,138,926 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	132,137,793 - 132,138,926 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	196,629,031 - 196,630,164 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	134,541,534 - 134,542,667 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	134,786,374 - 134,787,508 (+)	NCBI
Celera	4	121,187,535 - 121,188,668 (+)	NCBI		Celera
Cytogenetic Map	4	q34	NCBI

GPR27
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	71,753,855 - 71,756,496 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	71,753,855 - 71,756,496 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	3	71,803,006 - 71,805,647 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	71,885,891 - 71,887,018 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	3	71,885,890 - 71,887,018	NCBI
Celera	3	71,733,794 - 71,734,921 (+)	NCBI		Celera
Cytogenetic Map	3	p13	NCBI
CHM1_1	3	71,754,610 - 71,755,737 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	3	71,793,122 - 71,795,766 (+)	NCBI		T2T-CHM13v2.0

Gpr27
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	99,669,328 - 99,672,027 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	99,669,640 - 99,672,027 (+)	Ensembl		GRCm39 Ensembl
GRCm38	6	99,692,367 - 99,695,066 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	99,692,679 - 99,695,066 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	99,642,673 - 99,643,812 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	99,658,142 - 99,659,281 (+)	NCBI		MGSCv36	mm8
Celera	6	101,556,763 - 101,557,942 (+)	NCBI		Celera
Cytogenetic Map	6	D3	NCBI
cM Map	6	46.22	NCBI

Gpr27
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955421	16,352,643 - 16,353,094 (-)	NCBI	ChiLan1.0	ChiLan1.0

GPR27
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	71,713,162 - 71,715,808 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	71,717,950 - 71,720,596 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	71,693,611 - 71,696,247 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	73,050,542 - 73,052,347 (+)	NCBI	panpan1.1	PanPan1.1	panPan2

GPR27
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Dog10K_Boxer_Tasha	20	20,249,117 - 20,251,750 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	20,307,618 - 20,309,127 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	20,307,969 - 20,309,117 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	19,992,950 - 19,995,575 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	20,342,113 - 20,344,735 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	20,408,115 - 20,410,754 (-)	NCBI		UU_Cfam_GSD_1.0

Gpr27
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404942	3,284,932 - 3,289,003 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936603	3,241,741 - 3,289,996 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GPR27
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	53,152,062 - 53,153,192 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	53,152,038 - 53,154,537 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

GPR27
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	22	32,708,228 - 32,709,820 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	22	32,708,599 - 32,709,729 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666041	134,068,927 - 134,071,765 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gpr27
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624773	6,294,850 - 6,296,010 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624773	6,294,850 - 6,297,249 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Gpr27
3 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	174
Count of miRNA genes:	130
Interacting mature miRNAs:	147
Transcripts:	ENSRNOT00000014455
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	11320076	180699135	Rat
731165	Uae21	Urinary albumin excretion QTL 21	2.4	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	4	106649412	151649412	Rat
737821	Hcar9	Hepatocarcinoma resistance QTL 9	3.7		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	4	109866907	167139601	Rat
1298082	Stresp4	Stress response QTL 4			blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	50119848	146803430	Rat
631646	Stl4	Serum triglyceride level QTL 4	6.5	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	4	73169846	132642728	Rat
631674	Iddm14	Insulin dependent diabetes mellitus QTL 14			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	4	64528739	157573521	Rat
631683	Bp116	Blood pressure QTL 116		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	124303370	169303370	Rat
631689	Scl4	Serum cholesterol level QTL 4	1.9	0.008	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	4	95174120	140174120	Rat
737978	Pia23	Pristane induced arthritis QTL 23	5.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	131730738	167139601	Rat
6478760	Anxrr45	Anxiety related response QTL 45		0.06717	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	110870972	155870972	Rat
6478763	Anxrr46	Anxiety related response QTL 46		0.07428	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	110870972	155870972	Rat
6478778	Anxrr51	Anxiety related response QTL 51		0.25384	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	4	124778595	169778595	Rat
738009	Sach4	Saccharine consumption QTL 4	4.9	0.000016	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	59948935	154902892	Rat
738016	Alc16	Alcohol consumption QTL 16	3.6	0.00015	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
738031	Alc14	Alcohol consumption QTL 14	7.6	0.00003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
631511	Pia7	Pristane induced arthritis QTL 7	4.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	131730738	167139601	Rat
634347	Hcar8	Hepatocarcinoma resistance QTL 8	5.8		liver integrity trait (VT:0010547)	liver tumorous lesion area to total liver area ratio (CMO:0001075)	4	123143783	168143783	Rat
7411558	Bw133	Body weight QTL 133	13.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	125590636	170590636	Rat
7207480	Bss105	Bone structure and strength QTL 105	8.1		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	4	109827074	154827074	Rat
1300116	Hrtrt5	Heart rate QTL 5	3.76		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	116179486	151161268	Rat
1358352	Srcrt3	Stress Responsive Cort QTL 3	2.29		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	38465774	146803430	Rat
1331802	Srn5	Serum renin concentration QTL 5	3.045		renin activity (VT:0005581)	plasma renin activity level (CMO:0000116)	4	119428175	157578333	Rat
1354612	Foco1	Food consumption QTL 1	8.87		eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	4	44463908	148090542	Rat
1354660	Salc1	Saline consumption QTL 1	11.26		drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	4	44463908	148090542	Rat
1358202	Gluco11	Glucose level QTL 11	2.4	0.02	adipocyte glucose uptake trait (VT:0004185)	absolute change in adipocyte glucose uptake (CMO:0000873)	4	85379421	167139601	Rat
1549832	Bss3	Bone structure and strength QTL 3	11		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	4	109827074	154827074	Rat
1578655	Bmd11	Bone mineral density QTL 11	11		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	4	90850165	135850165	Rat
1582232	Gluco25	Glucose level QTL 25	3.6	0.0023	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	85253748	148090731	Rat
1576305	Emca6	Estrogen-induced mammary cancer QTL 6	5.8		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	4	44463720	155883716	Rat
1576316	Ept5	Estrogen-induced pituitary tumorigenesis QTL 5	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	4	83428419	177635233	Rat
61330	Eau1	Experimental allergic uveoretinitis QTL 1		0.0003	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	4	70362013	132642728	Rat
61406	Scwia1	Streptococcal cell wall induced arthritis QTL 1	2.3		joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	4	106805662	151805662	Rat
61434	Cia3	Collagen induced arthritis QTL 3	4.8		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	103194656	148194656	Rat
70177	Xhs1	X-ray hypersensitivity QTL 1	25.1		intestine integrity trait (VT:0010554)	post-insult time to onset of moribundity (CMO:0001896)	4	82798864	152731274	Rat
70200	Alc18	Alcohol consumption QTL 18	9.2		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	4	56647873	149491524	Rat
2293840	Kiddil9	Kidney dilation QTL 9	2.9		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	4	120926564	148090731	Rat
2302049	Pia32	Pristane induced arthritis QTL 32	5.1	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112)	4	105789505	150789505	Rat
1331759	Hrtrt13	Heart rate QTL 13	3.54628		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	110275411	168266883	Rat
724535	Cm18	Cardiac mass QTL 18	2.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	4	118856416	163856416	Rat
61451	Ciaa4	CIA Autoantibody QTL 4	3.1		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	4	126395976	167139601	Rat
2312567	Glom19	Glomerulus QTL 19	1.9	0.006	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	4	45456990	146803430	Rat
12798519	Anxrr54	Anxiety related response QTL 54	2.54	0.05	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	114627026	159627026	Rat
12798527	Anxrr58	Anxiety related response QTL 58	4.11	0.05	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	119463257	147278687	Rat
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5214602	146446691	Rat
12798523	Anxrr56	Anxiety related response QTL 56	2.83	0.05	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	85253748	150276390	Rat
634335	Anxrr16	Anxiety related response QTL 16	7.22		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	93308457	167139447	Rat
70201	Gcr1	Gastric cancer resistance QTL 1	2.7		stomach morphology trait (VT:0000470)	stomach tumor susceptibility score (CMO:0002043)	4	120260281	147278687	Rat

Markers in Region

D4Rat57

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	132,326,984 - 132,327,165 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	132,136,266 - 132,136,446	NCBI	Rnor6.0
Rnor_5.0	4	196,627,504 - 196,627,684	UniSTS	Rnor5.0
RGSC_v3.4	4	134,539,257 - 134,539,438	RGD	RGSC3.4
RGSC_v3.4	4	134,539,258 - 134,539,438	UniSTS	RGSC3.4
RGSC_v3.1	4	134,784,056 - 134,784,344	RGD
Celera	4	121,186,241 - 121,186,421	UniSTS
RH 2.0 Map	4	859.1	RGD
SHRSP x BN Map	4	57.7499	RGD
FHH x ACI Map	4	76.9499	RGD
Cytogenetic Map	4	q34	UniSTS

UniSTS:487638

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	132,328,363 - 132,329,497 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	132,137,793 - 132,138,926	NCBI	Rnor6.0
Rnor_5.0	4	196,629,031 - 196,630,164	UniSTS	Rnor5.0
RGSC_v3.4	4	134,541,534 - 134,542,667	UniSTS	RGSC3.4
Celera	4	121,187,535 - 121,188,668	UniSTS
Cytogenetic Map	4	q34	UniSTS

UniSTS:493241

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	132,328,363 - 132,329,497 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	132,137,793 - 132,138,926	NCBI	Rnor6.0
Rnor_5.0	4	196,629,031 - 196,630,164	UniSTS	Rnor5.0
RGSC_v3.4	4	134,541,534 - 134,542,667	UniSTS	RGSC3.4
Celera	4	121,187,535 - 121,188,668	UniSTS
Cytogenetic Map	4	q34	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium									32
Low	1	40	12	2	11	2	8	11	42	30	33	9	8
Below cutoff	1	3	27	21	8	21				5	8	2

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_023099	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB040802	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473957	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000014455 ⟹ ENSRNOP00000014455

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	132,328,364 - 132,329,497 (+)	Ensembl
Rnor_6.0 Ensembl	4	132,137,793 - 132,138,926 (+)	Ensembl

RefSeq Acc Id:

NM_023099 ⟹ NP_075587

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	133,884,894 - 133,886,027 (+)	NCBI
mRatBN7.2	4	132,328,364 - 132,329,497 (+)	NCBI
Rnor_6.0	4	132,137,793 - 132,138,926 (+)	NCBI
Rnor_5.0	4	196,629,031 - 196,630,164 (+)	NCBI
RGSC_v3.4	4	134,541,534 - 134,542,667 (+)	RGD
Celera	4	121,187,535 - 121,188,668 (+)	RGD

Sequence:

show sequence

ATGGCGAACGCTAGTGAGCCGGGCGGCGGCGGCGGCGGGGCCGAGGCTGCCGCGCTGGGCCTCA
GGCTGGCCACACTCAGCCTGCTGCTGTGCGTGAGCCTGGCGGGCAACGTGCTGTTCGCTCTGCT
CATCGTGAGGGAGCGCAGCCTGCACCGCGCGCCTTACTACCTGCTGCTCGACCTGTGCCTGGCC
GACGGGCTGCGCGCGCTCGCCTGTCTCCCGGCCGTCATGCTGGCTGCGCGGCGCGCGGCAGCCG
CGGCGGGGACGCCTCCGGGTGCGCTGGGCTGCAAGCTGCTGGCCTTCCTGGCCGCGCTCTTCTG
CTTCCACGCGGCCTTCCTGCTGCTGGGCGTGGGCGTCACCCGCTACCTGGCCATCGCTCACCAC
CGCTTCTATGCCGAGCGCCTGGCCGGCTGGCCGTGCGCCGCGATGCTGGTGTGCGCCGCCTGGG
CGCTGGCTTTGGCCGCGGCCTTCCCGCCGGTGCTGGACGGCGGTGGCGCGGACGACGAGGATGC
GCCGTGCGCCCTGGAGCAGCGGCCCGACGGCGCCCCGGGTGCGCTAGGCTTCCTGCTGCTCCTG
GCCGCGGTGGTGGGCGCCACGCACCTCGTCTACCTTCGCCTGCTCTTCTTCATCCACGACCGCC
GCAAGATGCGGCCCGCACGCCTGGTGCCCGCCGTCAGCCACGACTGGACCTTCCACGGCCCGGG
CGCCACCGGTCAAGCGGCCGCCAACTGGACGGCGGGCTTCGGCCGCGGGCCCACGCCACCTGCG
CTCGTGGGCATCAGGCCTGCAGGCCCGGGCCGCGGAGCCCGGCGCCTCCTGGTGCTGGAGGAAT
TCAAGACGGAGAAGAGGCTGTGCAAGATGTTCTACGCCATCACGCTGCTCTTCCTGCTCCTCTG
GGGGCCCTATGTGGTTGCCAGTTACCTGCGCGTCCTGGTGCGGCCCGGAGCTGTCCCGCAGGCC
TACCTGACAGCCTCGGTGTGGCTGACATTCGCACAGGCCGGCATCAACCCCGTGGTGTGTTTCC
TCTTCAACCGGGAGCTGAGGGACTGTTTCAGAGCCCAGTTCCCCTGTTGCCAGAGCCCCCAGGC
CACGCAGGCCACCCTCCCCTGCGACCTGAAAGGCATTGGTTTGTGA

hide sequence

Protein Sequences


Protein RefSeqs	NP_075587	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	BAA96648	(Get FASTA)	NCBI Sequence Viewer
	EDL91437	(Get FASTA)	NCBI Sequence Viewer
	EDL91438	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000014455
	ENSRNOP00000014455.1
	ENSRNOP00055027738
	ENSRNOP00060005657
	ENSRNOP00065037010
GenBank Protein	Q9JJH3	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_075587 ⟸ NM_023099

- UniProtKB:

Q9JJH3 (UniProtKB/Swiss-Prot), A6IBG9 (UniProtKB/TrEMBL), A6IBH0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MANASEPGGGGGGAEAAALGLRLATLSLLLCVSLAGNVLFALLIVRERSLHRAPYYLLLDLCLA
DGLRALACLPAVMLAARRAAAAAGTPPGALGCKLLAFLAALFCFHAAFLLLGVGVTRYLAIAHH
RFYAERLAGWPCAAMLVCAAWALALAAAFPPVLDGGGADDEDAPCALEQRPDGAPGALGFLLLL
AAVVGATHLVYLRLLFFIHDRRKMRPARLVPAVSHDWTFHGPGATGQAAANWTAGFGRGPTPPA
LVGIRPAGPGRGARRLLVLEEFKTEKRLCKMFYAITLLFLLLWGPYVVASYLRVLVRPGAVPQA
YLTASVWLTFAQAGINPVVCFLFNRELRDCFRAQFPCCQSPQATQATLPCDLKGIGL

hide sequence

RefSeq Acc Id:

ENSRNOP00000014455 ⟸ ENSRNOT00000014455

Protein Domains

G-protein coupled receptors family 1 profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9JJH3-F1-model_v2	AlphaFold	Q9JJH3	1-377	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693273

Promoter ID:

EPDNEW_R3798

Type:

single initiation site

Name:

Gpr27_1

Description:

G protein-coupled receptor 27

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	4	132,137,813 - 132,137,873	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:71067	AgrOrtholog
BioCyc Gene	G2FUF-43582	BioCyc
Ensembl Genes	ENSRNOG00000010880	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOG00055020038	UniProtKB/Swiss-Prot
	ENSRNOG00060004468	UniProtKB/Swiss-Prot
	ENSRNOG00065026173	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000014455	ENTREZGENE
	ENSRNOT00000014455.3	UniProtKB/Swiss-Prot
	ENSRNOT00055034203	UniProtKB/Swiss-Prot
	ENSRNOT00060007474	UniProtKB/Swiss-Prot
	ENSRNOT00065045128	UniProtKB/Swiss-Prot
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	GPCR_Rhodpsn	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:65275	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	65275	ENTREZGENE
PANTHER	G PROTEIN-COUPLED RECEPTOR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	G-PROTEIN COUPLED RECEPTOR 27-RELATED	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	7tm_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Gpr27	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000010880	RatGTEx
	ENSRNOG00055020038	RatGTEx
	ENSRNOG00060004468	RatGTEx
	ENSRNOG00065026173	RatGTEx
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A6IBG9	ENTREZGENE, UniProtKB/TrEMBL
	A6IBH0	ENTREZGENE, UniProtKB/TrEMBL
	GPR27_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2002-07-09	Gpr27	G protein-coupled receptor 27			Symbol and Name updated to reflect Human and Mouse nomenclature	70877	APPROVED

RGD Curation Notes

Note Type	Note	Reference

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD