Advanced Search (OLGA)

Gene: Bco1 (beta-carotene oxygenase 1) Rattus norvegicus

Analyze

Symbol:

Bco1

Name:

beta-carotene oxygenase 1

RGD ID:

70981

Description:

Enables beta-carotene 15,15'-dioxygenase activity. Involved in retinoid metabolic process. Predicted to be located in cytosol. Orthologous to human BCO1 (beta-carotene oxygenase 1); PARTICIPATES IN retinol metabolic pathway; vitamin A deficiency pathway; INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Bcdo; Bcmo1; beta,beta-carotene 15,15'-dioxygenase; beta,beta-carotene 15,15'-monooxygenase; beta-carotene 15 15'-dioxygenase; beta-carotene 15 15-dioxygenase; beta-carotene 15, 15'-dioxygenase; beta-carotene 15, 15-dioxygenase; beta-carotene 15,15'-monooxygenase; beta-carotene 15,15'-monooxygenase 1; beta-carotene dioxygenase 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	BCO1 (beta-carotene oxygenase 1)	HGNC	EggNOG, Ensembl, HomoloGene, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Bco1 (beta-carotene oxygenase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Bco1 (beta-carotene oxygenase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	BCO1 (beta-carotene oxygenase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	BCO1 (beta-carotene oxygenase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Bco1 (beta-carotene oxygenase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	BCO1 (beta-carotene oxygenase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	BCO1 (beta-carotene oxygenase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Bco1 (beta-carotene oxygenase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Bco1 (beta-carotene oxygenase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Bco1 (beta-carotene oxygenase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	BCO1 (beta-carotene oxygenase 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	bco1l (beta-carotene oxygenase 1, like)	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)
Danio rerio (zebrafish):	bco1l (beta-carotene oxygenase 1, like)	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	bco1 (beta-carotene oxygenase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	bcmo-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	ninaB	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	ninaB	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	bcmo-2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	bco1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	bco1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	62,058,061 - 62,094,923 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	19	62,058,089 - 62,094,917 (+)	Ensembl				GRCr8
mRatBN7.2	19	45,149,250 - 45,186,102 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	45,149,265 - 45,186,101 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	19	51,959,095 - 51,995,942 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	52,612,116 - 52,648,960 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	54,856,354 - 54,893,189 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	49,637,059 - 49,673,577 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	49,637,016 - 49,673,808 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	19	60,424,580 - 60,460,636 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	19	47,202,955 - 47,239,225 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	19	44,421,345 - 44,457,802 (+)	NCBI		Celera
RGSC_v3.1	19	47,207,835 - 47,244,106 (+)	NCBI
Cytogenetic Map	19	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Hypercarotenemia and Vitamin A Deficiency, Autosomal Dominant (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(1->4)-beta-D-glucan (ISO)

17beta-estradiol (EXP)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,6-dinitrotoluene (EXP)

4,4'-sulfonyldiphenol (EXP,ISO)

4-hydroxyphenyl retinamide (ISO)

9-cis-retinoic acid (EXP)

aflatoxin B1 (EXP,ISO)

aldehydo-D-glucose (ISO)

all-trans-retinoic acid (EXP,ISO)

Allylamine (EXP)

amiodarone (ISO)

ammonium chloride (EXP)

amphetamine (EXP)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

beta-carotene (EXP,ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (EXP)

butanal (ISO)

C60 fullerene (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

D-glucose (ISO)

diarsenic trioxide (ISO)

dorsomorphin (ISO)

endosulfan (EXP)

entinostat (ISO)

ethanol (ISO)

flavonoids (EXP)

fructose (ISO)

furan (EXP,ISO)

gentamycin (EXP)

glucose (ISO)

herbicide (ISO)

inulin (ISO)

L-ascorbic acid (EXP)

lycopene (ISO)

mercury dibromide (ISO)

methylmercury chloride (ISO)

N-nitrosodiethylamine (ISO)

nitrofen (EXP)

okadaic acid (ISO)

oxaliplatin (EXP)

p-chloromercuribenzoic acid (ISO)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

phenobarbital (ISO)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

Ro 41-5253 (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

testosterone (ISO)

tetrachloromethane (EXP,ISO)

topotecan (EXP)

trichloroethene (EXP)

trichostatin A (ISO)

troglitazone (ISO)

valproic acid (ISO)

vitamin E (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

beta-carotene metabolic process (ISO)

carotene catabolic process (IBA,IEA,ISO,ISS)

lipid metabolic process (IEA)

retinal metabolic process (IBA,IEA,ISO,ISS)

retinoid metabolic process (IDA,IEA,ISO)

retinol metabolic process (IEA)

Cellular Component

cytosol (IEA,ISS)

Molecular Function

beta-carotene 15,15'-dioxygenase activity (IBA,IDA,IEA,ISO)

carotenoid dioxygenase activity (IBA)

dioxygenase activity (IEA)

metal ion binding (IEA)

oxidoreductase activity (IEA)

oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

retinol metabolic pathway (IEA,ISO,TAS)

vitamin A deficiency pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Feedback regulation of beta,beta-carotene 15,15'-monooxygenase by retinoic acid in rats and chickens.	Bachmann H, etal., J Nutr 2002 Dec;132(12):3616-22.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Mechanisms involved in the intestinal absorption of dietary vitamin A and provitamin A carotenoids.	Harrison EH Biochim Biophys Acta. 2012 Jan;1821(1):70-7. Epub 2011 Jun 12.
4.	Mammalian carotenoid-oxygenases: key players for carotenoid function and homeostasis.	Lobo GP, etal., Biochim Biophys Acta. 2012 Jan;1821(1):78-87. Epub 2011 May 4.
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
7.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
8.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
9.	GOA pipeline	RGD automated data pipeline
10.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:11092891	PMID:11401432	PMID:11960992	PMID:19276538	PMID:19509464	PMID:20702748	PMID:21512299	PMID:23327966	PMID:25575786	PMID:25701869

Genomics

Comparative Map Data

Bco1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	62,058,061 - 62,094,923 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	19	62,058,089 - 62,094,917 (+)	Ensembl				GRCr8
mRatBN7.2	19	45,149,250 - 45,186,102 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	45,149,265 - 45,186,101 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	19	51,959,095 - 51,995,942 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	52,612,116 - 52,648,960 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	54,856,354 - 54,893,189 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	49,637,059 - 49,673,577 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	49,637,016 - 49,673,808 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	19	60,424,580 - 60,460,636 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	19	47,202,955 - 47,239,225 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	19	44,421,345 - 44,457,802 (+)	NCBI		Celera
RGSC_v3.1	19	47,207,835 - 47,244,106 (+)	NCBI
Cytogenetic Map	19	q12	NCBI

BCO1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	81,238,689 - 81,291,142 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	81,238,576 - 81,291,226 (+)	Ensembl			hg38	GRCh38
GRCh37	16	81,272,294 - 81,324,747 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	79,829,797 - 79,882,248 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	16	79,829,796 - 79,882,248	NCBI
Celera	16	65,569,740 - 65,622,032 (+)	NCBI		Celera
Cytogenetic Map	16	q23.2	NCBI
HuRef	16	67,027,575 - 67,079,925 (+)	NCBI		HuRef
CHM1_1	16	82,683,655 - 82,736,052 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	16	87,299,473 - 87,351,905 (+)	NCBI		T2T-CHM13v2.0

Bco1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	117,822,590 - 117,860,459 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	117,822,593 - 117,860,459 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	8	117,095,851 - 117,133,720 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	117,095,854 - 117,133,720 (+)	Ensembl			mm10	GRCm38
MGSCv37	8	119,619,765 - 119,657,620 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	8	119,981,842 - 120,019,458 (+)	NCBI		MGSCv36	mm8
Celera	8	121,315,369 - 121,353,295 (+)	NCBI		Celera
Cytogenetic Map	8	E1	NCBI
cM Map	8	63.61	NCBI

Bco1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955522	3,985,266 - 4,018,886 (+)	Ensembl
ChiLan1.0	NW_004955522	3,985,515 - 4,018,116 (+)	NCBI	ChiLan1.0	ChiLan1.0

BCO1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	18	90,987,587 - 91,047,027 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	16	96,908,478 - 96,962,121 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	16	61,843,567 - 61,897,012 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	16	81,270,957 - 81,323,088 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	16	81,270,577 - 81,323,088 (+)	Ensembl			panPan2	panpan1.1

BCO1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	70,598,743 - 70,637,273 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	70,599,284 - 70,637,017 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	70,547,948 - 70,586,427 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	70,903,713 - 70,942,206 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	70,903,715 - 70,942,392 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	70,846,152 - 70,884,642 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	70,681,343 - 70,719,822 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	71,159,198 - 71,197,682 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Bco1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	30,698,707 - 30,729,976 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936475	28,859,318 - 28,889,934 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936475	28,859,222 - 28,890,407 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

BCO1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	7,012,332 - 7,055,305 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	6	7,008,330 - 7,054,089 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

BCO1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	66,681,756 - 66,730,832 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	5	66,681,513 - 66,733,604 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666047	9,105,596 - 9,155,354 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Bco1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624746	6,143,892 - 6,180,408 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624746	6,146,338 - 6,181,020 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Bco1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	17	36,750,709 - 36,786,831 (+)	NCBI		Rrattus_CSIRO_v1

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	42
Count of miRNA genes:	41
Interacting mature miRNAs:	42
Transcripts:	ENSRNOT00000016880
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61447	Tcas1	Tongue tumor susceptibility QTL 1	6.08		tongue integrity trait (VT:0010553)	squamous cell carcinoma of the tongue maximum tumor diameter (CMO:0001875)	19	19220689	64220689	Rat
631840	Niddm38	Non-insulin dependent diabetes mellitus QTL 38	3.86		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	19	10329076	74246245	Rat
724546	Kidm3	Kidney mass QTL 3	3.1		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	19	46226778	74246245	Rat
7411549	Bw130	Body weight QTL 130	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	32365311	74246245	Rat
1331737	Uae29	Urinary albumin excretion QTL 29	5.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	36289	74246245	Rat
724518	Uae19	Urinary albumin excretion QTL 19	5.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	24093973	69093973	Rat
61423	Cia14	Collagen induced arthritis QTL 14	3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	19	10833618	74246245	Rat
2303628	Vencon9	Ventilatory control QTL 9		0.005	respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	19	23188586	68188586	Rat
2313395	Anxrr26	Anxiety related response QTL 26			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	19	44385134	74246245	Rat
1578764	Stresp19	Stress response QTL 19	3.6	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	19	32539615	74246245	Rat
5135224	Leukc1	Leukocyte quantity QTL 1			eosinophil quantity (VT:0002602)	blood eosinophil count (CMO:0000033)	19	61249161	74246245	Rat
1331788	Rf45	Renal function QTL 45	2.818		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	19	31777888	74246245	Rat
1554318	Bmd5	Bone mineral density QTL 5	12.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	19	23188586	68188586	Rat
2317848	Alcrsp21	Alcohol response QTL 21	1.899999976158142	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	19	20109306	65109306	Rat
7247442	Uae39	Urinary albumin excretion QTL 39			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	2194317	74246245	Rat
1549835	Tcas7	Tongue tumor susceptibility QTL 7		0.001	tongue integrity trait (VT:0010553)	squamous cell carcinoma of the head and neck tumor number (CMO:0001876)	19	41722546	74246245	Rat
724566	Uae12	Urinary albumin excretion QTL 12	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	2194317	74246245	Rat

Markers in Region

D19Got51

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	45,156,357 - 45,156,608 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	49,644,103 - 49,644,353	NCBI	Rnor6.0
Rnor_5.0	19	60,431,383 - 60,431,633	UniSTS	Rnor5.0
RGSC_v3.4	19	47,209,981 - 47,210,231	UniSTS	RGSC3.4
Celera	19	44,428,387 - 44,428,637	UniSTS
RGSC_v3.1	19	47,214,862 - 47,215,112	RGD
RH 3.4 Map	19	601.9	UniSTS
RH 3.4 Map	19	601.9	RGD
RH 2.0 Map	19	621.7	RGD
Cytogenetic Map	19	q12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	11	56	130	90	89	59	83	59	6	328	168	11	104	77	92	30	9	9

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053648	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039097426	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039097427	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473972	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219222	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000019	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000016880 ⟹ ENSRNOP00000016880

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	19	62,058,089 - 62,094,917 (+)	Ensembl
mRatBN7.2 Ensembl	19	45,149,265 - 45,186,101 (+)	Ensembl
Rnor_6.0 Ensembl	19	49,637,016 - 49,673,808 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000112976 ⟹ ENSRNOP00000089555

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	19	62,059,490 - 62,094,917 (+)	Ensembl
mRatBN7.2 Ensembl	19	45,150,666 - 45,186,101 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000121956 ⟹ ENSRNOP00000110581

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	19	62,058,089 - 62,092,883 (+)	Ensembl

RefSeq Acc Id:

NM_053648 ⟹ NP_446100

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	62,058,140 - 62,094,679 (+)	NCBI
mRatBN7.2	19	45,149,316 - 45,185,863 (+)	NCBI
Rnor_6.0	19	49,637,059 - 49,673,577 (+)	NCBI
Rnor_5.0	19	60,424,580 - 60,460,636 (+)	NCBI
RGSC_v3.4	19	47,202,955 - 47,239,225 (+)	RGD
Celera	19	44,421,345 - 44,457,802 (+)	RGD

Sequence:

show sequence

GGGACAGATGGAGGCATCAAGGAGCAGAGGGCAGGAAGACAGGACGCTTTGAGCACACGGGGCT
TTGTGTCTATTCCACTGACAACCTCCTCACTGCCACCCACCGGTTCCATGGAGATAATATTTGG
CCGGAATAAGAAAGAACAGCTGGAGCCATTACGGGCCACAGTGACAGGCAGCATTCCAGCATGG
CTGCAGGGGACCCTGCTCCGAAACGGGCCTGGGATGCACACAGTGGGAGACAGCAAGTACAACC
ATTGGTTTGATGGCCTGGCCCTTCTCCACAGTTTCTCCATCAGAGATGGGGAGGTCTTCTACAG
GAGCAAATACCTGCAGAGCGACACCTACAACGCCAACATCGAGGCCAATAGAATCGTGGTGTCT
GAGTTCGGAACAATGGCCTACCCAGACCCCTGCAAAAACATCTTTTCCAAAGCTTTCTCCTACT
TGTCCCACACCATCCCCGACTTCACAGACAACTGCCTGATTAACATCATGAAATGTGGAGAAGA
CTTCTATGCCACCACAGAGACCAACTACATCAGGAAAATCGACCCCCAGACTCTAGAGACCTTG
GAGAAGGTTGATTACCGGAAGTATGTGGCTGTAAACCTGGCTACCTCACACCCTCATTACGACG
AGGCTGGAAATGTCCTTAACATGGGTACCTCCATCGCGGACAAAGGAAGGACAAAATACGTGAT
GTTTAAGATCCCCGCCACAGCACCAGGCAGCAAGAAGAAAGGGAAGAACCCCTTGAAGCACTCA
GAAGTTTTCTGCTCCATCCCGTCCCGCTCGCTGCTCTCCCCCAGTTACTACCACAGCTTTGGAG
TCACGGAGAACTATGTGGTGTTTCTGGAGCAGCCTTTTAAGCTGGATATCCTCAAGATGGCCAC
CGCATACATGAGGGGTGTGAGCTGGGCTTCCTGTATGACATTCTGCAAGGAGGACAAGACTTAC
ATTCATATCATCGACCAGAAGACCAGAAAGCCTGTGCCAACCAAATTCTACACAGACCCCATGG
TGGTCTTCCACCATGTTAATGCCTATGAGGAGGACGGCTGTGTGCTGTTTGATGTCATCGCCTA
TGAGGACAACAGTCTCTATCAGCTCTTCTACCTGGCCAACCTGAACAAGGACTTCGAGGAGAAG
TCCAGGCTGACCTCAGTGCCTACCCTCAGGAGGTTTGCTGTGCCCCTCCACGTGGACAAGGATG
CAGAAGTGGGCTCGAATTTAGTCAAGGTGTCATCTACAACAGCAACTGCCCTGAAGGAGAAGGA
CGACCATGTCTACTGCCAGCCTGAGGTCCTCTACGAAGGCCTAGAGCTCCCTCGGATAAATTAT
GCTCACAACGGGAAGCCATATCGCTACATCTTTGCTGCTGAAGTACAATGGAGTCCAGTCCCAA
CCAAGATACTAAAATATGACGTTCTCACCAAGTCCTCCTTAAAGTGGTCCGAGGAGAGCTGCTG
GCCTGCAGAGCCTCTGTTTGTCCCCACACCGGGTGCGAAGGATGAGGATGATGGAGTCATCTTA
TCAGCCATCATCTCTACAGATCCCCAAAAGCTGCCCTTTTTACTTATTCTGGATGCGAAAAGTT
TTACGGAATTGGCTCGCGCCTCTGTTGATGTGGACATGCACCTGGACCTGCATGGTTTATTTAT
TCCGGATGCAGGCTGGAATGCAGTGAAGCAGACTCCAGCCAAAACGCAAGAGGATGAAAATTCA
GATCATCCCACAGGTCTGACAGCACCAGGATTGGGCCATGGTGAAAATGACTTCACGGCAGGTC
ATGGCGGCAAGAGCCTTTAATCCTAGCACTCGAGGCAGAGGCAAGCAGATCTCTGAGTTCAAGG
CCAGCCTGGTCTACAACACAAGTTCCAGGACAGCCAGGGATACACAGAGAAATCCTATCTTGAA
AACAAAGCAAA

hide sequence

RefSeq Acc Id:

XM_039097426 ⟹ XP_038953354

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	62,070,863 - 62,094,923 (+)	NCBI
mRatBN7.2	19	45,162,116 - 45,186,102 (+)	NCBI

RefSeq Acc Id:

XM_039097427 ⟹ XP_038953355

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	62,058,061 - 62,075,479 (+)	NCBI
mRatBN7.2	19	45,149,250 - 45,166,649 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_446100	(Get FASTA)	NCBI Sequence Viewer
	XP_038953354	(Get FASTA)	NCBI Sequence Viewer
	XP_038953355	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL92648	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000016880
GenBank Protein	Q91XT5	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_446100 ⟸ NM_053648

- UniProtKB:

Q91XT5 (UniProtKB/Swiss-Prot), G3V7N1 (UniProtKB/TrEMBL), A6IZH0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEIIFGRNKKEQLEPLRATVTGSIPAWLQGTLLRNGPGMHTVGDSKYNHWFDGLALLHSFSIRD
GEVFYRSKYLQSDTYNANIEANRIVVSEFGTMAYPDPCKNIFSKAFSYLSHTIPDFTDNCLINI
MKCGEDFYATTETNYIRKIDPQTLETLEKVDYRKYVAVNLATSHPHYDEAGNVLNMGTSIADKG
RTKYVMFKIPATAPGSKKKGKNPLKHSEVFCSIPSRSLLSPSYYHSFGVTENYVVFLEQPFKLD
ILKMATAYMRGVSWASCMTFCKEDKTYIHIIDQKTRKPVPTKFYTDPMVVFHHVNAYEEDGCVL
FDVIAYEDNSLYQLFYLANLNKDFEEKSRLTSVPTLRRFAVPLHVDKDAEVGSNLVKVSSTTAT
ALKEKDDHVYCQPEVLYEGLELPRINYAHNGKPYRYIFAAEVQWSPVPTKILKYDVLTKSSLKW
SEESCWPAEPLFVPTPGAKDEDDGVILSAIISTDPQKLPFLLILDAKSFTELARASVDVDMHLD
LHGLFIPDAGWNAVKQTPAKTQEDENSDHPTGLTAPGLGHGENDFTAGHGGKSL

hide sequence

Ensembl Acc Id:

ENSRNOP00000016880 ⟸ ENSRNOT00000016880

RefSeq Acc Id:	XP_038953355 ⟸ XM_039097427
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_038953354 ⟸ XM_039097426
- Peptide Label:	isoform X1

Ensembl Acc Id:

ENSRNOP00000089555 ⟸ ENSRNOT00000112976

Ensembl Acc Id:

ENSRNOP00000110581 ⟸ ENSRNOT00000121956

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q91XT5-F1-model_v2	AlphaFold	Q91XT5	1-566	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13701170

Promoter ID:

EPDNEW_R11693

Type:

initiation region

Name:

Bco1_1

Description:

beta-carotene oxygenase 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	19	49,637,007 - 49,637,067	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:70981	AgrOrtholog
BioCyc Gene	G2FUF-5556	BioCyc
BioCyc Pathway	PWY-6857 [retinol biosynthesis]	BioCyc
BioCyc Pathway Image	PWY-6857	BioCyc
Ensembl Genes	ENSRNOG00000012027	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000016880	ENTREZGENE
InterPro	Carotenoid_Oase	UniProtKB/Swiss-Prot
NCBI Gene	114106	ENTREZGENE
PANTHER	BETA,BETA-CAROTENE 15,15'-DIOXYGENASE	UniProtKB/Swiss-Prot
	PTHR10543	UniProtKB/Swiss-Prot
Pfam	RPE65	UniProtKB/Swiss-Prot
PhenoGen	Bco1	PhenoGen
RatGTEx	ENSRNOG00000012027	RatGTEx
UniProt	A0A8I6AAK4_RAT	UniProtKB/TrEMBL
	A0ABK0M559_RAT	UniProtKB/TrEMBL
	A6IZH0	ENTREZGENE, UniProtKB/TrEMBL
	BCDO1_RAT	UniProtKB/Swiss-Prot
	G3V7N1	ENTREZGENE, UniProtKB/TrEMBL
	Q91XT5	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2014-07-23	Bco1	beta-carotene oxygenase 1	Bcmo1	beta-carotene 15,15'-monooxygenase 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-25	Bcmo1	beta-carotene 15,15'-monooxygenase 1	Bcmo1	beta-carotene 15,15'-monooxygenase	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-11-17	Bcmo1	beta-carotene 15,15'-monooxygenase			Symbol and Name updated	1299863	APPROVED
2002-07-09	Bcdo	beta-carotene 15, 15-dioxygenase			Symbol and Name updated to reflect Human and Mouse nomenclature	70877	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_regulation	induced by retinoids and carotenoids	634627

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways