Advanced Search (OLGA)

Gene: Ddx1 (DEAD-box helicase 1) Rattus norvegicus

Analyze

Symbol:

Ddx1

Name:

DEAD-box helicase 1

RGD ID:

619903

Description:

Predicted to enable several functions, including RNA binding activity; helicase activity; and transcription coregulator activity. Predicted to be involved in several processes, including positive regulation of canonical NF-kappaB signal transduction; positive regulation of myeloid dendritic cell cytokine production; and protein localization to cytoplasmic stress granule. Predicted to act upstream of or within response to exogenous dsRNA and response to virus. Predicted to be located in several cellular components, including cleavage body; cytoplasmic stress granule; and mitochondrion. Predicted to be part of ribonucleoprotein complex and tRNA-splicing ligase complex. Orthologous to human DDX1 (DEAD-box helicase 1); INTERACTS WITH (+)-schisandrin B; 2,4-dinitrotoluene; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

ATP-dependent RNA helicase DDX1; DEAD (Asp-Glu-Ala-Asp) box helicase 1; DEAD (Asp-Glu-Ala-Asp) box polypeptide 1; DEAD box protein 1; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 1; DEAD/H-box helicase 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	DDX1 (DEAD-box helicase 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Ddx1 (DEAD box helicase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ddx1 (DEAD-box helicase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	DDX1 (DEAD-box helicase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	DDX1 (DEAD-box helicase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ddx1 (DEAD-box helicase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	DDX1 (DEAD-box helicase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	DDX1 (DEAD-box helicase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ddx1 (DEAD-box helicase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Ddx1 (DEAD-box helicase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	DDX1 (DEAD-box helicase 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ddx1 (DEAD box helicase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ddx1 (DEAD (Asp-Glu-Ala-Asp) box helicase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Ddx1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	Y55F3BR.1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	Y55F3BR.1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ddx1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ddx1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	41,725,365 - 41,756,236 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	6	41,725,367 - 41,758,302 (-)	Ensembl				GRCr8
mRatBN7.2	6	35,996,469 - 36,027,340 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	35,996,469 - 36,027,365 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	6	36,308,721 - 36,339,592 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	36,623,377 - 36,654,248 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	36,091,437 - 36,122,515 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	38,422,892 - 38,453,762 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	38,422,888 - 38,453,797 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	6	47,188,697 - 47,219,567 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	6	36,794,602 - 36,825,473 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	6	35,359,044 - 35,389,916 (-)	NCBI		Celera
RGSC_v3.1	6	36,812,356 - 36,818,005 (-)	NCBI
Cytogenetic Map	6	q15	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

endometrial hyperplasia (ISO)

human immunodeficiency virus infectious disease (ISO)

substance-related disorder (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

1,2-dimethylhydrazine (ISO)

1-chloro-2,4-dinitrobenzene (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

2-amino-14,16-dimethyloctadecan-3-ol (ISO)

2-hydroxypropanoic acid (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

actinomycin D (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

antirheumatic drug (ISO)

Aroclor 1254 (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

buspirone (EXP)

C60 fullerene (EXP)

cadmium sulfate (ISO)

chlorpyrifos (ISO)

diarsenic trioxide (ISO)

Dibutyl phosphate (ISO)

dicrotophos (ISO)

enzyme inhibitor (ISO)

ethanol (ISO)

finasteride (EXP)

flutamide (EXP)

FR900359 (ISO)

fumonisin B1 (ISO)

gallic acid (ISO)

gentamycin (EXP)

hydrogen peroxide (ISO)

ibuprofen (ISO)

isoflavones (EXP)

ivermectin (ISO)

lead(0) (ISO)

menadione (ISO)

methidathion (ISO)

methimazole (EXP)

N-methyl-4-phenylpyridinium (ISO)

Nutlin-3 (ISO)

okadaic acid (ISO)

oxaliplatin (EXP)

paracetamol (EXP,ISO)

pentachlorophenol (ISO)

pirinixic acid (ISO)

propiconazole (ISO)

rac-lactic acid (ISO)

resveratrol (ISO)

rotenone (EXP)

SB 431542 (ISO)

sodium arsenite (EXP,ISO)

sulfadimethoxine (EXP)

sulindac (EXP)

tetrachloromethane (EXP,ISO)

titanium dioxide (ISO)

topotecan (EXP)

trimellitic anhydride (ISO)

triphenyl phosphate (ISO)

troglitazone (ISO)

trovafloxacin (EXP)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

defense response to virus (IEA)

DNA-templated transcription (IEA)

double-strand break repair (IEA,ISO,ISS)

immune system process (IEA)

innate immune response (IEA)

mRNA processing (IEA)

positive regulation of canonical NF-kappaB signal transduction (IEA,ISO,ISS)

positive regulation of myeloid dendritic cell cytokine production (IEA,ISO)

protein localization to cytoplasmic stress granule (IEA,ISO)

response to exogenous dsRNA (ISO)

response to virus (ISO)

tRNA processing (IEA)

tRNA splicing, via endonucleolytic cleavage and ligation (IEA,ISO,ISS)

Cellular Component

cleavage body (IEA,ISO,ISS)

cytoplasm (IEA,ISO,ISS)

cytoplasmic stress granule (IEA,ISO,ISS)

cytosol (IEA,ISO,ISS)

mitochondrion (IEA,ISO,ISS)

nucleoplasm (IEA,ISO)

nucleus (IEA,ISO,ISS)

ribonucleoprotein complex (IEA,ISO)

tRNA-splicing ligase complex (IEA,ISO,ISS)

Molecular Function

ATP binding (IEA)

ATP hydrolysis activity (IEA)

chromatin binding (IEA,ISO,ISS)

DNA binding (IEA)

DNA/RNA helicase activity (IEA,ISO,ISS)

double-stranded RNA binding (IEA,ISO)

exonuclease activity (IEA)

helicase activity (IEA)

hydrolase activity (IEA)

nuclease activity (IEA,ISO,ISS)

nucleic acid binding (IEA)

nucleotide binding (IEA)

poly(A) binding (IEA,ISO,ISS)

protein binding (ISO)

RNA binding (IEA)

RNA helicase activity (IEA,ISO,ISS)

transcription coregulator activity (IEA,ISO,ISS)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Amplification of Mycn, Ddx1, Rrm2, and Odc1 in rat uterine endometrial carcinomas.	Karlsson A, etal., Genes Chromosomes Cancer 2001 Aug;31(4):345-56.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	GOA pipeline	RGD automated data pipeline
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:7689221	PMID:11598190	PMID:12183465	PMID:12477932	PMID:15489334	PMID:18335541	PMID:18710941	PMID:18809582	PMID:19058135	PMID:19946888	PMID:21311021	PMID:21703541
PMID:21933836	PMID:22658674	PMID:22681889	PMID:24608264	PMID:24870230	PMID:24965446	PMID:28259758	PMID:28755400	PMID:30295850

Genomics

Comparative Map Data

Ddx1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	41,725,365 - 41,756,236 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	6	41,725,367 - 41,758,302 (-)	Ensembl				GRCr8
mRatBN7.2	6	35,996,469 - 36,027,340 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	35,996,469 - 36,027,365 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	6	36,308,721 - 36,339,592 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	36,623,377 - 36,654,248 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	36,091,437 - 36,122,515 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	38,422,892 - 38,453,762 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	38,422,888 - 38,453,797 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	6	47,188,697 - 47,219,567 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	6	36,794,602 - 36,825,473 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	6	35,359,044 - 35,389,916 (-)	NCBI		Celera
RGSC_v3.1	6	36,812,356 - 36,818,005 (-)	NCBI
Cytogenetic Map	6	q15	NCBI

DDX1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	15,591,868 - 15,631,101 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	15,591,178 - 15,634,346 (+)	Ensembl			hg38	GRCh38
GRCh37	2	15,731,992 - 15,771,225 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	15,649,221 - 15,688,676 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	2	15,682,367 - 15,721,823	NCBI
Celera	2	15,649,490 - 15,688,945 (+)	NCBI		Celera
Cytogenetic Map	2	p24.3	NCBI
HuRef	2	15,583,004 - 15,622,496 (+)	NCBI		HuRef
CHM1_1	2	15,661,598 - 15,701,093 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	2	15,623,489 - 15,662,692 (+)	NCBI		T2T-CHM13v2.0

Ddx1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	12	13,269,308 - 13,299,175 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	12	13,266,974 - 13,299,214 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	12	13,219,307 - 13,249,174 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	12	13,216,973 - 13,249,213 (-)	Ensembl			mm10	GRCm38
MGSCv37	12	13,226,113 - 13,255,980 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	12	13,245,295 - 13,275,162 (-)	NCBI		MGSCv36	mm8
Celera	12	13,565,291 - 13,593,111 (-)	NCBI		Celera
Cytogenetic Map	12	A1.1	NCBI
cM Map	12	6.4	NCBI

Ddx1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955487	9,085,918 - 9,119,979 (+)	Ensembl
ChiLan1.0	NW_004955487	9,085,950 - 9,117,599 (+)	NCBI	ChiLan1.0	ChiLan1.0

DDX1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	12	110,890,477 - 110,930,113 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2A	110,894,450 - 110,959,990 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2A	15,582,499 - 15,619,751 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2A	15,716,044 - 15,753,482 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2A	15,716,044 - 15,753,623 (+)	Ensembl			panPan2	panpan1.1

DDX1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	17	11,432,060 - 11,467,000 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	17	11,432,136 - 11,466,990 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	17	11,375,128 - 11,409,962 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	17	11,559,789 - 11,594,731 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	17	11,559,798 - 11,594,727 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	17	11,419,496 - 11,454,379 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	17	11,429,814 - 11,464,805 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	17	11,454,120 - 11,488,966 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Ddx1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024406292	55,920,933 - 55,954,651 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936493	14,884,442 - 14,918,823 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936493	14,884,532 - 14,918,621 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

DDX1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	121,818,406 - 121,856,604 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	3	121,818,400 - 121,856,667 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	130,448,196 - 130,480,756 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

DDX1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	14	92,007,446 - 92,045,414 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	14	92,007,036 - 92,045,190 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666045	20,189,540 - 20,227,199 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ddx1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624865	898,850 - 928,091 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624865	898,850 - 927,375 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Ddx1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	7	33,161,556 - 33,192,522 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Ddx1
279 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	21
Count of miRNA genes:	21
Interacting mature miRNAs:	21
Transcripts:	ENSRNOT00000009100
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
8552962	Pigfal16	Plasma insulin-like growth factor 1 level QTL 16	9.4		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	6	1975879	46975879	Rat
8693632	Alc27	Alcohol consumption QTL 27	2.2	0.791	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	6	40052411	56848866	Rat
634318	Bw118	Body weight QTL 118	3.55		abdominal fat pad mass (VT:1000711)	abdominal fat pad weight (CMO:0000088)	6	39028659	63457441	Rat
634307	Bp141	Blood pressure QTL 141	4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	6	40957564	85957564	Rat
10401812	Kidm54	Kidney mass QTL 54			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	6	20097635	65097635	Rat
8552910	Pigfal5	Plasma insulin-like growth factor 1 level QTL 5	4.3		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	6	22653889	67653889	Rat
10401800	Kidm49	Kidney mass QTL 49			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	6	20097635	65097635	Rat
1331779	Rf38	Renal function QTL 38	2.876		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	6	31185002	76185002	Rat
1300164	Rf15	Renal function QTL 15	3.12		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	6	3239989	48239989	Rat
9589129	Insul24	Insulin level QTL 24	19.06	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	6	1975879	46975879	Rat
7411603	Foco13	Food consumption QTL 13	5.5	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	6	1975879	46975879	Rat
1598843	Cm63	Cardiac mass QTL 63	2.6		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	6	1	44788383	Rat
7411542	Bw127	Body weight QTL 127	5.5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	1975879	46975879	Rat
2292616	Ept15	Estrogen-induced pituitary tumorigenesis QTL 15	4.4		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	6	1	44788383	Rat
9589048	Scfw3	Subcutaneous fat weight QTL 3	4.57	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	6	1975879	46975879	Rat
2293839	Kiddil2	Kidney dilation QTL 2	4.8		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	26618314	86868070	Rat
1576309	Emca7	Estrogen-induced mammary cancer QTL 7	4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	20859430	113082285	Rat
2293709	Bss23	Bone structure and strength QTL 23	5.18	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	6	3239989	48239989	Rat
2301964	Bp323	Blood pressure QTL 323	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	6	1	86868070	Rat
2293650	Bss31	Bone structure and strength QTL 31	5.05	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	6	3239989	48239989	Rat
1578665	Bss16	Bone structure and strength QTL 16	4.4		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	6	33328841	78328841	Rat
2293841	Kiddil4	Kidney dilation QTL 4	4.4		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	26618314	86868070	Rat
1641898	Colcr4	Colorectal carcinoma resistance QTL4	3.71	0.0007	intestine integrity trait (VT:0010554)	well differentiated malignant colorectal tumor surface area measurement (CMO:0002077)	6	30937632	75937632	Rat
1578668	Bmd14	Bone mineral density QTL 14	3.8		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	6	33328841	78328841	Rat
6893340	Cm77	Cardiac mass QTL 77	0.26	0.57	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	6	39028659	86867923	Rat
70199	Coreg1	Compensatory renal growth QTL 1	11.8		kidney mass (VT:0002707)	compensatory renal growth score (CMO:0001894)	6	14599473	63457687	Rat
2301972	Bp325	Blood pressure QTL 325	4.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	6	16089372	61967788	Rat
2293656	Bss28	Bone structure and strength QTL 28	6.79	0.0001	femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	6	3239989	48239989	Rat
1358190	Ept1	Estrogen-induced pituitary tumorigenesis QTL 1	4.4		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	6	1	44788383	Rat
1300143	Rf14	Renal function QTL 14	2.92		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	6	40163183	85163183	Rat
1354664	Slep2	Serum leptin concentration QTL 2	4.49		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	6	22288257	67288257	Rat

Markers in Region

RH127887

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	6	41,725,489 - 41,725,680 (+)	Marker Load Pipeline
mRatBN7.2	6	35,996,593 - 35,996,784 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	38,423,017 - 38,423,207	NCBI	Rnor6.0
Rnor_5.0	6	47,188,822 - 47,189,012	UniSTS	Rnor5.0
RGSC_v3.4	6	36,794,727 - 36,794,917	UniSTS	RGSC3.4
Celera	6	35,359,169 - 35,359,359	UniSTS
Cytogenetic Map	6	q15-q16	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053414	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AH009557	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC082049	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473947	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ226373	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ227615	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000009100 ⟹ ENSRNOP00000009100

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	6	41,725,367 - 41,758,302 (-)	Ensembl
mRatBN7.2 Ensembl	6	35,996,469 - 36,027,365 (-)	Ensembl
Rnor_6.0 Ensembl	6	38,422,888 - 38,453,797 (-)	Ensembl

RefSeq Acc Id:

NM_053414 ⟹ NP_445866

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	41,725,365 - 41,756,236 (-)	NCBI
mRatBN7.2	6	35,996,469 - 36,027,340 (-)	NCBI
Rnor_6.0	6	38,422,892 - 38,453,762 (-)	NCBI
Rnor_5.0	6	47,188,697 - 47,219,567 (-)	NCBI
RGSC_v3.4	6	36,794,602 - 36,825,473 (-)	RGD
Celera	6	35,359,044 - 35,389,916 (-)	RGD

Sequence:

show sequence

CTGGAAGGAGGGATCGACCGGGCCGGCAGCGGAGGAGTGCGGGAAGATGGCGGCCTTCTCCGAA
ATGGGTGTTATGCCCGAGATTGCACAAGCCGTGGAGGAGATGGATTGGCTTCTACCCACTGATA
TCCAGGCAGAATCTATCCCATTGATCCTAGGAGGAGGTGATGTACTTATGGCTGCAGAAACGGG
AAGTGGAAAAACTGGTGCATTTAGTATTCCAGTTATCCAGATAGTGTATGAGACTCTGAAAGAC
CAACAGGAAGGAAAGAAAGGGAAAGCAACTATTAAAACTGGTGCTTCTGTGCTCAACAAGTGGC
AGATGAACCCATATGATAGAGGGTCTGCTTTTGCAATTGGGTCAGATGGTCTGTGTTGTCAGAG
CAGAGAGGTGAAGGAGTGGCATGGGTGCAGAGCGACTAGAGGACTGCTGAGAGGGAAGCACTAC
TACGAAGTATCCTGTCATGACCAAGGGCTGTGCAGAGTTGGGTGGTCCACCATGCAGGCTTCCT
TAGACCTGGGTACTGACAAGTTTGGATTTGGCTTCGGTGGAACAGGAAAGAAATCTCATAATAA
ACAATTTGATAATTATGGAGAGGAATTCACTATGCATGACACCATTGGATGTTACTTAGACATC
GATAAAGGGCACGTGAAGTTCTCTAAGAATGGAAAAGACCTTGGTCTGGCATTTGAAATACCTG
CACACATAAAAAACCAAGCCCTCTTCCCTGCCTGTGTTTTGAAGAATGCTGAATTGAAATTTAA
CTTTGGTGAAGAAGAATTTAAGTTTCCACCAAAAGATGGTTTTGTTGCTCTTTCCAAGGCCCCT
GATAGTTACGTCGTCAAATCGCAGCACACAGGTAATGCACAGGTGTCACAAACAAAATTTCTCC
CTAATGCTCCAAAAGCTCTTATTGTGGAACCCTCCAGAGAGTTAGCTGAGCAAACCTTGAACAA
TGTGAAACAGTTTAAGAAGTACATCGATAATCCTAAATTGCGGGAGCTTCTCATAATTGGTGGC
GTTGCAGCTCGGGATCAGCTCTCCGTTCTGGATAATGGGGTTGATATTGTCGTCGGTACTCCAG
GAAGATTAGATGATTTGGTGTCAACTGGAAAGCTCAACTTGTCTCAAGTTAGATTCCTGGTCCT
GGATGAAGCAGATGGGCTTCTCTCTCAAGGTTATTCTGACTTTATTAACAGGATGCACAACCAG
ATTCCTCAGATTACTTCTGATGGGAAAAGACTTCAGGTGATTGTTTGCTCTGCTACTCTGCATT
CTTTTGATGTAAAGAAACTATCTGAGAAGATAATGCATTTTCCCACGTGGGTGGATTTGAAAGG
AGAAGATTCTGTTCCTGATACTGTGCATCATGTCGTTGTTCCTGTGAACCCAAAAACTGACAGG
CTCTGGGAAAGGCTGGGGAAGAACCACATTCGAACCGATGATGTCCATGCAAAGGATAACACAA
GACCTGGTGCCAACAGTCCAGAGATGTGGTCTGAAGCTATTAAAATACTGAAGGGGGAGTATGC
TGTCCGAGCAATCAAGGAGCACAAGATGGATCAAGCAATTATCTTCTGTAGAACGAAAATTGAC
TGTGACAACTTGGAGCAGTACTTTATGCAGCAAGGAGGAGGACCTGATAAAAAAGGACACCAAT
TCTCATGTGTATGTCTTCATGGTGACAGAAAGCCTCACGAGAGAAAGCAGAACTTGGAACGATT
TAAGAAAGGAGACGTAAGATTCCTGATTTGCACAGACGTAGCTGCCAGAGGAATTGACATCCAC
GGTGTTCCTTATGTTATTAATGTCACCCTGCCTGATGAAAAGCAGAATTATGTGCACCGGATTG
GCAGAGTGGGGCGAGCTGAAAGGATGGGCCTGGCTATTTCCCTGGTGGCAACAGAGAAAGAAAA
GGTTTGGTATCACGTATGCAGCAACCGTGGGAAGGGATGCTATAACACTAGACTCAAGGAAGAT
GGCGGCTGTACTATCTGGTACAATGAAATGCAGCTACTTTCTGAGATAGAAGAACACCTGAACT
GTACCATTTCCCAGGTTGAGCCAGATATAAAGGTTCCAGTGGATGAGTTTGATGGGAAAGTTAC
ATATGGTCAGAAAAGAGCTGCTGGCGGTGGGAACTATAAAGGCCATGTGGACATCCTGGCACCT
ACCGTTCAAGAGTTGGCTGCCCTTGAAAAGGAAGCACAGACATCTTTCCTACACCTTGGCTACC
TTCCCAACCAGCTGTTCAGAACCTTCTGATTTCATGTAGATGGAGAAGGATTGGAGTAATCGCG
TCTGTAGTCTTAACTTAACGTGGTGGTGCTTCTGAGCACAGTGTTTACAGTAGCTGAACTATTA
CTGCTAACTCTGCATGTCGGCAAACACAAATCTTAGGAGTTCTTCATAAAATGGCCGCCTAATG
AAAATAAATTGGACAACTATATTTTCATGAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_445866	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAF81015	(Get FASTA)	NCBI Sequence Viewer
	AAF81016	(Get FASTA)	NCBI Sequence Viewer
	AAH82049	(Get FASTA)	NCBI Sequence Viewer
	EDM03114	(Get FASTA)	NCBI Sequence Viewer
	EDM03115	(Get FASTA)	NCBI Sequence Viewer
	EDM03116	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000009100
	ENSRNOP00000009100.5
GenBank Protein	Q641Y8	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_445866 ⟸ NM_053414

- UniProtKB:

Q641Y8 (UniProtKB/Swiss-Prot), A6HAQ9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAAFSEMGVMPEIAQAVEEMDWLLPTDIQAESIPLILGGGDVLMAAETGSGKTGAFSIPVIQIV
YETLKDQQEGKKGKATIKTGASVLNKWQMNPYDRGSAFAIGSDGLCCQSREVKEWHGCRATRGL
LRGKHYYEVSCHDQGLCRVGWSTMQASLDLGTDKFGFGFGGTGKKSHNKQFDNYGEEFTMHDTI
GCYLDIDKGHVKFSKNGKDLGLAFEIPAHIKNQALFPACVLKNAELKFNFGEEEFKFPPKDGFV
ALSKAPDSYVVKSQHTGNAQVSQTKFLPNAPKALIVEPSRELAEQTLNNVKQFKKYIDNPKLRE
LLIIGGVAARDQLSVLDNGVDIVVGTPGRLDDLVSTGKLNLSQVRFLVLDEADGLLSQGYSDFI
NRMHNQIPQITSDGKRLQVIVCSATLHSFDVKKLSEKIMHFPTWVDLKGEDSVPDTVHHVVVPV
NPKTDRLWERLGKNHIRTDDVHAKDNTRPGANSPEMWSEAIKILKGEYAVRAIKEHKMDQAIIF
CRTKIDCDNLEQYFMQQGGGPDKKGHQFSCVCLHGDRKPHERKQNLERFKKGDVRFLICTDVAA
RGIDIHGVPYVINVTLPDEKQNYVHRIGRVGRAERMGLAISLVATEKEKVWYHVCSNRGKGCYN
TRLKEDGGCTIWYNEMQLLSEIEEHLNCTISQVEPDIKVPVDEFDGKVTYGQKRAAGGGNYKGH
VDILAPTVQELAALEKEAQTSFLHLGYLPNQLFRTF

hide sequence

Ensembl Acc Id:

ENSRNOP00000009100 ⟸ ENSRNOT00000009100

Protein Domains

B30.2/SPRY DEAD-box RNA helicase Q DEAD/DEAH box helicase Helicase ATP-binding Helicase C-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q641Y8-F1-model_v2	AlphaFold	Q641Y8	1-740	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13694499

Promoter ID:

EPDNEW_R5024

Type:

initiation region

Name:

Ddx1_1

Description:

DEAD-box helicase 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	6	38,453,750 - 38,453,810	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:619903	AgrOrtholog
BioCyc Gene	G2FUF-38124	BioCyc
Ensembl Genes	ENSRNOG00000006652	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000009100	ENTREZGENE
	ENSRNOT00000009100.7	UniProtKB/Swiss-Prot
Gene3D-CATH	2.60.120.920	UniProtKB/Swiss-Prot
	3.40.50.300	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7131804	IMAGE-MGC_LOAD
InterPro	B30.2/SPRY	UniProtKB/Swiss-Prot
	B30.2/SPRY_sf	UniProtKB/Swiss-Prot
	ConA-like_dom_sf	UniProtKB/Swiss-Prot
	DEAD/DEAH_box_helicase_dom	UniProtKB/Swiss-Prot
	Helicase_ATP-bd	UniProtKB/Swiss-Prot
	Helicase_C	UniProtKB/Swiss-Prot
	P-loop_NTPase	UniProtKB/Swiss-Prot
	RNA_helicase_DEAD_Q_motif	UniProtKB/Swiss-Prot
	SPRY_dom	UniProtKB/Swiss-Prot
KEGG Report	rno:84474	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:95195	IMAGE-MGC_LOAD
NCBI Gene	84474	ENTREZGENE
PANTHER	RNA HELICASE	UniProtKB/Swiss-Prot
Pfam	DEAD	UniProtKB/Swiss-Prot
	Helicase_C	UniProtKB/Swiss-Prot
	SPRY	UniProtKB/Swiss-Prot
PhenoGen	Ddx1	PhenoGen
PROSITE	B302_SPRY	UniProtKB/Swiss-Prot
	HELICASE_ATP_BIND_1	UniProtKB/Swiss-Prot
	HELICASE_CTER	UniProtKB/Swiss-Prot
	Q_MOTIF	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000006652	RatGTEx
SMART	DEXDc	UniProtKB/Swiss-Prot
	HELICc	UniProtKB/Swiss-Prot
	SPRY	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF49899	UniProtKB/Swiss-Prot
	SSF52540	UniProtKB/Swiss-Prot
UniProt	A6HAQ9	ENTREZGENE, UniProtKB/TrEMBL
	A6HAR0_RAT	UniProtKB/TrEMBL
	A6HAR1_RAT	UniProtKB/TrEMBL
	DDX1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q9JIJ7_RAT	UniProtKB/TrEMBL
	Q9JIJ8_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-10-05	Ddx1	DEAD-box helicase 1	Ddx1	DEAD/H-box helicase 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-01-13	Ddx1	DEAD/H-box helicase 1	Ddx1	DEAD (Asp-Glu-Ala-Asp) box helicase 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-07-16	Ddx1	DEAD (Asp-Glu-Ala-Asp) box helicase 1	Ddx1	DEAD (Asp-Glu-Ala-Asp) box polypeptide 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Ddx1	DEAD (Asp-Glu-Ala-Asp) box polypeptide 1		DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 1	Name updated	1299863	APPROVED
2002-08-07	Ddx1	DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 1			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_regulation	expression is amplified in estrogen-dependent endometrial adenocarcinoma	632515

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD