Advanced Search (OLGA)

Gene: Rtp2 (receptor (chemosensory) transporter protein 2) Rattus norvegicus

Analyze

Symbol:

Rtp2

Name:

receptor (chemosensory) transporter protein 2

RGD ID:

1565722

Description:

Predicted to enable olfactory receptor binding activity. Predicted to be involved in detection of chemical stimulus involved in sensory perception of bitter taste; protein insertion into membrane; and protein targeting to membrane. Predicted to be located in membrane. Predicted to be active in cell surface. Orthologous to human RTP2 (receptor transporter protein 2); INTERACTS WITH bisphenol A; testosterone; 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ortholog).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC303835; receptor transporter protein 2; receptor-transporting protein 2; RGD1565722; similar to Receptor transporting protein 2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RTP2 (receptor transporter protein 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Rtp2 (receptor transporter protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rtp2 (receptor transporter protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RTP2 (receptor transporter protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RTP2 (receptor transporter protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rtp2 (receptor transporter protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RTP2 (receptor transporter protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RTP2 (receptor transporter protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rtp2 (receptor transporter protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Rtp2 (receptor transporter protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	IFT81 (intraflagellar transport 81)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	RTP2 (receptor transporter protein 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Rtp2 (receptor transporter protein 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	si:ch211-276k2.2	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	si:ch211-276k2.1	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	rtp3	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder)
Xenopus tropicalis (tropical clawed frog):	rtp3	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	rtp3a.3	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	rtp3b	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	11	90,422,553 - 90,436,684 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	11	90,422,553 - 90,434,975 (+)	Ensembl				GRCr8
mRatBN7.2	11	76,917,904 - 76,930,760 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	76,917,904 - 76,930,327 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	11	85,683,400 - 85,688,323 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	11	78,318,613 - 78,323,536 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	11	77,397,705 - 77,402,628 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	11	80,319,177 - 80,331,599 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	80,319,177 - 80,331,599 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	11	80,401,494 - 80,429,935 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	11	79,092,578 - 79,098,266 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	11	75,798,200 - 75,809,685 (+)	NCBI		Celera
Cytogenetic Map	11	q23	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,4,4'-trichlorobiphenyl (ISO)

bisphenol A (EXP)

CGP 52608 (ISO)

folic acid (ISO)

lipopolysaccharide (ISO)

PCB138 (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

testosterone (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

detection of chemical stimulus involved in sensory perception of bitter taste (IBA)

protein insertion into membrane (IBA,IEA,ISO)

protein targeting to membrane (IBA)

Cellular Component

cell surface (IBA,IEA,ISO)

membrane (IEA)

Molecular Function

metal ion binding (IEA)

olfactory receptor binding (IBA,IEA,ISO)

protein binding (ISO)

zinc ion binding (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:15550249

Genomics

Comparative Map Data

Rtp2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	11	90,422,553 - 90,436,684 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	11	90,422,553 - 90,434,975 (+)	Ensembl				GRCr8
mRatBN7.2	11	76,917,904 - 76,930,760 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	76,917,904 - 76,930,327 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	11	85,683,400 - 85,688,323 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	11	78,318,613 - 78,323,536 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	11	77,397,705 - 77,402,628 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	11	80,319,177 - 80,331,599 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	80,319,177 - 80,331,599 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	11	80,401,494 - 80,429,935 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	11	79,092,578 - 79,098,266 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	11	75,798,200 - 75,809,685 (+)	NCBI		Celera
Cytogenetic Map	11	q23	NCBI

RTP2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	187,698,259 - 187,715,691 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	187,698,259 - 187,702,656 (-)	Ensembl			hg38	GRCh38
GRCh37	3	187,416,047 - 187,420,345 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	188,898,741 - 188,903,039 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	3	185,847,022 - 185,851,326 (-)	NCBI		Celera
Cytogenetic Map	3	q27.3	NCBI
HuRef	3	184,820,228 - 184,824,522 (-)	NCBI		HuRef
CHM1_1	3	187,379,307 - 187,383,611 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	3	190,515,702 - 190,533,149 (-)	NCBI		T2T-CHM13v2.0

Rtp2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	16	23,744,298 - 23,749,544 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	16	23,744,298 - 23,751,144 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	16	23,925,548 - 23,930,794 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	16	23,925,548 - 23,932,394 (-)	Ensembl			mm10	GRCm38
MGSCv37	16	23,925,634 - 23,930,880 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	16	23,840,897 - 23,846,143 (-)	NCBI		MGSCv36	mm8
Celera	16	24,475,557 - 24,480,804 (-)	NCBI		Celera
Cytogenetic Map	16	B1	NCBI
cM Map	16	15.12	NCBI

Rtp2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955420	20,043,153 - 20,047,082 (+)	Ensembl
ChiLan1.0	NW_004955420	20,043,153 - 20,047,082 (+)	NCBI	ChiLan1.0	ChiLan1.0

RTP2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	185,569,040 - 185,586,485 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	185,573,784 - 185,591,199 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	184,724,924 - 184,729,201 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	193,285,134 - 193,289,417 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	193,284,970 - 193,289,417 (-)	Ensembl			panPan2	panpan1.1

RTP2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	34	20,087,395 - 20,091,248 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	34	20,087,226 - 20,115,428 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	34	24,180,280 - 24,184,080 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	34	20,007,412 - 20,011,212 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	34	20,007,243 - 20,047,268 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	34	20,036,044 - 20,039,837 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	34	20,029,799 - 20,033,599 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	34	20,269,685 - 20,273,481 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Rtp2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	116,327,592 - 116,332,201 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936578	2,419,589 - 2,423,455 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936578	2,419,589 - 2,423,455 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RTP2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	125,355,018 - 125,358,738 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	13	125,355,018 - 125,358,738 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	134,638,577 - 134,642,298 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RTP2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	15	81,974,322 - 81,982,793 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	15	81,974,561 - 81,978,207 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666041	55,472,123 - 55,476,438 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rtp2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624730	69,177,075 - 69,187,800 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624730	69,184,639 - 69,188,318 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Rtp2
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	4	8,708,430 - 8,713,380 (-)	NCBI		Rrattus_CSIRO_v1

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	23
Count of miRNA genes:	23
Interacting mature miRNAs:	23
Transcripts:	ENSRNOT00000036777
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
70208	Niddm22	Non-insulin dependent diabetes mellitus QTL 22	3.61		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	11	73308487	96070872	Rat
724554	Iddm17	Insulin dependent diabetes mellitus QTL 17		0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	11	46443168	91443168	Rat
1581565	Pur10	Proteinuria QTL 10		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	11	58272363	96350770	Rat
4889859	Pur28	Proteinuria QTL 28	19.5	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	11	58928336	99753367	Rat
1549848	Bvd6	Brain ventricular dilatation QTL 6	3.1	0.0001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	11	79618519	99753367	Rat
10058954	Gmadr7	Adrenal mass QTL 7	2.49	0.0049	adrenal gland mass (VT:0010420)	both adrenal glands wet weight to body weight ratio (CMO:0002411)	11	73850894	99753367	Rat
2298551	Neuinf10	Neuroinflammation QTL 10	3.7		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	11	58931822	92356038	Rat
1300135	Rf19	Renal function QTL 19	3.38		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	11	54415391	96071021	Rat
1354656	Bvd3	Brain ventricular dilatation QTL 3	3.64	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	11	82951028	96351019	Rat
2312566	Glom20	Glomerulus QTL 20	3.6	0.001	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	11	57754837	96071021	Rat
724563	Uae10	Urinary albumin excretion QTL 10	6		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	11	20193549	96351019	Rat
724561	Plsm4	Polydactyly-luxate syndrome (PLS) morphotypes QTL 4		0.0003	forelimb integrity trait (VT:0010562)	front foot phalanges count (CMO:0001947)	11	67962184	99753367	Rat
631506	Bp104	Blood pressure QTL 104	2.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	11	73308315	99753367	Rat
4889521	Gluco62	Glucose level QTL 62	2.82	0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	11	68599321	96497754	Rat
7411658	Foco27	Food consumption QTL 27	16.2	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	11	69855943	99753367	Rat
1581572	Uae35	Urinary albumin excretion QTL 35		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	11	58272363	96350770	Rat
1300110	Stl7	Serum triglyceride level QTL 7	4.64		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	11	51071021	96071021	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system
3	9	11	42	15	13	8	1	8	4	63	26	1	33	20	11	5

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001107083	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039088296	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473999	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000011	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000036777 ⟹ ENSRNOP00000036068

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	11	90,422,553 - 90,434,975 (+)	Ensembl
mRatBN7.2 Ensembl	11	76,917,904 - 76,930,327 (+)	Ensembl
Rnor_6.0 Ensembl	11	80,319,177 - 80,331,599 (+)	Ensembl

RefSeq Acc Id:

NM_001107083 ⟹ NP_001100553

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	90,422,553 - 90,434,975 (+)	NCBI
mRatBN7.2	11	76,917,904 - 76,930,327 (+)	NCBI
Rnor_6.0	11	80,319,177 - 80,331,599 (+)	NCBI
Rnor_5.0	11	80,401,494 - 80,429,935 (-)	NCBI
RGSC_v3.4	11	79,092,578 - 79,098,266 (+)	RGD
Celera	11	75,798,200 - 75,809,685 (+)	RGD

Sequence:

show sequence

CTTTCACTGCCATTTGATCTGGGAACACTGGTATAGCACATCTCAGAGCTGGACCACCACACTC
AGCTCTAGGTCAGGCCAAATCTCTCAGCTTCCTTCAGTTCCTGGGAATTCATGGTCCTGCACAT
AACCTGTTTTGAGGCTGATTATAGGAGAGTCCCCAGATTAGGGAACCAGAGCCTTAGGTTAAAG
AAGTGACAGGTGAGGGACTACAGATATCACAGAAACCTCACGGTGCCCTGGGCAGAACCAGGAC
CATGTCCACCAGCCTGACCACTTGTGAGTGGAAGAAGGTCTTCTATGAGAAGATGGAGGTGGCA
AAGCCAGCGGATAGCTGGGAGCTCATCATAGACCCCAATCTCAAACCCAATGAGCTGGGCCCTG
GCTGGAAGCAGTACCTGGAACAGCATGCCTCAGGCAGGTTCCACTGTTCTTGGTGCTGGCACAC
CTGGCAGTCTGCCAATGTGGTCATCCTCTTCCACATGCACCTGGACCGTGCCCAGCGTGTTGGC
TCAGTGCGCATGCGTGTGTTCAAGCAGCTGTGCTACCAGTGCGGCACCTCACGGCTGGACGAGT
CCAGCATGCTGGAGGAGAACATCGAGGGCCTGGTGGACAACCTCATCACCAGTCTGCGCGAGCA
GTGCTACGACGAGGATGGGGGCCAGTATCGCATCCACGTGGCCAGCCGGCCCGACACCGGATTG
CACCGCAGCGAGTTCTGCGAGGCTTGCCAGGAAGGCATCGTGCACTGGAAGCCCAGCGAGAAGC
TGCTGGAGGAGGACGCCGCCTTCACCGATGACTCCAAGAGGAAGGGCCAAGCTGGTTTTATCTC
CGACTTCTTCTCATTTCGCTGGTGCCTTTTCTGGGGTGCCCTCTGCCTGGTCATTGTCTACCTG
CAGTTCTTCCGAGGCCGCTCGGGATTCCTTTAATGGGGTTGG

hide sequence

RefSeq Acc Id:

XM_039088296 ⟹ XP_038944224

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	90,430,665 - 90,436,684 (+)	NCBI
mRatBN7.2	11	76,926,016 - 76,930,760 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001100553	(Get FASTA)	NCBI Sequence Viewer
	XP_038944224	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL78096	(Get FASTA)	NCBI Sequence Viewer
	EDL78097	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000036068
	ENSRNOP00000036068.4

RefSeq Acc Id:

NP_001100553 ⟸ NM_001107083

- UniProtKB:

D3ZCW1 (UniProtKB/TrEMBL), A6JS11 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSTSLTTCEWKKVFYEKMEVAKPADSWELIIDPNLKPNELGPGWKQYLEQHASGRFHCSWCWHT
WQSANVVILFHMHLDRAQRVGSVRMRVFKQLCYQCGTSRLDESSMLEENIEGLVDNLITSLREQ
CYDEDGGQYRIHVASRPDTGLHRSEFCEACQEGIVHWKPSEKLLEEDAAFTDDSKRKGQAGFIS
DFFSFRWCLFWGALCLVIVYLQFFRGRSGFL

hide sequence

Ensembl Acc Id:

ENSRNOP00000036068 ⟸ ENSRNOT00000036777

RefSeq Acc Id:	XP_038944224 ⟸ XM_039088296
- Peptide Label:	isoform X1

Protein Domains

3CxxC-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZCW1-F1-model_v2	AlphaFold	D3ZCW1	1-223	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1565722	AgrOrtholog
BioCyc Gene	G2FUF-20885	BioCyc
Ensembl Genes	ENSRNOG00000022160	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000036777	ENTREZGENE
	ENSRNOT00000036777.6	UniProtKB/TrEMBL
InterPro	R-trans_p	UniProtKB/TrEMBL
	zf-3CxxC	UniProtKB/TrEMBL
KEGG Report	rno:303835	UniProtKB/TrEMBL
NCBI Gene	303835	ENTREZGENE
PANTHER	PTHR14402	UniProtKB/TrEMBL
	RECEPTOR-TRANSPORTING PROTEIN 2	UniProtKB/TrEMBL
Pfam	zf-3CxxC	UniProtKB/TrEMBL
PhenoGen	Rtp2	PhenoGen
RatGTEx	ENSRNOG00000022160	RatGTEx
SMART	zf-3CxxC	UniProtKB/TrEMBL
UniProt	A6JS11	ENTREZGENE, UniProtKB/TrEMBL
	D3ZCW1	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-10-30	Rtp2	receptor (chemosensory) transporter protein 2	Rtp2	receptor transporter protein 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Rtp2	receptor transporter protein 2	Rtp2_predicted	receptor transporter protein 2 (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-30	Rtp2_predicted	receptor transporter protein 2 (predicted)	RGD1565722_predicted	similar to Receptor transporting protein 2 (predicted)	Symbol and Name updated	1299863	APPROVED
2006-03-07	RGD1565722_predicted	similar to Receptor transporting protein 2 (predicted)	LOC303835	similar to Receptor transporting protein 2	Symbol and Name status set to approved	1299863	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message